BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS002D07

Length=472
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610601.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        209   1e-61   Nicotiana tomentosiformis
ref|XP_009791207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    206   1e-60   Nicotiana sylvestris
ref|XP_006345964.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    203   2e-59   Solanum tuberosum [potatoes]
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    202   3e-59   Sesamum indicum [beniseed]
ref|XP_004239793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        202   9e-59   Solanum lycopersicum
ref|NP_001234416.1|  beta-glucosidase 08 precursor                      194   3e-56   Solanum lycopersicum
gb|AHL24654.1|  Fra e 9.01 allergen                                     193   5e-56   Fraxinus excelsior
ref|NP_001275174.1|  glucan endo-1,3-beta-glucosidase-like precursor    192   1e-55   Solanum tuberosum [potatoes]
gb|AHL24655.1|  Fra e 9.02 allergen                                     192   2e-55   Fraxinus excelsior
ref|XP_009593199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    191   4e-55   Nicotiana tomentosiformis
ref|XP_009789910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    189   3e-54   Nicotiana sylvestris
gb|EYU33213.1|  hypothetical protein MIMGU_mgv1a006294mg                188   5e-54   Erythranthe guttata [common monkey flower]
gb|EPS63364.1|  glycoside hydrolase                                     186   1e-53   Genlisea aurea
emb|CDP00093.1|  unnamed protein product                                186   2e-53   Coffea canephora [robusta coffee]
gb|EPS69142.1|  hypothetical protein M569_05624                         174   1e-49   Genlisea aurea
ref|XP_011101632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    176   2e-49   
ref|XP_010091462.1|  putative glucan endo-1,3-beta-glucosidase A6       167   6e-49   
ref|XP_003552703.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        173   2e-48   Glycine max [soybeans]
ref|XP_003622030.1|  Glucan endo-1,3-beta-glucosidase                   168   2e-46   Medicago truncatula
ref|XP_004516968.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    167   3e-46   Cicer arietinum [garbanzo]
ref|XP_007220314.1|  hypothetical protein PRUPE_ppa005160m1g            164   4e-46   
ref|XP_008233624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    164   8e-45   Prunus mume [ume]
ref|XP_004307514.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    163   2e-44   Fragaria vesca subsp. vesca
gb|EYU19897.1|  hypothetical protein MIMGU_mgv1a006105mg                162   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_011470609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    164   3e-44   Fragaria vesca subsp. vesca
ref|XP_008342287.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    159   5e-44   
ref|XP_007139210.1|  hypothetical protein PHAVU_008G010600g             160   8e-44   Phaseolus vulgaris [French bean]
dbj|BAB40807.1|  endo-1,3-beta-glucanase-like protein                   159   2e-43   Pyrus pyrifolia [sha li]
emb|CAB85903.1|  beta-1,3 glucanase                                     159   2e-43   Pisum sativum [garden pea]
ref|XP_008382814.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   3e-43   Malus domestica [apple tree]
ref|XP_009357725.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    158   3e-43   
ref|XP_008343598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    157   4e-43   
ref|XP_004147695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    157   1e-42   
ref|XP_008382813.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   1e-42   
ref|XP_004167482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    157   1e-42   
emb|CBI31680.3|  unnamed protein product                                156   1e-42   Vitis vinifera
ref|XP_008461659.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        157   2e-42   Cucumis melo [Oriental melon]
ref|XP_011029669.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    156   3e-42   Populus euphratica
ref|XP_009357726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        157   4e-42   
ref|XP_002283647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        156   4e-42   Vitis vinifera
ref|XP_010534498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        155   6e-42   Tarenaya hassleriana [spider flower]
gb|ACM45718.1|  endo-1,3-beta-glucanase                                 155   1e-41   Pyrus x bretschneideri x Pyrus pyrifolia
gb|ABK95730.1|  unknown                                                 155   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_002312097.1|  hypothetical protein POPTR_0008s05600g             155   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_002878033.1|  hypothetical protein ARALYDRAFT_485970             154   1e-41   
ref|XP_008371690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    154   2e-41   Malus domestica [apple tree]
gb|KJB73920.1|  hypothetical protein B456_011G261000                    152   3e-41   Gossypium raimondii
ref|XP_008362701.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    154   5e-41   Malus domestica [apple tree]
ref|XP_009357727.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    153   5e-41   
gb|AAM66982.1|  beta-1,3-glucanase-like protein                         153   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191103.1|  O-Glycosyl hydrolases family 17 protein               153   7e-41   Arabidopsis thaliana [mouse-ear cress]
gb|AAK76666.1|  putative beta-1,3-glucanase                             153   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403459.1|  hypothetical protein EUTSA_v10010363mg             152   9e-41   Eutrema salsugineum [saltwater cress]
ref|XP_002530862.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    152   1e-40   
ref|XP_010922329.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    152   1e-40   Elaeis guineensis
ref|XP_002890613.1|  predicted protein                                  143   2e-40   
ref|XP_010690550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   3e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010690542.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   3e-40   
ref|XP_010504397.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    151   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010516112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    151   3e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002530863.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    151   4e-40   Ricinus communis
