BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS002H02

Length=415
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             181   3e-52   Nicotiana benthamiana
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    181   3e-52   Nicotiana sylvestris
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    180   8e-52   Nicotiana tomentosiformis
emb|CDP18560.1|  unnamed protein product                                177   1e-50   Coffea canephora [robusta coffee]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    173   4e-49   Nelumbo nucifera [Indian lotus]
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                173   4e-49   Arachis hypogaea [goober]
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    167   5e-47   Solanum tuberosum [potatoes]
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         167   5e-47   Morus notabilis
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    166   9e-47   Nicotiana tabacum [American tobacco]
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    166   2e-46   Solanum lycopersicum
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    166   2e-46   Solanum lycopersicum
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    165   4e-46   Fragaria vesca subsp. vesca
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    165   4e-46   Sesamum indicum [beniseed]
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         164   7e-46   Medicago truncatula
gb|EPS59235.1|  hypothetical protein M569_15573                         164   7e-46   Genlisea aurea
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    164   8e-46   Nelumbo nucifera [Indian lotus]
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    164   8e-46   Pyrus x bretschneideri [bai li]
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    164   2e-45   Malus domestica [apple tree]
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              163   2e-45   Scoparia dulcis [escobilla]
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    163   3e-45   Cucumis melo [Oriental melon]
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    163   3e-45   Eucalyptus grandis [rose gum]
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   4e-45   Malus domestica [apple tree]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   4e-45   Prunus mume [ume]
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    162   5e-45   Theobroma cacao [chocolate]
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    162   5e-45   Cicer arietinum [garbanzo]
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    161   1e-44   Ricinus communis
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             161   2e-44   Prunus persica
gb|ABK96233.1|  unknown                                                 160   2e-44   Populus trichocarpa x Populus deltoides
gb|KJB11771.1|  hypothetical protein B456_001G276400                    160   2e-44   Gossypium raimondii
gb|ABK96725.1|  unknown                                                 160   2e-44   Populus trichocarpa x Populus deltoides
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       160   2e-44   Medicago sativa [alfalfa]
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   3e-44   Populus euphratica
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    159   3e-44   Gossypium arboreum [tree cotton]
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                160   3e-44   Bruguiera gymnorhiza [Burma mangrove]
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             160   4e-44   Cucumis sativus [cucumbers]
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    160   4e-44   
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    159   7e-44   
gb|KJB70723.1|  hypothetical protein B456_011G088800                    159   1e-43   Gossypium raimondii
gb|ACU21011.1|  unknown                                                 158   1e-43   Glycine max [soybeans]
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    157   2e-43   Gossypium arboreum [tree cotton]
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    158   2e-43   Glycine soja [wild soybean]
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    158   2e-43   Glycine soja [wild soybean]
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    158   2e-43   
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             158   2e-43   
gb|ABK94956.1|  unknown                                                 158   2e-43   Populus trichocarpa [western balsam poplar]
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    158   2e-43   Cucumis melo [Oriental melon]
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             157   2e-43   Citrus clementina [clementine]
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    157   3e-43   Pisum sativum [garden pea]
emb|CAA33264.1|  unnamed protein product                                157   3e-43   Pisum sativum [garden pea]
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             157   3e-43   Capsella rubella
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   4e-43   
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    157   4e-43   Arabis alpina [alpine rockcress]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                157   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    157   5e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875330.1|  gapa                                               157   5e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   5e-43   Populus euphratica
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    157   5e-43   
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   5e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             157   6e-43   Eutrema salsugineum [saltwater cress]
gb|AGJ50596.1|  GAPDH                                                   156   8e-43   Pericallis cruenta
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             156   1e-42   Eutrema salsugineum [saltwater cress]
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    156   1e-42   Brassica rapa
gb|AGV54738.1|  glyceraldehyde-3-phosphate dehydrogenase A chloro...    154   1e-42   Phaseolus vulgaris [French bean]
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             156   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   1e-42   Citrus sinensis [apfelsine]
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                155   2e-42   Mangifera indica
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    155   2e-42   Brassica rapa
emb|CDY19412.1|  BnaC05g09210D                                          155   2e-42   Brassica napus [oilseed rape]
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               155   2e-42   Brassica rapa subsp. chinensis [bok-choy]
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    155   2e-42   Arabis alpina [alpine rockcress]
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   155   2e-42   Citrus sinensis [apfelsine]
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                156   2e-42   Erythranthe guttata [common monkey flower]
tpg|DAA37468.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         151   2e-42   
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   155   3e-42   Citrus sinensis [apfelsine]
emb|CBI21236.3|  unnamed protein product                                152   3e-42   Vitis vinifera
emb|CDY26599.1|  BnaA09g46780D                                          155   3e-42   Brassica napus [oilseed rape]
dbj|BAJ34149.1|  unnamed protein product                                155   3e-42   Eutrema halophilum
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          154   4e-42   Amborella trichopoda
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              154   4e-42   Phaseolus vulgaris [French bean]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             154   5e-42   Phaseolus vulgaris [French bean]
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    154   6e-42   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY13649.1|  BnaA06g32740D                                          154   6e-42   Brassica napus [oilseed rape]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    154   7e-42   Brassica rapa
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    154   7e-42   Spinacia oleracea
emb|CDY28536.1|  BnaC02g36240D                                          153   8e-42   Brassica napus [oilseed rape]
emb|CDX83635.1|  BnaC07g23750D                                          153   9e-42   
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    154   9e-42   
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    154   1e-41   
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             153   1e-41   
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    153   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002892719.1|  GAPA-2                                             153   1e-41   Arabidopsis lyrata subsp. lyrata
emb|CAN78872.1|  hypothetical protein VITISV_021726                     152   2e-41   Vitis vinifera
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    152   2e-41   Vitis vinifera
emb|CDY16038.1|  BnaC08g40850D                                          152   2e-41   Brassica napus [oilseed rape]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    152   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    152   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         152   2e-41   Jatropha curcas
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    152   3e-41   Setaria italica
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    151   6e-41   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         151   7e-41   
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    151   8e-41   Tarenaya hassleriana [spider flower]
gb|KHN13412.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    147   9e-41   Glycine soja [wild soybean]
emb|CAA30152.1|  GADPH (383 AA)                                         150   1e-40   Zea mays [maize]
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    150   1e-40   Zea mays [maize]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        150   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    149   3e-40   
emb|CDY48981.1|  BnaA02g28150D                                          149   3e-40   Brassica napus [oilseed rape]
ref|NP_001052984.1|  Os04g0459500                                       149   4e-40   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    149   4e-40   Oryza brachyantha
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    149   4e-40   
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    148   5e-40   
gb|AAA33484.1|  glyceraldehyde-3-phosphate dehydrogenase precursor      142   5e-40   Zea mays [maize]
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    147   2e-39   Brachypodium distachyon [annual false brome]
gb|ABK25233.1|  unknown                                                 146   5e-39   Picea sitchensis
gb|ACN40000.1|  unknown                                                 146   5e-39   Picea sitchensis
gb|ABK24313.1|  unknown                                                 146   5e-39   Picea sitchensis
gb|ACN40537.1|  unknown                                                 146   5e-39   Picea sitchensis
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    145   5e-39   Triticum urartu
dbj|BAJ90885.1|  predicted protein                                      146   5e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    144   1e-38   Pyrus x bretschneideri [bai li]
dbj|BAJ90530.1|  predicted protein                                      145   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               144   3e-38   Marchantia polymorpha
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             143   3e-38   
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      143   4e-38   Arabidopsis thaliana [mouse-ear cress]
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    142   6e-38   Marchantia polymorpha
ref|XP_010458726.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    140   1e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    141   3e-37   
gb|AAF03099.1|AF162198_1  NADP-dependent glyceraldehyde phosphate...    134   5e-37   Lactuca sativa [cultivated lettuce]
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     139   7e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001771209.1|  predicted protein                                  140   9e-37   
gb|AAF19788.1|AF162202_1  NADP-dependent glyceraldehyde phosphate...    132   1e-36   Lactuca sativa [cultivated lettuce]
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  140   1e-36   Pinus sylvestris [Scotch pine]
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             139   2e-36   Selaginella moellendorffii
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             139   2e-36   Selaginella moellendorffii
gb|AAB82133.1|  glyceralehyde-3-phosphate dehydrogenase subunit         138   3e-36   Oryza sativa Indica Group [Indian rice]
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    137   8e-36   
dbj|BAH57068.1|  AT1G12900                                              136   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001779769.1|  predicted protein                                  137   1e-35   
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    135   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    136   4e-35   
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              132   2e-34   Brassica rapa subsp. chinensis [bok-choy]
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    132   5e-34   
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                132   6e-34   Lilium regale
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    132   7e-34   Zea mays [maize]
ref|XP_001771246.1|  predicted protein                                  132   1e-33   
ref|XP_001766703.1|  predicted protein                                  130   3e-33   
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               126   5e-32   Capsicum annuum
ref|XP_001753934.1|  predicted protein                                  127   6e-32   
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     127   7e-32   Physcomitrella patens
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               125   1e-31   Capsicum annuum
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                125   2e-31   Syntrichia caninervis
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    124   2e-31
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    124   3e-31   Spinacia oleracea
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    124   3e-31   Spinacia oleracea
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    124   4e-31   Spinacia oleracea
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               125   4e-31   Chara vulgaris
gb|ACJ85309.1|  unknown                                                 121   5e-31   Medicago truncatula
ref|XP_001779753.1|  predicted protein                                  124   6e-31   
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    122   1e-30   Spinacia oleracea
ref|XP_003603852.1|  Glyceraldehyde-3-phosphate dehydrogenase           121   2e-30   
gb|EYU41183.1|  hypothetical protein MIMGU_mgv1a025772mg                118   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    122   5e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              121   5e-30   Volvox carteri f. nagariensis
ref|XP_006383782.1|  hypothetical protein POPTR_0005s27550g             120   6e-30   
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    122   7e-30   Ricinus communis
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             121   8e-30   Prunus persica
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    121   8e-30   Prunus mume [ume]
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             121   8e-30   Selaginella moellendorffii
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    121   8e-30   Populus euphratica
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              121   9e-30   Medicago truncatula
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             121   9e-30   
gb|ACJ84309.1|  unknown                                                 121   1e-29   Medicago truncatula
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           121   1e-29   Medicago truncatula
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    121   1e-29   Setaria italica
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    120   1e-29   Spinacia oleracea
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      120   1e-29   Mesostigma viride
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    120   2e-29   Nicotiana tomentosiformis
gb|KDO85181.1|  hypothetical protein CISIN_1g012940mg                   118   2e-29   Citrus sinensis [apfelsine]
gb|KDO85183.1|  hypothetical protein CISIN_1g012940mg                   118   2e-29   Citrus sinensis [apfelsine]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    120   2e-29   Mesostigma viride
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           120   2e-29   
gb|KDO85177.1|  hypothetical protein CISIN_1g012940mg                   119   2e-29   Citrus sinensis [apfelsine]
gb|KJB57937.1|  hypothetical protein B456_009G186400                    118   2e-29   Gossypium raimondii
gb|KDO85179.1|  hypothetical protein CISIN_1g012940mg                   117   2e-29   Citrus sinensis [apfelsine]
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    120   2e-29   Cucumis melo [Oriental melon]
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    120   2e-29   
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    120   3e-29   
ref|XP_006435407.1|  hypothetical protein CICLE_v10001114mg             119   3e-29   
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    120   3e-29   Populus trichocarpa [western balsam poplar]
gb|KDO85176.1|  hypothetical protein CISIN_1g012940mg                   119   3e-29   Citrus sinensis [apfelsine]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             119   4e-29   
gb|KJB57939.1|  hypothetical protein B456_009G186400                    118   4e-29   Gossypium raimondii
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               118   4e-29   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   4e-29   Elaeis guineensis
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   4e-29   Nicotiana sylvestris
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   4e-29   Phoenix dactylifera
gb|ABC68431.1|  putative glyceraldehyde 3-phosphate dehydrogenase       114   5e-29   Tragopogon pratensis [Jack-go-to-bed-at-noon]
gb|ABC68432.1|  putative glyceraldehyde 3-phosphate dehydrogenase       114   5e-29   Tragopogon dubius [yellow salsify]
gb|KDO85175.1|  hypothetical protein CISIN_1g012940mg                   118   5e-29   Citrus sinensis [apfelsine]
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   6e-29   
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    119   6e-29   
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   7e-29   Solanum tuberosum [potatoes]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   7e-29   Solanum lycopersicum
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                118   7e-29   Vicia sativa [spring vetch]
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               119   7e-29   Solanum tuberosum [potatoes]
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   119   7e-29   Citrus sinensis [apfelsine]
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   8e-29   Fragaria vesca subsp. vesca
gb|ADE06487.1|  putative glyceraldehyde 3-phosphate dehydrogenase       112   8e-29   Tragopogon dubius [yellow salsify]
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             119   8e-29   Phaseolus vulgaris [French bean]
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   8e-29   Nicotiana sylvestris
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   8e-29   Populus euphratica
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              119   8e-29   Scoparia dulcis [escobilla]
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    117   8e-29   Spinacia oleracea
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    119   8e-29   Triticum urartu
dbj|BAJ86633.1|  predicted protein                                      119   8e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   8e-29   
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    119   8e-29   Gossypium arboreum [tree cotton]
dbj|BAJ87214.1|  predicted protein                                      119   8e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             118   8e-29   Micromonas pusilla CCMP1545
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    119   8e-29   Nicotiana tabacum [American tobacco]
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   8e-29   Populus euphratica
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   9e-29   Nicotiana tomentosiformis
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    119   9e-29   Citrus sinensis [apfelsine]
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           118   9e-29   Chlamydomonas reinhardtii
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             119   9e-29   Citrus clementina [clementine]
gb|ADE06488.1|  putative glyceraldehyde 3-phosphate dehydrogenase       111   9e-29   Tragopogon porrifolius [oyster plant]
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             119   1e-28   
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    118   1e-28   
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    118   1e-28   Gossypium arboreum [tree cotton]
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    117   1e-28   Chlamydomonas incerta
gb|KJB57936.1|  hypothetical protein B456_009G186400                    118   1e-28   Gossypium raimondii
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    118   1e-28   Arabis alpina [alpine rockcress]
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    118   1e-28   
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    117   1e-28   Chlamydomonas incerta
gb|ABF93790.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    114   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    117   1e-28   Dunaliella viridis
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             118   1e-28   Eutrema salsugineum [saltwater cress]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    118   1e-28   Sesamum indicum [beniseed]
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    118   1e-28   
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    118   1e-28   Pyrus x bretschneideri [bai li]
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    118   1e-28   
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    118   2e-28   Malus domestica [apple tree]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    118   2e-28   Pisum sativum [garden pea]
emb|CAA33262.1|  unnamed protein product                                118   2e-28   Pisum sativum [garden pea]
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    118   2e-28   Glycine max [soybeans]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              118   2e-28   Pyrus x bretschneideri [bai li]
ref|NP_001240080.1|  uncharacterized protein LOC100806482               118   2e-28   Glycine max [soybeans]
emb|CAN69459.1|  hypothetical protein VITISV_021576                     118   2e-28   Vitis vinifera
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    118   2e-28   Vitis vinifera
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    117   2e-28   
gb|ABR16095.1|  unknown                                                 115   2e-28   Picea sitchensis
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    117   2e-28   Pyrus x bretschneideri [bai li]
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    117   2e-28   Glycine soja [wild soybean]
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    117   2e-28   
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    117   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    117   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB14201.1|  hypothetical protein B456_002G114000                    117   2e-28   Gossypium raimondii
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    117   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    117   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    117   2e-28   Nelumbo nucifera [Indian lotus]
gb|KIY96104.1|  hypothetical protein MNEG_11860                         112   2e-28   Monoraphidium neglectum
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    117   3e-28   Cucumis sativus [cucumbers]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    117   3e-28   Brassica rapa
emb|CDY69523.1|  BnaC08g46180D                                          117   3e-28   Brassica napus [oilseed rape]
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    117   3e-28   
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         117   4e-28   Jatropha curcas
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             116   6e-28   Capsella rubella
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               115   7e-28   Spirogyra sp.
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                115   8e-28   Dunaliella salina
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    115   8e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    116   8e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    115   8e-28   Camelina sativa [gold-of-pleasure]
gb|EPS70760.1|  hypothetical protein M569_03997                         115   8e-28   Genlisea aurea
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    115   9e-28   Micromonas commoda
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    115   9e-28   
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          115   9e-28   
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            115   9e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      115   1e-27   
emb|CDP07271.1|  unnamed protein product                                115   1e-27   
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    116   1e-27   
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    115   1e-27   
gb|ACN40006.1|  unknown                                                 115   1e-27   
gb|ABK24645.1|  unknown                                                 115   1e-27   
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    115   2e-27   
gb|KHN00649.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    114   2e-27   
ref|NP_001048847.1|  Os03g0129300                                       115   2e-27   
gb|ACN40526.1|  unknown                                                 115   2e-27   
gb|ACU20783.1|  unknown                                                 114   3e-27   
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    112   1e-26   
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    112   1e-26   
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    112   1e-26   
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         115   1e-26   
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              111   2e-26   
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      111   2e-26   
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               110   2e-26   
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      111   3e-26   
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               112   3e-26   
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               110   3e-26   
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    111   3e-26   
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                110   4e-26   
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      110   5e-26   
gb|AAP80811.1|  glyceraldehyde-3-phosphate dehydrogenase precursor      106   5e-26   
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           110   6e-26   
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                110   8e-26   
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      110   9e-26   
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      109   1e-25   
ref|XP_001420043.1|  predicted protein                                  108   2e-25   
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      108   2e-25   
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               108   2e-25   
ref|XP_010270465.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    105   2e-25   
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                107   4e-25   
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase                107   4e-25   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    105   3e-24   
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    105   6e-24   
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      104   7e-24   
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           104   7e-24   
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      103   2e-23   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    103   2e-23   
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    103   3e-23   
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           103   3e-23   
gb|ACN39951.1|  unknown                                                 102   5e-23   
gb|ACN41006.1|  unknown                                                 102   7e-23   
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    101   9e-23   
ref|XP_005843104.1|  hypothetical protein CHLNCDRAFT_49269              100   1e-22   
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase              99.0    6e-22   
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B       98.6    1e-21   
gb|ADB81486.1|  glyceraldehyde-3-phosphate dehydrogenase              97.8    1e-21   
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase             97.8    2e-21   
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...  97.4    2e-21   
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    96.7    4e-21   
gb|ABR18416.1|  unknown                                               97.4    6e-21   
ref|XP_001415434.1|  predicted protein                                96.7    6e-21   
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...  97.1    6e-21   
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...  96.3    9e-21   
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339           95.5    2e-20   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase         93.6    5e-20   
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase         93.6    5e-20   
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase         93.2    7e-20   
dbj|BAK02737.1|  predicted protein                                    93.2    7e-20   
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A    92.8    2e-19   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...  92.4    3e-19   
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase         91.3    3e-19   
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  91.3    3e-19   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  90.9    4e-19   
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase         90.5    5e-19   
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  90.1    8e-19   
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase         90.1    8e-19   
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    9e-19   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    1e-18   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase         89.7    1e-18   
pdb|2D2I|A  Chain A, Crystal Structure Of Nadp-Dependent Glyceral...  90.1    1e-18   
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase         90.5    1e-18   
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase         89.4    1e-18   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase         89.4    1e-18   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase         89.4    1e-18   
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  89.4    2e-18   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase         89.0    2e-18   
ref|WP_011433307.1|  glyceraldehyde-3-phosphate dehydrogenase         89.0    2e-18   
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+       88.2    5e-18   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase         87.8    5e-18   
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  87.8    5e-18   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...  87.8    6e-18   
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase         87.8    6e-18   
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  87.4    7e-18   
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...  87.4    8e-18   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  87.4    8e-18   
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  87.0    9e-18   
gb|KJB57938.1|  hypothetical protein B456_009G186400                  87.8    1e-17   
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  87.0    1e-17   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase         86.7    1e-17   
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  86.3    2e-17   
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase         86.3    2e-17   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...  86.3    2e-17   
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  85.9    2e-17   
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  85.9    3e-17   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase         85.9    3e-17   
ref|WP_011140533.1|  glyceraldehyde-3-phosphate dehydrogenase         85.9    3e-17   
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2   85.5    3e-17   
ref|WP_011429234.1|  glyceraldehyde-3-phosphate dehydrogenase         85.5    3e-17   
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase         85.5    4e-17   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase         85.5    4e-17   
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase         85.1    4e-17   
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2       85.1    5e-17   
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase         85.1    5e-17   
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase              84.3    7e-17   
ref|WP_017327507.1|  glyceraldehyde-3-phosphate dehydrogenase         84.3    8e-17   
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           84.0    1e-16   
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           84.0    1e-16   
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           84.0    1e-16   
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2           84.0    2e-16   
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase         83.6    2e-16   
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase         83.6    2e-16   
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase         83.6    2e-16   
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase         83.6    2e-16   
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase         83.6    2e-16   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase         83.6    2e-16   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase         83.2    2e-16   
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...  83.2    2e-16   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  83.2    2e-16   
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase         83.2    3e-16   
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase         83.2    3e-16   
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  82.8    3e-16   
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  82.8    3e-16   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase         82.8    3e-16   
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase         82.8    3e-16   
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  82.8    3e-16   
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase              84.3    3e-16   
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase         82.4    4e-16   
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase         82.4    4e-16   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  82.4    4e-16   
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  82.4    4e-16   
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase         82.4    4e-16   
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase         82.4    4e-16   
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  82.4    4e-16   
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  82.4    5e-16   
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)      82.8    5e-16   
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase         82.4    5e-16   
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  82.4    5e-16   
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase         82.0    6e-16   
ref|WP_012164673.1|  glyceraldehyde-3-phosphate dehydrogenase         81.6    8e-16   
ref|WP_010475353.1|  glyceraldehyde-3-phosphate dehydrogenase         81.6    8e-16   
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase         81.6    8e-16   
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase         81.6    9e-16   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  81.6    1e-15   
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  81.3    1e-15   
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  81.3    1e-15   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  80.9    2e-15   
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase         80.9    2e-15   
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase         80.9    2e-15   
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase         80.9    2e-15   
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      80.9    2e-15   
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase         81.6    2e-15   
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)      80.9    2e-15   
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...  80.5    2e-15   
gb|AFK38236.1|  unknown                                               77.8    2e-15   
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase         80.1    3e-15   
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [       80.1    3e-15   
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  80.1    3e-15   
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase         80.1    3e-15   
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase         80.1    3e-15   
ref|WP_015224818.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  80.1    4e-15   
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase             80.1    4e-15   
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...  80.1    4e-15   
ref|WP_011057306.1|  glyceraldehyde-3-phosphate dehydrogenase         80.1    4e-15   
ref|WP_041429017.1|  glyceraldehyde-3-phosphate dehydrogenase         79.7    4e-15   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase         79.7    5e-15   
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  79.7    5e-15   
pdb|3ZCX|A  Chain A, Structure Of Gapdh From Thermosynechococcus ...  79.7    5e-15   
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase         79.7    5e-15   
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...  79.3    5e-15   
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase              79.3    7e-15   
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase         79.3    7e-15   
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase         79.0    8e-15   
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  79.0    8e-15   
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase         79.0    8e-15   
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase         79.0    9e-15   
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase         79.0    9e-15   
ref|WP_025781786.1|  glyceraldehyde-3-phosphate dehydrogenase         79.0    9e-15   
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase         78.6    1e-14   
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase         78.6    1e-14   
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase              78.6    1e-14   
emb|CAB41845.1|  glyceraldehyde-3-phosphate dehydrogenase             78.2    1e-14   
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase         78.2    2e-14   
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase         77.8    2e-14   
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  77.8    2e-14   
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase         77.8    2e-14   
ref|WP_015125741.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  77.8    2e-14   
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase         77.8    2e-14   
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase         77.8    2e-14   
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase         77.8    2e-14   
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase         77.8    2e-14   
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase              77.8    3e-14   
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase         77.4    3e-14   
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase         77.4    3e-14   
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase         77.4    3e-14   
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  77.4    3e-14   
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  77.4    3e-14   
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  77.0    3e-14   
emb|CAC85938.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  77.0    4e-14   
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase         77.0    4e-14   
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase         76.6    5e-14   
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  76.6    6e-14   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase         76.6    6e-14   
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...  76.6    6e-14   
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase         76.6    7e-14   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...  76.3    9e-14   
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase         75.5    1e-13   
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I      75.5    1e-13   
gb|AAM68968.1|AF406628_1  glyceraldehyde-3-phosphate dehydrogenase    76.3    1e-13   
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase         74.7    3e-13   
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase  74.7    3e-13   
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase         74.3    4e-13   
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase              74.3    4e-13   
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...  74.3    4e-13   
emb|CAC80998.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  73.6    5e-13   
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase         73.2    1e-12   
ref|WP_012458937.1|  glyceraldehyde-3-phosphate dehydrogenase         72.8    1e-12   
emb|CAC81003.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...  72.4    2e-12   



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  200
            MASAALSVANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  201  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  380
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  381  GIFDADVKPVG  413
            GIFDADVKPVG
Sbjct  118  GIFDADVKPVG  128



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  200
            MASAALSVANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  201  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  380
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   SKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  381  GIFDADVKPVG  413
            GIFDADVKPVG
Sbjct  118  GIFDADVKPVG  128



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   180 bits (456),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  200
            MASAAL+VANS+L QVSNKG S       SS+          DDL SVV+FQTSV+GG  
Sbjct  1    MASAALTVANSSL-QVSNKGFSEFSGLRTSSAIPFGRKTN--DDLLSVVAFQTSVIGGGN  57

Query  201  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  380
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  381  GIFDADVKPVG  413
            GIFDADVKPVG
Sbjct  118  GIFDADVKPVG  128



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 105/129 (81%), Gaps = 5/129 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  200
            MASAALSVANS+L QVSNKG S       SS      A    DDL SVV+FQTSV+GG K
Sbjct  1    MASAALSVANSSL-QVSNKGFSEFAGLRSSSLPFARKAS---DDLLSVVAFQTSVIGGGK  56

Query  201  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  380
             +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDSTL
Sbjct  57   NKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTL  116

Query  381  GIFDADVKP  407
            GIF+ADVKP
Sbjct  117  GIFEADVKP  125



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 106/131 (81%), Gaps = 3/131 (2%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  200
            MASA LSVANS L Q + KG S       SS+S     + S DDL SV++FQTSVVGG  
Sbjct  1    MASATLSVANSAL-QANGKGFSEFSGLRNSSASLPFARKAS-DDLLSVIAFQTSVVGGNG  58

Query  201  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  380
            Q+R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  59   QKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  118

Query  381  GIFDADVKPVG  413
            GIF+ADVKP G
Sbjct  119  GIFEADVKPAG  129



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 105/132 (80%), Gaps = 2/132 (2%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA   L     KG S       SSSS LPF+R++ DD HS++SFQTS VG  G
Sbjct  1    MASATLSVAKPALQGNGGKGFSEFSGLRNSSSSYLPFSRKTSDDFHSIISFQTSAVGSSG  60

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  61   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  120

Query  378  LGIFDADVKPVG  413
            LGIFDADVKPVG
Sbjct  121  LGIFDADVKPVG  132



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 100/128 (78%), Gaps = 4/128 (3%)
 Frame = +3

Query  33   AALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-KQRR  209
            AALSVAN++L +VSNKG S       SS+          DDL SV   QTS +GG K +R
Sbjct  2    AALSVANTSL-KVSNKGFSEFSGLRTSSAVPFGRKTN--DDLFSVAGLQTSAIGGRKNKR  58

Query  210  AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  389
             V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF
Sbjct  59   IVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  118

Query  390  DADVKPVG  413
            DADVKPVG
Sbjct  119  DADVKPVG  126



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   167 bits (424),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 103/132 (78%), Gaps = 3/132 (2%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA  +L Q S KG S       S++S     + S DD  SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QASGKGFSEFSGLRSSTASLPFARKASSDDFLSVIAFQTSAVGSSG  59

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG+KQASHLLKYDST
Sbjct  60   GYKKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGIKQASHLLKYDST  119

Query  378  LGIFDADVKPVG  413
            LGIF+ADVKPVG
Sbjct  120  LGIFNADVKPVG  131



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 84/89 (94%), Gaps = 1/89 (1%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            DDL SVV+FQTSV+GG   +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  31   DDLLSVVAFQTSVIGGGNSKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  90

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            DTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  91   DTGGVKQASHLLKYDSTLGIFDADVKPVG  119



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 110/136 (81%), Gaps = 6/136 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYD-DLHSVVSFQTSVVGGK  200
            MASAALSVANS++H   NKG  SEF+GLR+SS+         + DL S+V++QTSV+ G 
Sbjct  1    MASAALSVANSSVHVSKNKGSFSEFTGLRTSSAVPFGVGWKTNVDLLSLVAYQTSVISGA  60

Query  201  QRR-----AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  365
             +       VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND+GGVKQASHLLK
Sbjct  61   GKNNNNNSRVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDSGGVKQASHLLK  120

Query  366  YDSTLGIFDADVKPVG  413
            YDSTLGIFDADVKPVG
Sbjct  121  YDSTLGIFDADVKPVG  136



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 100/128 (78%), Gaps = 4/128 (3%)
 Frame = +3

Query  33   AALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-KQRR  209
            AALSVAN++L +V+NKG S       SS+          DDL SV   QTS +GG K +R
Sbjct  2    AALSVANTSL-KVNNKGFSEFSGLRTSSAVPFGRKTN--DDLFSVAGLQTSAIGGRKNKR  58

Query  210  AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  389
             V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF
Sbjct  59   IVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF  118

Query  390  DADVKPVG  413
            DADVKPVG
Sbjct  119  DADVKPVG  126



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 106/132 (80%), Gaps = 3/132 (2%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA  +  Q + KG +       SS++SL F RR+ DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPS-PQANGKGFAEFAGLRNSSAASLCFGRRTSDDLFSVIAFQTSAVGTNG  59

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              +R + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  60   GYKRGITEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  119

Query  378  LGIFDADVKPVG  413
            LGIFDA+VKPVG
Sbjct  120  LGIFDAEVKPVG  131



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 84/89 (94%), Gaps = 1/89 (1%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            DD  SV++FQTSVVGG K +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  38   DDFVSVIAFQTSVVGGGKNKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  97

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            DTGGVKQASHLLKYDSTLGIF+ADVKPVG
Sbjct  98   DTGGVKQASHLLKYDSTLGIFEADVKPVG  126



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   164 bits (416),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  203
            MASA  SVAN  L +V+ KG S       SS       + S DD HSV+SFQT+ VG   
Sbjct  1    MASATFSVANPAL-KVNGKGFSEFSGLRNSSGYLPFSRKTS-DDFHSVISFQTNAVGSSG  58

Query  204  RR---AVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            R     VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   RSKKGVVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKPVG
Sbjct  119  TLGIFDADVKPVG  131



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 1/89 (1%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            DD  SV++FQTS VGG K  R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  34   DDFFSVIAFQTSSVGGDKNSRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  93

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            DTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  94   DTGGVKQASHLLKYDSTLGIFDADVKPVG  122



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 102/131 (78%), Gaps = 3/131 (2%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  200
            MAS  LSVAN +L Q + KG S       SS+S     + S DD  SV++FQTS VGG  
Sbjct  1    MASTTLSVANPSL-QANGKGFSDFSGLRISSASLPFARKTS-DDFLSVIAFQTSAVGGSG  58

Query  201  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  380
            Q+R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDSTL
Sbjct  59   QKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTL  118

Query  381  GIFDADVKPVG  413
            GIF+ADVKP G
Sbjct  119  GIFEADVKPAG  129



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   164 bits (415),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 102/132 (77%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVIAFQTSAVGSNG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIFDADVKPVG
Sbjct  119  LGIFDADVKPVG  130



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 102/132 (77%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV++FQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVIAFQTSSVGSNG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIFDADVKPVG
Sbjct  119  LGIFDADVKPVG  130



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  329
            +D  SV++FQTS +  K +R VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND
Sbjct  38   EDFLSVIAFQTSAIDSKNKRGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  97

Query  330  TGGVKQASHLLKYDSTLGIFDADVKPVG  413
            TGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  98   TGGVKQASHLLKYDSTLGIFDADVKPVG  125



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 100/132 (76%), Gaps = 3/132 (2%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MA+A LSVA  ++ Q + KG         SS+      R S DD  S+++FQTS VG  G
Sbjct  1    MATATLSVAKPSIQQANGKGFGEFSGLRNSSTCLPFARRTS-DDFLSIIAFQTSAVGSNG  59

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  60   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  119

Query  378  LGIFDADVKPVG  413
            LGIF+ADVKP G
Sbjct  120  LGIFEADVKPAG  131



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 102/132 (77%), Gaps = 5/132 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASAALSVA  +L Q + KG +       S+S S        +D  SV++FQTS VG  G
Sbjct  1    MASAALSVAKPSL-QANGKGFAEFSGLRNSASVSFGRKNS--EDFLSVIAFQTSAVGSNG  57

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGG+KQASHLLKYDST
Sbjct  58   GYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGIKQASHLLKYDST  117

Query  378  LGIFDADVKPVG  413
            LGIF+ADVKPVG
Sbjct  118  LGIFEADVKPVG  129



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 103/132 (78%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            M+SA LSVA  +L Q + KGL+       SS+      + S DDL SV++FQTS +G  G
Sbjct  1    MSSAILSVAKPSL-QANGKGLAEFSGLRTSSACLPFGKKTS-DDLFSVITFQTSALGSNG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIFDADVKPVG
Sbjct  119  LGIFDADVKPVG  130



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 101/132 (77%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA  +L Q + KG +       S +      + S DDL SV++FQTS +G  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSLACLPFGRKTS-DDLFSVIAFQTSALGSNG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   VYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIFDADVKPVG
Sbjct  119  LGIFDADVKPVG  130



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 101/132 (77%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV+SFQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVISFQTSAVGSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIFDADVKPVG
Sbjct  119  LGIFDADVKPVG  130



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA +SVA  TL Q + KG         SSSS     + S DD  SVV+FQTS +G   
Sbjct  1    MASATVSVAKPTL-QANGKGFGEFSGLRNSSSSLPFPRKTS-DDFLSVVAFQTSALGSNN  58

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKP G
Sbjct  119  TLGIFDADVKPAG  131



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 111/134 (83%), Gaps = 6/134 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA  TL    N    SEFSGLR+S+  LPF+R++ DD HSVVSFQT+ VG  G
Sbjct  1    MASATLSVAKPTLK--GNGKGFSEFSGLRNSTGYLPFSRKTSDDFHSVVSFQTNAVGSNG  58

Query  198  KQRRA--VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
              +R   VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYD
Sbjct  59   GYKRGGVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYD  118

Query  372  STLGIFDADVKPVG  413
            STLGIFDADVKPVG
Sbjct  119  STLGIFDADVKPVG  132



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA  SVA  +L Q + KG         SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATFSVAKPSL-QGNGKGFQEFSGLRNSSAFLPFSKKTS-DDFLSVVAFQTSAVGSSN  58

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKTVAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKPVG
Sbjct  119  TLGIFDADVKPVG  131



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 100/132 (76%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA  +L Q + KG +       SS+      + S DDL SV+SFQTS VG  G
Sbjct  1    MASAILSVAKPSL-QANGKGFAEFSGLRTSSACLPFGRKTS-DDLFSVISFQTSAVGSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  119  LGIFDADVKPAG  130



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSAMGNSS  58

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKPVG
Sbjct  119  TLGIFDADVKPVG  131



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 82/91 (90%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA  320
            DD  SV++FQTS +G   G  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA
Sbjct  40   DDFQSVIAFQTSALGINNGGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA  99

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIF+ADVKPVG
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFEADVKPVG  130



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSAMGNSS  58

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKPVG
Sbjct  119  TLGIFDADVKPVG  131



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVAN  L +V+ KG S       SS       + S DD HSV+S QT+ VG  G
Sbjct  1    MASATFSVANPAL-KVNGKGFSEFSGLRNSSGYLPFSRKTS-DDFHSVISVQTNAVGSSG  58

Query  198  KQRRAVV-EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            + R+ VV EAK+KVAINGFGR GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   RSRKGVVVEAKIKVAINGFGRTGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKPVG
Sbjct  119  TLGIFDADVKPVG  131



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS  G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSATGNSS  58

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKPVG
Sbjct  119  TLGIFDADVKPVG  131



>gb|KHG29734.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=360

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 82/91 (90%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA  320
            DD  SV++FQTS +G   G  ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA
Sbjct  40   DDFQSVIAFQTSALGINNGGYQKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA  99

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIF+ADVKPVG
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFEADVKPVG  130



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA LSVA  +  Q + KG +       SS+      + S DD  SVV+FQTS +    
Sbjct  1    MASATLSVAKPSHLQANGKGFTEFSGLRNSSAFLPFAKKTS-DDFLSVVAFQTSALASSS  59

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  RRA  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  60   GGYRRAAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  119

Query  375  TLGIFDADVKPVG  413
            TLGIF+ADVKP G
Sbjct  120  TLGIFEADVKPAG  132



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 102/132 (77%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MA+A LSVA  ++ Q + KG +       SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFAEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIF+ADVKP G
Sbjct  119  LGIFEADVKPAG  130



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 102/132 (77%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MA+A LSVA  ++ Q + KG +       SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFAEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIF+ADVKP G
Sbjct  119  LGIFEADVKPAG  130



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 101/132 (77%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MA+A LSVA  ++ Q + KG         SS+S     R S DD  SV++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFGEFSGLRNSSTSLSFARRTS-DDFLSVIAFQTSAVGSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIF+ADVKP G
Sbjct  119  LGIFEADVKPAG  130



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 106/135 (79%), Gaps = 5/135 (4%)
 Frame = +3

Query  24   MASAALSVANSTLH-QVSNKGlssefsglr-ssssslpfarrsYDDLHSVVSFQTSVVG-  194
            MASA +SVA   L  Q   KG+         +SS+SLPFAR++ DD HS+V+FQTS +G 
Sbjct  1    MASATVSVAKPNLQIQAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGS  60

Query  195  --GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  368
              G  R+ + EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY
Sbjct  61   NNGGYRKGMAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  120

Query  369  DSTLGIFDADVKPVG  413
            DSTLGIF ADVKPVG
Sbjct  121  DSTLGIFAADVKPVG  135



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 97/132 (73%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  378  LGIFDADVKPVG  413
            LG FDADVKPVG
Sbjct  119  LGTFDADVKPVG  130



>gb|KHG21941.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=363

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 103/135 (76%), Gaps = 5/135 (4%)
 Frame = +3

Query  24   MASAALSVANSTLH-QVSNKGlssefsglrssssslp-farrsYDDLHSVVSFQTSVVG-  194
            MASA +SVA   L  Q   KG+         +SS+   FAR++ DD HS+V+FQTS +G 
Sbjct  1    MASATVSVAKPNLQIQAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGS  60

Query  195  --GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  368
              G  R+ + EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY
Sbjct  61   NNGGYRKGMAEAKVKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKY  120

Query  369  DSTLGIFDADVKPVG  413
            DSTLGIF ADVKPVG
Sbjct  121  DSTLGIFAADVKPVG  135



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 97/132 (73%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  378  LGIFDADVKPVG  413
            LG FDADVKPVG
Sbjct  119  LGTFDADVKPVG  130



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 97/132 (73%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  378  LGIFDADVKPVG  413
            LG FDADVKPVG
Sbjct  119  LGTFDADVKPVG  130



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 97/132 (73%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  378  LGIFDADVKPVG  413
            LG FDADVKPVG
Sbjct  119  LGTFDADVKPVG  130



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 99/132 (75%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  197
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS+    G
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSMGNSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIFDADVKPVG
Sbjct  119  LGIFDADVKPVG  130



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 99/132 (75%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  197
            MASA  SVA  +L Q S KG +       SS+      + S DD  SVV+FQTS+    G
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSVVAFQTSMGNSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R++  EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYRKSAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIFDADVKPVG
Sbjct  119  LGIFDADVKPVG  130



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 100/132 (76%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MA+A LSVA  ++ Q + KG         SS+      R S DD  S+++FQTS VG  G
Sbjct  1    MATATLSVAKPSI-QANGKGFGEFSGLRNSSTCLPFARRTS-DDFLSIIAFQTSAVGSNG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ +VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  59   GYKKGIVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  118

Query  378  LGIFDADVKPVG  413
            LGIF+ADVKP G
Sbjct  119  LGIFEADVKPAG  130



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 101/133 (76%), Gaps = 6/133 (5%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  203
            MASA LSVA STL      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSTLQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  204  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  375  TLGIFDADVKPVG  413
            TLGIF+ADVKPVG
Sbjct  118  TLGIFEADVKPVG  130



>sp|P12858.2|G3PA_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Pisum sativum]
 emb|CAA36396.1| glyceraldehyde-3-phosphate dehydrogenase [Pisum sativum]
Length=405

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 83/92 (90%), Gaps = 4/92 (4%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG---GKQRRAVVEAK-LKVAINGFGRIGRNFLRCWHGRKDSPLDVI  317
            DD HS+V+FQT+ VG   G ++  VVEAK LKVAINGFGRIGRNFLRCWHGRKDSPLDVI
Sbjct  41   DDFHSLVTFQTNAVGSSGGHKKSLVVEAKQLKVAINGFGRIGRNFLRCWHGRKDSPLDVI  100

Query  318  AINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            AINDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  101  AINDTGGVKQASHLLKYDSTLGIFDADVKPVG  132



>emb|CAA33264.1| unnamed protein product [Pisum sativum]
Length=405

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 83/92 (90%), Gaps = 4/92 (4%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG---GKQRRAVVEAK-LKVAINGFGRIGRNFLRCWHGRKDSPLDVI  317
            DD HS+V+FQT+ VG   G ++  VVEAK LKVAINGFGRIGRNFLRCWHGRKDSPLDVI
Sbjct  41   DDFHSLVTFQTNAVGSSGGHKKSLVVEAKQLKVAINGFGRIGRNFLRCWHGRKDSPLDVI  100

Query  318  AINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            AINDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  101  AINDTGGVKQASHLLKYDSTLGIFDADVKPVG  132



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  SVV+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  94   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  123



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  94   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  123



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  34   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  93

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  94   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  123



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 97/133 (73%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA  SVA  +L Q S KG +       SS+      + S DD  S VS QTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSAVSLQTSALGSSS  58

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
            TLGIF+ADVKPVG
Sbjct  119  TLGIFEADVKPVG  131



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 96/132 (73%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVA   L Q + KG S       SS       + S +D HSV++FQT  VG  G
Sbjct  1    MASATFSVAKPAL-QANGKGFSEFSGLRSSSGFLPFSRKSS-EDFHSVIAFQTYAVGSSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSI  118

Query  378  LGIFDADVKPVG  413
            LG FDADVKPVG
Sbjct  119  LGTFDADVKPVG  130



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S+VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAI
Sbjct  38   DEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  SVV+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = +3

Query  36   ALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQRRAV  215
            A ++ANS+L QV+ KG S       SS+S   F  +S DD  S+V+ QTS VG K  +  
Sbjct  2    AFTMANSSL-QVNGKGFSEFAGLRSSSASLPAFQMKSCDDFVSMVALQTSFVG-KNSKGP  59

Query  216  VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDA  395
            VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI INDTGGVKQASHLLKYDSTLGIFDA
Sbjct  60   VEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVINDTGGVKQASHLLKYDSTLGIFDA  119

Query  396  DVKPVG  413
            DVKP G
Sbjct  120  DVKPSG  125



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 79/90 (88%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  96

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  97   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  126



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 79/90 (88%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  96

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  97   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  126



>gb|AGV54738.1| glyceraldehyde-3-phosphate dehydrogenase A chloroplastic-like 
protein [Phaseolus vulgaris]
Length=316

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 99/132 (75%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSI  118

Query  378  LGIFDADVKPVG  413
            LG FDA VKPVG
Sbjct  119  LGTFDAVVKPVG  130



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 97/133 (73%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA  SVA  +L Q S KG +       SS+      + S DD  S VS QTS +G   
Sbjct  1    MASATFSVAKPSL-QASGKGFTDFSGLRSSSAFLPFTKKTS-DDFVSAVSLQTSALGSSS  58

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R++  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  59   GGYRKSAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
            TLGIF ADVKPVG
Sbjct  119  TLGIFAADVKPVG  131



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 79/90 (88%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S VSFQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSFVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 100/133 (75%), Gaps = 6/133 (5%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  203
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  204  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  375  TLGIFDADVKPVG  413
            TLGIF+ADVKPVG
Sbjct  118  TLGIFEADVKPVG  130



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 96/131 (73%), Gaps = 4/131 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGK-  200
            MASA  SVA  +L Q + KG +       S+S          +D  SV++FQTS VG   
Sbjct  1    MASATFSVAKPSL-QANGKGFTDFSGLRNSASLPFSRKTS--EDFLSVIAFQTSAVGNSG  57

Query  201  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  380
             R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL
Sbjct  58   YRKGAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTL  117

Query  381  GIFDADVKPVG  413
            GIFDA+VKPVG
Sbjct  118  GIFDANVKPVG  128



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 101/132 (77%), Gaps = 8/132 (6%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  115  LGIFDADVKPSG  126



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 101/132 (77%), Gaps = 8/132 (6%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  115  LGIFDADVKPSG  126



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 101/132 (77%), Gaps = 8/132 (6%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  115  LGIFDADVKPSG  126



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVA  +L   S       FSGLR+SS+     R S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMGSNG  54

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  55   AYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  114

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  115  LGIFDADVKPSG  126



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 100/133 (75%), Gaps = 6/133 (5%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  203
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  204  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  375  TLGIFDADVKPVG  413
            TLGIF+ADVKPVG
Sbjct  118  TLGIFEADVKPVG  130



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 81/88 (92%), Gaps = 1/88 (1%)
 Frame = +3

Query  153  DLHSVVSFQTSVVGG-KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  329
            D  S VSFQTS+VGG K ++ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND
Sbjct  106  DFVSFVSFQTSLVGGEKNQKVVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  165

Query  330  TGGVKQASHLLKYDSTLGIFDADVKPVG  413
            TGGVKQA+HLLKYDSTLGIFDA VKPVG
Sbjct  166  TGGVKQAAHLLKYDSTLGIFDAVVKPVG  193



>tpg|DAA37468.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=252

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 78/91 (86%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  320
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  130



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score =   155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 100/133 (75%), Gaps = 6/133 (5%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  203
            MASA LSVA S L      G          +S+SLPF R+S DD HSV++ QTS +G   
Sbjct  1    MASATLSVAKSALQ---GNGKGFSEFSGLRNSASLPFGRKSSDDFHSVIALQTSALGSSS  57

Query  204  ---RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
               R+   +AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+AINDTGGVKQASHLLKYDS
Sbjct  58   SGYRKVAAQAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDS  117

Query  375  TLGIFDADVKPVG  413
            TLGIF+ADVKPVG
Sbjct  118  TLGIFEADVKPVG  130



>emb|CBI21236.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 97/133 (73%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
             LG F+ADVK VG
Sbjct  119  ILGTFEADVKAVG  131



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 101/132 (77%), Gaps = 8/132 (6%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVA  +L   S+      FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSD------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST
Sbjct  55   GYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  114

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  115  LGIFDADVKPSG  126



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  SVV+FQTS +G  G  R+ V EAKLKVAI+GFGRIGRNFLRCWHGRKDSPLDVIAI
Sbjct  38   DEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAISGFGRIGRNFLRCWHGRKDSPLDVIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 80/89 (90%), Gaps = 1/89 (1%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            +D  SVV+FQTSVV G   +R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN
Sbjct  37   EDFLSVVAFQTSVVWGSGYKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  96

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            DTGGVKQASHLLKYDSTLGIFDADVK  G
Sbjct  97   DTGGVKQASHLLKYDSTLGIFDADVKVAG  125



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 99/132 (75%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSI  118

Query  378  LGIFDADVKPVG  413
            LG FDA VKPVG
Sbjct  119  LGTFDAVVKPVG  130



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 99/132 (75%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA LSVA   L Q + KG S       SSS      + S +D +SV++FQTS VG  G
Sbjct  1    MASATLSVAKPAL-QANGKGFSDFSGLRSSSSYLPFSRKTS-EDFNSVIAFQTSAVGNSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              ++ VVEAKLKVAINGFGRIGRNFLRCWHGRK+SPLDVIAINDTGGVKQASHLLKYDS 
Sbjct  59   GYKKVVVEAKLKVAINGFGRIGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSI  118

Query  378  LGIFDADVKPVG  413
            LG FDA VKPVG
Sbjct  119  LGTFDAVVKPVG  130



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 97/132 (73%), Gaps = 5/132 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA L+ AN+ L     KG S       +SSS       S DD  SVV+F+TS VG  G
Sbjct  1    MASATLTAANACLQ---GKGFSDFSGLRSASSSIPLRRINSSDDFLSVVAFRTSAVGSSG  57

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQASHLLKYDST
Sbjct  58   GYRKGAAEAKVKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQASHLLKYDST  117

Query  378  LGIFDADVKPVG  413
            LGIF+A+VKP G
Sbjct  118  LGIFEANVKPEG  129



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   154 bits (388),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 78/90 (87%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S V+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 78/90 (87%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S V+FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   154 bits (388),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 96/132 (73%), Gaps = 6/132 (5%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  203
            MAS  LS+AN +L +V NKG S       SS           DDL + VSFQT+ VGGK+
Sbjct  1    MASNMLSIANPSL-RVYNKGFSEFSGLHTSSLPFGRKGS---DDLMAFVSFQTNAVGGKR  56

Query  204  --RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              +  VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS 
Sbjct  57   SSQNGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSI  116

Query  378  LGIFDADVKPVG  413
            LG FDADVK  G
Sbjct  117  LGTFDADVKTAG  128



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   153 bits (387),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 78/90 (87%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S ++FQTS +G  G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAI
Sbjct  38   DEFVSAITFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 77/90 (86%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S VSFQTS +G     R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSP D+IAI
Sbjct  38   DEFVSAVSFQTSAMGSSSGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDIIAI  97

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  98   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  127



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   154 bits (390),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 98/139 (71%), Gaps = 7/139 (5%)
 Frame = +3

Query  9    PVNPAMASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV  188
            P    MASA L+VAN++L Q + KG S       SS           DD  SV+SF+TS 
Sbjct  37   PETKTMASATLAVANASL-QANGKGFSEFSGLRSSSLPLRRINTS--DDFISVISFKTSA  93

Query  189  VGGKQ----RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  356
            V G      R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQASH
Sbjct  94   VAGGSGGGYRKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQASH  153

Query  357  LLKYDSTLGIFDADVKPVG  413
            LLKYDSTLGIF+ADVKP G
Sbjct  154  LLKYDSTLGIFEADVKPAG  172



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 99/139 (71%), Gaps = 7/139 (5%)
 Frame = +3

Query  9    PVNPAMASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV  188
            P   AMASA L+VAN++L Q + KG S       SS           DD  SV++F+TS 
Sbjct  37   PDTKAMASATLAVANASL-QANGKGFSEFSGLRSSSLPLRKINTS--DDFLSVIAFKTSA  93

Query  189  VGGKQ----RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  356
            V G      R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGG+KQASH
Sbjct  94   VAGGGGGGYRKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGIKQASH  153

Query  357  LLKYDSTLGIFDADVKPVG  413
            LLKYDSTLGIF+ADVKP G
Sbjct  154  LLKYDSTLGIFEADVKPAG  172



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSSMGSNG  54

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGGVKQA+HLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGVKQATHLLKYDST  114

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  115  LGIFDADVKPSG  126



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 99/132 (75%), Gaps = 8/132 (6%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNG  54

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  114

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  115  LGIFDADVKPSG  126



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 99/132 (75%), Gaps = 8/132 (6%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNG  54

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  114

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  115  LGIFDADVKPSG  126



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 97/133 (73%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
             LG F+ADVK VG
Sbjct  119  ILGTFEADVKAVG  131



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 97/133 (73%), Gaps = 5/133 (4%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTS VG   
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSAVGSNS  58

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS
Sbjct  59   GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDS  118

Query  375  TLGIFDADVKPVG  413
             LG F+ADVK VG
Sbjct  119  ILGTFEADVKAVG  131



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 99/132 (75%), Gaps = 8/132 (6%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG--G  197
            MASA  SVA  +L   S       FSGLR+SS+     + S D+  S VSFQTS +G  G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNG  54

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
               + V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDST
Sbjct  55   GYSKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDST  114

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  115  LGIFDADVKPSG  126



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 78/90 (87%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            D+  S VSFQTS +G  G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ I
Sbjct  37   DEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVI  96

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  97   NDTGGVKQASHLLKYDSTLGIFDADVKPSG  126



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 95/132 (72%), Gaps = 3/132 (2%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  197
            MASA L+ AN+ L Q S KG S       +S S       S DD  S V+F+T+     G
Sbjct  1    MASATLTAANACL-QASGKGFSDFSGLRSASCSIPLRKIHSSDDFLSTVAFRTAAESSSG  59

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+AINDTGG+KQASHLLKYDST
Sbjct  60   GYRKGAAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVAINDTGGIKQASHLLKYDST  119

Query  378  LGIFDADVKPVG  413
            LGIF+ADVKP G
Sbjct  120  LGIFEADVKPEG  131



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 99/140 (71%), Gaps = 12/140 (9%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV-----  188
            MASA LSVA  +L Q + KG         SS+      + S DD  SVV+FQTS      
Sbjct  1    MASATLSVAKPSL-QGNGKGFQEFSGLRNSSAFLPFAKKTS-DDFLSVVAFQTSAKRILT  58

Query  189  --VG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  353
              VG   G  R+   EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS
Sbjct  59   VKVGSNNGGYRKTAAEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  118

Query  354  HLLKYDSTLGIFDADVKPVG  413
            HLLKYDSTLGIF+ADVKPVG
Sbjct  119  HLLKYDSTLGIFEADVKPVG  138



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 78/90 (87%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            DD  + VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DSPL+VIAI
Sbjct  39   DDFVNAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRDDSPLEVIAI  98

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  99   NDTGGVKQASHLLKYDSTLGIFDADVKPVG  128



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 98/132 (74%), Gaps = 6/132 (5%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGGKQ  203
            MAS  LS+AN +L +VSNKG S       SS           DDL ++V+FQT+ + GK+
Sbjct  1    MASNMLSIANPSL-RVSNKGFSEFAGLHTSSLPFARRGS---DDLVALVAFQTNALAGKR  56

Query  204  --RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              +  VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ IND+GGVKQASHLLKYDS 
Sbjct  57   STQNGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVINDSGGVKQASHLLKYDSI  116

Query  378  LGIFDADVKPVG  413
            LG FDADVKP G
Sbjct  117  LGTFDADVKPEG  128



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 78/91 (86%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  320
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  130



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   151 bits (381),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 101/133 (76%), Gaps = 7/133 (5%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVG---  194
            MASA LSVA S+L         SEFSGLRSSS      + S D+  S V+FQT  +G   
Sbjct  1    MASATLSVAKSSLQLQG----FSEFSGLRSSSGLPFAKKPSSDEFVSFVTFQTKALGNNN  56

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDS
Sbjct  57   GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAAHLLKYDS  116

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKP G
Sbjct  117  TLGIFDADVKPSG  129



>gb|KHN13412.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=244

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 2/77 (3%)
 Frame = +3

Query  189  VGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  362
            VGG++  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  23   VGGREGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  82

Query  363  KYDSTLGIFDADVKPVG  413
            KYDSTLGIFDADVKPVG
Sbjct  83   KYDSTLGIFDADVKPVG  99



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 78/91 (86%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  320
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  20   DDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  79

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  80   INDTGGVKQASHLLKYDSTLGIFDADVKPVG  110



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 78/91 (86%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  320
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  130



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 98/132 (74%), Gaps = 8/132 (6%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVV--GG  197
            MASA  SVA  +L   S       FSGLR+SS+     R S D+  S VSFQTS +   G
Sbjct  1    MASATFSVAKPSLQGFSE------FSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMRSNG  54

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDST
Sbjct  55   GYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDST  114

Query  378  LGIFDADVKPVG  413
            LGIFDADVKP G
Sbjct  115  LGIFDADVKPSG  126



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 96/132 (73%), Gaps = 4/132 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSV--VGG  197
            MASA LSVA  +L Q + KG +       SS+      + S DD  SVV+FQTSV    G
Sbjct  1    MASATLSVAKPSL-QANGKGFAEFSGLRNSSACLSFNRKTS-DDFLSVVAFQTSVGSNSG  58

Query  198  KQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDST  377
              R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +NDTGGVKQASHLLKYDS 
Sbjct  59   GYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSI  118

Query  378  LGIFDADVKPVG  413
            LG F+ADVK VG
Sbjct  119  LGTFEADVKAVG  130



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   149 bits (376),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 75/88 (85%), Gaps = 2/88 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  329
            D+  S V+FQTS V     + V EAKLKVAINGFGRIGRNFLRCWHGRKDSP DVIAIND
Sbjct  39   DEFVSAVTFQTSAVS--SLKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPFDVIAIND  96

Query  330  TGGVKQASHLLKYDSTLGIFDADVKPVG  413
            TGGVKQASHLLKYDSTLGIFDADVKP G
Sbjct  97   TGGVKQASHLLKYDSTLGIFDADVKPSG  124



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 78/91 (86%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  320
            DD  + VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PLDVIA
Sbjct  39   DDFMNAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLDVIA  98

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  99   INDTGGVKQASHLLKYDSTLGIFDADVKPVG  129



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 78/91 (86%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  320
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  38   DDFMSAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  98   INDTGGVKQASHLLKYDSTLGIFDADVKPVG  128



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 78/91 (86%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  320
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGARRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  99

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  130



>ref|XP_003548929.2| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde 3-phosphate dehydrogenase 
GAPA2, chloroplastic-like [Glycine max]
Length=346

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/77 (92%), Positives = 74/77 (96%), Gaps = 2/77 (3%)
 Frame = +3

Query  189  VGGKQ--RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  362
            VGG++  R+ VVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL
Sbjct  8    VGGREGYRKGVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLL  67

Query  363  KYDSTLGIFDADVKPVG  413
            KYDSTLGIFDADVKPVG
Sbjct  68   KYDSTLGIFDADVKPVG  84



>gb|AAA33484.1| glyceraldehyde-3-phosphate dehydrogenase precursor, partial [Zea 
mays]
Length=125

 Score =   142 bits (357),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 73/86 (85%), Gaps = 3/86 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVIA  320
            DD  S VSF+T  VG  G  RRA  EAKLKVAINGFGRIGRNFLRCWHGR D SPLDVIA
Sbjct  40   DDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDASPLDVIA  99

Query  321  INDTGGVKQASHLLKYDSTLGIFDAD  398
            INDTGGVKQASHLLKYDSTLGIFDAD
Sbjct  100  INDTGGVKQASHLLKYDSTLGIFDAD  125



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 77/92 (84%), Gaps = 4/92 (4%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGGK---QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVI  317
            +D  S VSF+T  VG      RRA  EAKLKVAINGFGRIGRNFLRCWHGR DS PLDVI
Sbjct  39   EDFMSAVSFRTYAVGTSGSGSRRAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLDVI  98

Query  318  AINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            AINDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  99   AINDTGGVKQASHLLKYDSTLGIFDADVKPVG  130



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            DTGGVKQASHLLKYDS LG FD +VK  G
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAG  136



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            DTGGVKQASHLLKYDS LG FD +VK  G
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAG  136



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            DTGGVKQASHLLKYDS LG FD +VK  G
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAG  136



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 1/89 (1%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            +DL SVV+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ IN
Sbjct  48   EDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVIN  107

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            DTGGVKQASHLLKYDS LG FD +VK  G
Sbjct  108  DTGGVKQASHLLKYDSILGTFDTEVKIAG  136



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 77/91 (85%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  320
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  29   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  88

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  89   INDTGGVKQASHLLKYDSTLGIFDADVKPVG  119



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 77/91 (85%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  320
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  38   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  98   INDTGGVKQASHLLKYDSTLGIFDADVKPVG  128



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/73 (92%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  ++ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  10   GGYKKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  69

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKPVG
Sbjct  70   TLGIFDADVKPVG  82



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 76/91 (84%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDS-PLDVIA  320
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLRCWHGR DS PL+VIA
Sbjct  38   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRCWHGRGDSSPLEVIA  97

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGG KQASHLLKYDSTLGIFDADVKPVG
Sbjct  98   INDTGGAKQASHLLKYDSTLGIFDADVKPVG  128



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 1/89 (1%)
 Frame = +3

Query  150  DDLHSVVSFQTSV-VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            DDL + V+ Q++V V G Q+RAVVEAK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+ IN
Sbjct  37   DDLLTRVAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVIN  96

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            DTGGVKQASHLLKYDS LGIFDA VK VG
Sbjct  97   DTGGVKQASHLLKYDSMLGIFDAYVKAVG  125



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/73 (92%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  64

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKP G
Sbjct  65   TLGIFDADVKPSG  77



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDS  64

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKP G
Sbjct  65   TLGIFDADVKPSG  77



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 1/83 (1%)
 Frame = +3

Query  168  VSFQTSV-VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVK  344
            V+ Q++V V G Q+RAVVEAK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+ INDTGGVK
Sbjct  2    VAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVINDTGGVK  61

Query  345  QASHLLKYDSTLGIFDADVKPVG  413
            QASHLLKYDS LGIFDADVK VG
Sbjct  62   QASHLLKYDSMLGIFDADVKAVG  84



>ref|XP_010458726.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010458727.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=283

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDS  64

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKP G
Sbjct  65   TLGIFDADVKPSG  77



>ref|XP_008663264.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58480.1| hypothetical protein ZEAMMB73_511551 [Zea mays]
Length=401

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 76/92 (83%), Gaps = 4/92 (4%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVI  317
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRIGRNFLRCWHGR  DSPLDVI
Sbjct  37   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIGRNFLRCWHGRDNDSPLDVI  96

Query  318  AINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            AINDTG +KQASHLLKYDS LGIFDADV+PVG
Sbjct  97   AINDTGDIKQASHLLKYDSMLGIFDADVEPVG  128



>gb|AAF03099.1|AF162198_1 NADP-dependent glyceraldehyde phosphate dehydrogenase [Lactuca 
sativa]
Length=113

 Score =   134 bits (336),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  200
            MAS A S+AN++L QV+ KG S       SS+S     + S DD  S+V+FQT++VGG K
Sbjct  1    MASTAFSMANASL-QVNGKGFSEFAGLRSSSASLPFGRKGS-DDFASMVAFQTTLVGGSK  58

Query  201  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  365
              + V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK
Sbjct  59   TPKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  113



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDS  64

Query  375  TLGIFDADVKPVG  413
            TLGIFDADVKP G
Sbjct  65   TLGIFDADVKPSG  77



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   140 bits (353),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = +3

Query  147  YDDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            +DDL ++V+ Q++V      +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ I
Sbjct  36   HDDLTTIVTAQSAVAASSGAKRAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDVVVI  95

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDS LG FDADVK  G
Sbjct  96   NDTGGVKQASHLLKYDSMLGTFDADVKVEG  125



>gb|AAF19788.1|AF162202_1 NADP-dependent glyceraldehyde phosphate dehydrogenase [Lactuca 
sativa]
Length=113

 Score =   132 bits (333),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 89/115 (77%), Gaps = 3/115 (3%)
 Frame = +3

Query  24   MASAALSVANSTLHQVSNKGlssefsglrssssslpfarrsYDDLHSVVSFQTSVVGG-K  200
            MAS A S+AN++L QV+ KG S       SS+S     + S DD  S+V+FQT++VGG K
Sbjct  1    MASTAFSMANASL-QVNGKGFSEFAGLRSSSASLPFGRKGS-DDFVSMVAFQTTLVGGSK  58

Query  201  QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  365
              + V EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK
Sbjct  59   TPKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  113



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 73/84 (87%), Gaps = 1/84 (1%)
 Frame = +3

Query  165  VVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGV  341
            +V+FQT+ VG   Q+R VVEAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGV
Sbjct  54   LVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGV  113

Query  342  KQASHLLKYDSTLGIFDADVKPVG  413
            KQASHLLKYDS LG FD DV+  G
Sbjct  114  KQASHLLKYDSILGTFDPDVQVAG  137



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 74/90 (82%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            +DL S V+ QT  V   G  +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDVI I
Sbjct  40   EDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVIVI  99

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDS LG FDADVK  G
Sbjct  100  NDTGGVKQASHLLKYDSMLGTFDADVKVSG  129



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 74/90 (82%), Gaps = 2/90 (2%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAI  323
            +DL S V+ QT  V   G  +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDVI I
Sbjct  40   EDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVIVI  99

Query  324  NDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            NDTGGVKQASHLLKYDS LG FDADVK  G
Sbjct  100  NDTGGVKQASHLLKYDSMLGTFDADVKVSG  129



>gb|AAB82133.1| glyceralehyde-3-phosphate dehydrogenase subunit [Oryza sativa 
Indica Group]
Length=343

 Score =   138 bits (347),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 75/91 (82%), Gaps = 3/91 (3%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVIA  320
            D+  + VSF+T  VG  G  RRA  EAKLKVAINGFGR GRNFLRCWHGR  DSPL++I 
Sbjct  39   DNFMNPVSFRTHAVGTNGGARRAPTEAKLKVAINGFGRFGRNFLRCWHGRGDDSPLNIIP  98

Query  321  INDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INDTGGVKQASH LKY+STLGIFDADVKPVG
Sbjct  99   INDTGGVKQASHRLKYNSTLGIFDADVKPVG  129



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 77/101 (76%), Gaps = 13/101 (13%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG--GKQRRAVVEAKLKVAINGFGRIGRNFLR----------CWHGR  293
            DD  S VSF+T  V   G  R+A  EAKLKVAINGFGRIGRNFLR          CWHGR
Sbjct  29   DDFMSAVSFRTYAVSTSGGSRKAPTEAKLKVAINGFGRIGRNFLRAQRIGRNFLRCWHGR  88

Query  294  KDS-PLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
             DS PL+VIAINDTGGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  89   GDSSPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVG  129



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  R+ V EAK+KVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS
Sbjct  5    GGYRKGVTEAKIKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDS  64

Query  375  TLGIFDADVKPVG  413
            TLGIF ADVKP G
Sbjct  65   TLGIFGADVKPSG  77



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVGGK-QRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            DDL ++V+ QT V       RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ IN
Sbjct  38   DDLSTIVAAQTVVAASSGASRAVTEAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVIN  97

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            DTGGVKQASHLLKYDS LG F+ADVK  G
Sbjct  98   DTGGVKQASHLLKYDSMLGTFNADVKVEG  126



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLD+IAINDTGGVKQASHLLKYDSTLGIFDADV
Sbjct  1    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADV  60

Query  402  KPVG  413
            KP G
Sbjct  61   KPSG  64



>ref|XP_008663258.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58475.1| hypothetical protein ZEAMMB73_739238 [Zea mays]
Length=401

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 4/92 (4%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGR-KDSPLDVI  317
            D+  S VSF+   +G   G+ RRA  EAKLKVA+NGFGRIGRN +RCWHGR  DSPLDVI
Sbjct  37   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAMNGFGRIGRNLMRCWHGRDNDSPLDVI  96

Query  318  AINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            AINDTG VKQAS+LLKYDS LGIFDADV+PVG
Sbjct  97   AINDTGDVKQASYLLKYDSMLGIFDADVEPVG  128



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/63 (97%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +3

Query  225  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  404
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGV+QASHLLKYDSTLGIFDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVEQASHLLKYDSTLGIFDADVK  60

Query  405  PVG  413
            P G
Sbjct  61   PSG  63



>gb|AFW58485.1| hypothetical protein ZEAMMB73_956640 [Zea mays]
Length=372

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 73/92 (79%), Gaps = 4/92 (4%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVI  317
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRI RNFLRCWHGR D SPLDVI
Sbjct  8    DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIRRNFLRCWHGRDDDSPLDVI  67

Query  318  AINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            AINDTG VKQASHLLKYDS LGIFDAD + VG
Sbjct  68   AINDTGDVKQASHLLKYDSLLGIFDADAELVG  99



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +3

Query  204  RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLG  383
            R+   EAK+KVAINGFGRIGRNFLRCWHGRKDSPL++IAINDTGGVKQASHLLKYDSTLG
Sbjct  2    RKGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLEIIAINDTGGVKQASHLLKYDSTLG  61

Query  384  IFDADVKPVG  413
            IF ADVK VG
Sbjct  62   IFGADVKAVG  71



>ref|XP_008664191.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Zea mays]
Length=420

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 73/92 (79%), Gaps = 4/92 (4%)
 Frame = +3

Query  150  DDLHSVVSFQTSVVG---GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKD-SPLDVI  317
            D+  S VSF+   +G   G+ RRA  EAKLKVAINGFGRI RNFLRCWHGR D SPLDVI
Sbjct  56   DEFMSAVSFRNHAIGTSGGRLRRAPTEAKLKVAINGFGRIRRNFLRCWHGRDDDSPLDVI  115

Query  318  AINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            AINDTG VKQASHLLKYDS LGIFDAD + VG
Sbjct  116  AINDTGDVKQASHLLKYDSLLGIFDADAELVG  147



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  204  RRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLG  383
            +RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG
Sbjct  63   KRAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLG  122

Query  384  IFDADVKPVG  413
             FDADVK  G
Sbjct  123  TFDADVKVEG  132



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RAV EAK+KVAINGFGRIGRNF+RCWHGRKDSPLD++ INDTGGVKQASHLLKYDS LG 
Sbjct  34   RAVTEAKIKVAINGFGRIGRNFVRCWHGRKDSPLDIVVINDTGGVKQASHLLKYDSMLGT  93

Query  387  FDADVKPVG  413
            FDADVK  G
Sbjct  94   FDADVKVEG  102



>emb|CAC80372.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=314

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/58 (98%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +3

Query  240  INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIF+ADVKPVG
Sbjct  2    INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVG  59



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RAV EAK+KVAINGFGRIGRNF+RCW GRKDSPLDV+ INDTGGVKQASHLLKYDS LG 
Sbjct  64   RAVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGT  123

Query  387  FDADVKPVG  413
            F+ADVK  G
Sbjct  124  FNADVKVEG  132



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RAV EAK+KVAINGFGRIGRNF+RCW GRKDSPLDV+ INDTGGVKQASHLLKYDS LG 
Sbjct  36   RAVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGT  95

Query  387  FDADVKPVG  413
            F+ADVK  G
Sbjct  96   FNADVKVEG  104



>emb|CAC80373.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=312

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/58 (97%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +3

Query  240  INGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            INGFGRIGRNFLRCWHGRKDSPL+VIAIND+GGVKQASHLLKYDSTLGIFDADVKPVG
Sbjct  2    INGFGRIGRNFLRCWHGRKDSPLEVIAINDSGGVKQASHLLKYDSTLGIFDADVKPVG  59



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RAV EAK++VAINGFGRIGRNF+RCWHGRKDSPL+V+ INDTGGVKQASHLLKYDS LG 
Sbjct  36   RAVTEAKIRVAINGFGRIGRNFVRCWHGRKDSPLEVVVINDTGGVKQASHLLKYDSMLGT  95

Query  387  FDADVK  404
            F+ADVK
Sbjct  96   FNADVK  101



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  225  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  404
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  405  PVG  413
              G
Sbjct  61   TAG  63



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  225  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  404
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  405  PVG  413
              G
Sbjct  61   TAG  63



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  225  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  404
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  405  PVG  413
              G
Sbjct  61   TAG  63



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  225  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  404
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  405  PVG  413
              G
Sbjct  61   TAG  63



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +3

Query  156  LHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTG  335
            + SV    +S V G   R   EAKL+VAINGFGRIGRNFLRCWHGR DSPL+VIAIND+G
Sbjct  88   VDSVTRDVSSKVIGSGHRGETEAKLRVAINGFGRIGRNFLRCWHGRPDSPLEVIAINDSG  147

Query  336  GVKQASHLLKYDSTLGIFDADVKPV  410
            GVKQA+HLLKYDS LG F+ADVK V
Sbjct  148  GVKQATHLLKYDSMLGTFNADVKTV  172



>gb|ACJ85309.1| unknown [Medicago truncatula]
Length=229

 Score =   121 bits (304),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  174  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  353
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  354  HLLKYDSTLGIFDADVK  404
            HLLKYDS LG F ADVK
Sbjct  128  HLLKYDSMLGTFKADVK  144



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  219  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDAD  398
            EAK+KVAINGFGRIGRNF+RCWHGRKDSPLDV+ INDTGGVKQASHLLKYDS LG F+AD
Sbjct  68   EAKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFNAD  127

Query  399  VKPVG  413
            VK  G
Sbjct  128  VKVEG  132



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  225  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  404
            KLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ IND GGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDAGGVKQASHLLKYDSILGTFDADVK  60

Query  405  PVG  413
              G
Sbjct  61   TAG  63



>ref|XP_003603852.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=283

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  174  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  353
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  354  HLLKYDSTLGIFDADVK  404
            HLLKYDS LG F ADVK
Sbjct  128  HLLKYDSMLGTFKADVK  144



>gb|EYU41183.1| hypothetical protein MIMGU_mgv1a025772mg, partial [Erythranthe 
guttata]
Length=182

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = +3

Query  156  LHSVVSFQ--TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  329
             H V++ Q  T   G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  59   FHDVIAAQLTTKTTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  118

Query  330  TGGVKQASHLLKYDSTLGIFDADVKPV  410
            +GGVK A+HLLKYDS LG F ADVK V
Sbjct  119  SGGVKSATHLLKYDSILGTFKADVKIV  145



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 68/82 (83%), Gaps = 4/82 (5%)
 Frame = +3

Query  177  QTSVVGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVK  344
            Q + V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVK
Sbjct  17   QKAGVRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVK  76

Query  345  QASHLLKYDSTLGIFDADVKPV  410
            QASHLLKYDSTLG FDADVK V
Sbjct  77   QASHLLKYDSTLGTFDADVKIV  98



>ref|XP_006383782.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61579.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=308

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  387  FDADVKPV  410
            F A+VK V
Sbjct  139  FKAEVKIV  146



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  387  FDADVKPV  410
            F ADVK V
Sbjct  139  FKADVKIV  146



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LGIF ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGIFKADV  143

Query  402  KPV  410
            K V
Sbjct  144  KIV  146



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LGIF ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGIFKADV  143

Query  402  KPV  410
            K V
Sbjct  144  KIV  146



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = +3

Query  156  LHSVVSFQTSVV-GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDT  332
            L   V  Q S+V  G   +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA+ND+
Sbjct  40   LFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAVNDS  99

Query  333  GGVKQASHLLKYDSTLGIFDADVKPV  410
            GGVK ASHLLKYDS LG F A+VK V
Sbjct  100  GGVKNASHLLKYDSMLGTFKANVKVV  125



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  387  FDADVKPV  410
            F ADVK V
Sbjct  139  FKADVKIV  146



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  174  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  353
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  354  HLLKYDSTLGIFDADVK  404
            HLLKYDS LG F ADVK
Sbjct  128  HLLKYDSMLGTFKADVK  144



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = +3

Query  156  LHSVVSFQTSVV-GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDT  332
            L   V  Q S+V  G   +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIA+ND+
Sbjct  40   LFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAVNDS  99

Query  333  GGVKQASHLLKYDSTLGIFDADVKPV  410
            GGVK ASHLLKYDS LG F A+VK V
Sbjct  100  GGVKNASHLLKYDSMLGTFKANVKVV  125



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  174  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  353
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  354  HLLKYDSTLGIFDADVK  404
            HLLKYDS LG F ADVK
Sbjct  128  HLLKYDSMLGTFKADVK  144



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  174  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  353
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  354  HLLKYDSTLGIFDADVK  404
            HLLKYDS LG F ADVK
Sbjct  128  HLLKYDSMLGTFKADVK  144



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR+DSPLDV+ +ND+GGV+ ASHLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPLDVVVVNDSGGVRNASHLLKYD  125

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  126  SMLGTFKADVKIV  138



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  156  LHSVVSFQ--TSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  329
             H V++ Q  T   G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND
Sbjct  59   FHDVIAAQLTTKPTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND  118

Query  330  TGGVKQASHLLKYDSTLGIFDADVK  404
            +GGVK A+HLLKYDS LG F ADVK
Sbjct  119  SGGVKSATHLLKYDSILGTFKADVK  143



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = +3

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  ++ V EAKLKVAINGFGRIGRNFLRCW GR++SPL+V+AIND+GGVKQA+HLLKYDS
Sbjct  38   GSSQKQVTEAKLKVAINGFGRIGRNFLRCWVGRENSPLEVVAINDSGGVKQAAHLLKYDS  97

Query  375  TLGIFDADVKPV  410
             LG F ADVK +
Sbjct  98   MLGTFKADVKVI  109



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = +3

Query  156  LHSVVSFQTS--VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  329
            L  VVS Q +    G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND
Sbjct  58   LFDVVSAQLTPKTTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVND  117

Query  330  TGGVKQASHLLKYDSTLGIFDADVKPV  410
            +GGVK ASHLLKYDS LG F ADVK V
Sbjct  118  SGGVKNASHLLKYDSMLGTFKADVKIV  144



>gb|KDO85181.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85182.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=269

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>gb|KDO85183.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85184.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=275

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +3

Query  195  GKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDS  374
            G  ++ V EAKLKVAINGFGRIGRNFLRCW GR++SPL+V+AIND+GGVKQA+HLLKYDS
Sbjct  10   GSSQKQVTEAKLKVAINGFGRIGRNFLRCWVGRENSPLEVVAINDSGGVKQAAHLLKYDS  69

Query  375  TLGIFDADVK  404
             LG F ADVK
Sbjct  70   MLGTFKADVK  79



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +3

Query  174  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  353
              T  +G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  68   LATKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  127

Query  354  HLLKYDSTLGIFDADVK  404
            HLLKYDS LG F ADVK
Sbjct  128  HLLKYDSMLGTFKADVK  144



>gb|KDO85177.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85178.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=304

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>gb|KJB57937.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=278

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLLKYD
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYD  136

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  137  SMLGTFKADVKIV  149



>gb|KDO85179.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85180.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=248

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +3

Query  186  VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  365
            VVG    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLK
Sbjct  71   VVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLK  130

Query  366  YDSTLGIFDADVKPV  410
            YDS LG F A+VK V
Sbjct  131  YDSMLGTFKAEVKIV  145



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +3

Query  186  VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLK  365
            VVG    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLK
Sbjct  72   VVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLK  131

Query  366  YDSTLGIFDADVKPV  410
            YDS LG F A+VK V
Sbjct  132  YDSMLGTFKAEVKIV  146



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR+DSP+DV+ +ND+GGV+ ASHLLKYD
Sbjct  71   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPIDVVVVNDSGGVRNASHLLKYD  130

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  131  SMLGTFKADVKIV  143



>ref|XP_006435407.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48647.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=329

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  387  FDADVKPV  410
            F A+VK V
Sbjct  139  FKAEVKIV  146



>gb|KDO85176.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=329

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RA   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  48   RAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  107

Query  387  FDADVKPV  410
            F A+VK V
Sbjct  108  FKAEVKIV  115



>gb|KJB57939.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=320

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLLKYD
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYD  136

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  137  SMLGTFKADVKIV  149



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/55 (96%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = +3

Query  249  FGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVG  413
            FGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQA+HLLKYDSTLGIFDADVKP G
Sbjct  1    FGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSG  55



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  174  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  353
              +  VG    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDV+ +ND+GGVK AS
Sbjct  68   LASKTVGASPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVVVVNDSGGVKNAS  127

Query  354  HLLKYDSTLGIFDADVKPV  410
            HLLKYDS LG F ADVK V
Sbjct  128  HLLKYDSMLGTFKADVKIV  146



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  82   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGTFKADV  141

Query  402  KPV  410
            K V
Sbjct  142  KIV  144



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  174  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  353
              +  VG    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDV+ +ND+GGVK AS
Sbjct  68   LASKTVGASPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVVVVNDSGGVKNAS  127

Query  354  HLLKYDSTLGIFDADVKPV  410
            HLLKYDS LG F ADVK V
Sbjct  128  HLLKYDSMLGTFKADVKIV  146



>gb|ABC68431.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
pratensis]
Length=143

 Score =   114 bits (285),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDA  395
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG F A
Sbjct  86   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKA  143



>gb|ABC68432.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
dubius]
Length=143

 Score =   114 bits (285),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +3

Query  174  FQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQAS  353
            F     G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK AS
Sbjct  70   FTPKAAGSTVAKVETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNAS  129

Query  354  HLLKYDSTLGIFDA  395
            HLLKYDS LG F A
Sbjct  130  HLLKYDSMLGTFKA  143



>gb|KDO85175.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=309

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  165  VVSFQTS--VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  338
            VVS Q +    G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GG
Sbjct  62   VVSAQLTPKTTGSAPAKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  121

Query  339  VKQASHLLKYDSTLGIFDADVKPV  410
            VK ASHLLKYDS LG F ADVK V
Sbjct  122  VKNASHLLKYDSMLGTFKADVKIV  145



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  126  SMLGTFKADVKIV  138



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  402  KPV  410
            K V
Sbjct  143  KIV  145



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  402  KPV  410
            K V
Sbjct  143  KIV  145



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +3

Query  156  LHSVVSFQTSV--VGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIND  329
             + VV+ Q S    G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND
Sbjct  38   FYDVVAAQLSTKRTGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND  97

Query  330  TGGVKQASHLLKYDSTLGIFDADVK  404
            +GGVK ASHLLKYDS LG F A+VK
Sbjct  98   SGGVKNASHLLKYDSMLGTFKAEVK  122



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  402  KPV  410
            K V
Sbjct  143  KIV  145



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +3

Query  147  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            +D + + ++ QTS  G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +N
Sbjct  61   FDAVAAQLTPQTS--GSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVN  118

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPV  410
            D+GGVK ASHLLKYDS LG F AD+K V
Sbjct  119  DSGGVKNASHLLKYDSMLGTFKADIKIV  146



>gb|ADE06487.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
dubius]
Length=90

 Score =   112 bits (279),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDA  395
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG F A
Sbjct  33   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKA  90



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYD
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYD  133

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  134  SMLGTFKADVKIV  146



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +3

Query  165  VVSFQTS--VVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGG  338
            VVS Q +    G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GG
Sbjct  61   VVSAQLTPKTTGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGG  120

Query  339  VKQASHLLKYDSTLGIFDADVKPV  410
            VK ASHLLKYDS LG F ADVK V
Sbjct  121  VKNASHLLKYDSMLGTFKADVKIV  144



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  387  FDADVKPV  410
            F A+VK V
Sbjct  139  FKAEVKIV  146



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = +3

Query  147  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            +D + + ++ +T+  G    +    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +N
Sbjct  61   FDAVAAQLTLKTA--GSTTVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVN  118

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPV  410
            D+GGVK ASHLLKYDS LG F ADVK V
Sbjct  119  DSGGVKNASHLLKYDSMLGTFKADVKIV  146



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 57/63 (90%), Gaps = 1/63 (2%)
 Frame = +3

Query  225  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVK  404
            KLKVAINGFGRIGRNFLRCWHG KDSPLDV+ INDTGGVKQASHLLKYDS LG FDADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHG-KDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  59

Query  405  PVG  413
              G
Sbjct  60   TAG  62



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  126  SMLGTFKADVKIV  138



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLLKYDS LG 
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYDSMLGT  130

Query  387  FDADVKPV  410
            F ADVK V
Sbjct  131  FKADVKIV  138



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  83   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  142

Query  402  KPV  410
            K V
Sbjct  143  KIV  145



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +3

Query  147  YDDLHSVVSFQTSVVGGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAIN  326
            +D L + ++ ++  V     R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +N
Sbjct  61   FDVLAAQLTPKSEGVPSASVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVN  120

Query  327  DTGGVKQASHLLKYDSTLGIFDADVKPV  410
            D+GGVK ASHLLKYDS LG F ADVK V
Sbjct  121  DSGGVKNASHLLKYDSMLGTFKADVKIV  148



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI IND+GGV+ ASHLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  126  SMLGTFKADVKIV  138



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 59/64 (92%), Gaps = 0/64 (0%)
 Frame = +3

Query  219  EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDAD  398
            +AK+KVAINGFGRIGRNFLRCWHGRKDS LDV+AIND+GGVKQASHL+KYDS LG F AD
Sbjct  40   KAKIKVAINGFGRIGRNFLRCWHGRKDSLLDVVAINDSGGVKQASHLVKYDSILGTFQAD  99

Query  399  VKPV  410
            VK V
Sbjct  100  VKIV  103



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  53   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  112

Query  402  KPV  410
            K V
Sbjct  113  KIV  115



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   119 bits (297),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  387  FDADVKPV  410
            F A+VK V
Sbjct  139  FKAEVKIV  146



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  82   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADV  141

Query  402  KPV  410
            K V
Sbjct  142  KIV  144



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   118 bits (295),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 4/78 (5%)
 Frame = +3

Query  189  VGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  356
            V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVKQASH
Sbjct  21   VRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASH  80

Query  357  LLKYDSTLGIFDADVKPV  410
            LLKYDSTLG F ADVK V
Sbjct  81   LLKYDSTLGTFAADVKIV  98



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+ +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  85   AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADV  144

Query  402  KPV  410
            K V
Sbjct  145  KIV  147



>gb|ADE06488.1| putative glyceraldehyde 3-phosphate dehydrogenase [Tragopogon 
porrifolius]
Length=86

 Score =   111 bits (278),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDA  395
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG F A
Sbjct  29   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKA  86



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RA   +KLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  101  RAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  160

Query  387  FDADVKPV  410
            F A+VK V
Sbjct  161  FKAEVKIV  168



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI +ND+GGV+ ASHLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVVNDSGGVRNASHLLKYD  125

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  126  SMLGTFKADVKIV  138



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLLKYD
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYD  136

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  137  SMLGTFKADVKIV  149



>gb|ABA01156.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
incerta]
Length=342

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 4/78 (5%)
 Frame = +3

Query  189  VGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  356
            V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVKQASH
Sbjct  8    VRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASH  67

Query  357  LLKYDSTLGIFDADVKPV  410
            LLKYDSTLG F ADVK V
Sbjct  68   LLKYDSTLGTFAADVKIV  85



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    R    AKLKVAINGFGRIGRNFLRCWHGRK+SPLDVI +ND+GGVK ASHLLKYD
Sbjct  77   GATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYD  136

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  137  SMLGTFKADVKIV  149



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  134

Query  387  FDADVKPV  410
            F ADVK V
Sbjct  135  FKADVKIV  142



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    RA  EAKLKVAINGFGRIGRNFLRCWHGR++SPL+V+ IND+GGV+ ASHLLKYD
Sbjct  69   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVVVINDSGGVRNASHLLKYD  128

Query  372  STLGIFDADVKPV  410
            S LG F ADVK V
Sbjct  129  SMLGTFKADVKIV  141



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 4/78 (5%)
 Frame = +3

Query  189  VGGKQRRAVV----EAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASH  356
            V  K  RAVV    E K++VAINGFGRIGRNFLRCWHGR+++ LDV+AIND+GGVKQASH
Sbjct  16   VRAKAARAVVDVRAEKKIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASH  75

Query  357  LLKYDSTLGIFDADVKPV  410
            LLKYDSTLG F ADVK V
Sbjct  76   LLKYDSTLGTFAADVKIV  93



>gb|ABF93790.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=207

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            RA  EAKLKVAINGFGRIGRNFLRCWH R++SPL+V+ +ND+GGV+ ASHLLKYDS LG 
Sbjct  71   RAPAEAKLKVAINGFGRIGRNFLRCWHERENSPLEVVVVNDSGGVRNASHLLKYDSMLGT  130

Query  387  FDADVKPV  410
            F ADVK V
Sbjct  131  FKADVKIV  138



>gb|ABC00187.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
 gb|ABC00188.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
Length=376

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G  +   V + K++VAINGFGRIGRNFLRCW GRKDS LDV+ +ND+GGVKQASHLLKYD
Sbjct  28   GAVKMEVVAQKKVRVAINGFGRIGRNFLRCWEGRKDSLLDVVCVNDSGGVKQASHLLKYD  87

Query  372  STLGIFDADVKPV  410
            +TLG FDADVK V
Sbjct  88   TTLGKFDADVKAV  100



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  75   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  134

Query  387  FDADVKPV  410
            F ADVK V
Sbjct  135  FKADVKIV  142



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKADV  143

Query  402  KPV  410
            K V
Sbjct  144  KIV  146



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  222  AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADV  401
            AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG F ADV
Sbjct  84   AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKADV  143

Query  402  KPV  410
            K V
Sbjct  144  KIV  146



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  387  FDADVKPV  410
            F ADVK V
Sbjct  139  FKADVKIV  146



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYD
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYD  133

Query  372  STLGIFDADVK  404
            S LG F ADVK
Sbjct  134  SMLGTFKADVK  144



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  387  FDADVKPV  410
            F ADVK V
Sbjct  139  FKADVKIV  146



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    + V  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYD
Sbjct  74   GSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYD  133

Query  372  STLGIFDADVK  404
            S LG F A+VK
Sbjct  134  SMLGTFKAEVK  144



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    + V  AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYD
Sbjct  70   GSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYD  129

Query  372  STLGIFDADVK  404
            S LG F A+VK
Sbjct  130  SMLGTFKAEVK  140



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYD
Sbjct  75   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYD  134

Query  372  STLGIFDADVK  404
            S LG F ADVK
Sbjct  135  SMLGTFKADVK  145



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+GGVK ASHLLKYDS LG 
Sbjct  79   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGT  138

Query  387  FDADVKPV  410
            F ADVK V
Sbjct  139  FKADVKIV  146



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +3

Query  192  GGKQRRAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYD  371
            G    R    AKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+ +ND+GGVK ASHLLKYD
Sbjct  74   GSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYD  133

Query  372  STLGIFDADVK  404
            S LG F ADVK
Sbjct  134  SMLGTFKADVK  144



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +3

Query  207  RAVVEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGI  386
            R    AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVI +ND+GGVK ASHLLKYDS LG 
Sbjct  80   RGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGT  139

Query  387  FDADVKPV  410
            F A+VK V
Sbjct  140  FKAEVKIV  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562275868875