ref|XP_006291113.1|  hypothetical protein CARUB_v10017225mg             150   8e-40   Capsella rubella
ref|XP_011027355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        150   9e-40   Populus euphratica
emb|CDY62387.1|  BnaCnng40170D                                          150   1e-39   Brassica napus [oilseed rape]
ref|XP_010034118.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        150   1e-39   Eucalyptus grandis [rose gum]
emb|CDY53692.1|  BnaA07g37860D                                          149   1e-39   Brassica napus [oilseed rape]
ref|XP_009343476.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        150   1e-39   Pyrus x bretschneideri [bai li]
emb|CDY41232.1|  BnaC08g26260D                                          149   2e-39   Brassica napus [oilseed rape]
gb|KCW85568.1|  hypothetical protein EUGRSUZ_B02365                     147   2e-39   Eucalyptus grandis [rose gum]
ref|XP_008802734.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        149   2e-39   Phoenix dactylifera
emb|CDY41234.1|  BnaC08g26240D                                          149   2e-39   Brassica napus [oilseed rape]
ref|XP_010043554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    147   2e-39   Eucalyptus grandis [rose gum]
ref|XP_002315222.2|  hypothetical protein POPTR_0010s21130g             148   5e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010043553.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    147   6e-39   Eucalyptus grandis [rose gum]
ref|XP_009103956.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    147   6e-39   Brassica rapa
gb|KCW85570.1|  hypothetical protein EUGRSUZ_B02367                     147   7e-39   Eucalyptus grandis [rose gum]
ref|XP_010043555.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    147   1e-38   Eucalyptus grandis [rose gum]
gb|KFK34786.1|  hypothetical protein AALP_AA5G193500                    147   1e-38   Arabis alpina [alpine rockcress]
ref|XP_009116237.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    147   1e-38   Brassica rapa
emb|CDY40218.1|  BnaA09g35000D                                          147   1e-38   Brassica napus [oilseed rape]
emb|CDY02936.1|  BnaC04g25500D                                          146   2e-38   
ref|XP_009116238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    146   2e-38   
ref|XP_010427314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    146   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009405069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    146   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP44958.1|  hypothetical protein JCGZ_01458                         145   3e-38   Jatropha curcas
emb|CDY40219.1|  BnaA09g35010D                                          145   4e-38   Brassica napus [oilseed rape]
ref|XP_010256938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    145   5e-38   Nelumbo nucifera [Indian lotus]
emb|CDX76097.1|  BnaA04g03610D                                          145   7e-38   
ref|XP_010937626.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    144   2e-37   Elaeis guineensis
ref|XP_009345986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    144   2e-37   Pyrus x bretschneideri [bai li]
ref|XP_009345982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    144   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_009353665.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    144   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_009139167.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    142   5e-37   Brassica rapa
ref|XP_007009341.1|  O-Glycosyl hydrolases family 17 protein, put...    142   5e-37   
ref|XP_003561280.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    142   6e-37   Brachypodium distachyon [annual false brome]
ref|XP_004959111.1|  PREDICTED: uncharacterized protein LOC101782084    145   7e-37   
ref|XP_006350772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    142   7e-37   Solanum tuberosum [potatoes]
gb|KJB37375.1|  hypothetical protein B456_006G202300                    142   9e-37   Gossypium raimondii
ref|XP_010106478.1|  Glucan endo-1,3-beta-glucosidase                   141   1e-36   
ref|XP_008810606.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        139   2e-36   
ref|XP_010043552.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    141   2e-36   
gb|KCW85567.1|  hypothetical protein EUGRSUZ_B02364                     141   2e-36   Eucalyptus grandis [rose gum]
ref|XP_007205054.1|  hypothetical protein PRUPE_ppa004320mg             141   3e-36   Prunus persica
ref|XP_010264453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        140   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_002312098.1|  glucan endo-1 family protein                       140   3e-36   Populus trichocarpa [western balsam poplar]
ref|NP_001151227.1|  glucan endo-1,3-beta-glucosidase precursor         140   4e-36   Zea mays [maize]
ref|XP_011029787.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    140   4e-36   Populus euphratica
ref|XP_008437641.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        140   5e-36   Cucumis melo [Oriental melon]
gb|KHG22731.1|  Glucan endo-1,3-beta-glucosidase                        140   5e-36   Gossypium arboreum [tree cotton]
ref|XP_004145947.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    140   7e-36   
emb|CDP05033.1|  unnamed protein product                                139   7e-36   Coffea canephora [robusta coffee]
ref|XP_006394688.1|  hypothetical protein EUTSA_v10004182mg             139   7e-36   
ref|XP_009419749.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    139   9e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN49838.1|  hypothetical protein Csa_5G139170                       139   1e-35   Cucumis sativus [cucumbers]
ref|XP_004241225.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    139   1e-35   Solanum lycopersicum
ref|XP_007013798.1|  O-Glycosyl hydrolases family 17 protein, put...    139   1e-35   
ref|XP_007013797.1|  O-Glycosyl hydrolases family 17 protein, put...    139   1e-35   
ref|XP_008457482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        139   2e-35   
gb|KHF99783.1|  Glucan endo-1,3-beta-glucosidase                        138   3e-35   Gossypium arboreum [tree cotton]
ref|XP_006441150.1|  hypothetical protein CICLE_v10020075mg             137   3e-35   Citrus clementina [clementine]
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    137   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846179.1|  hypothetical protein AMTR_s00012p00207210          137   3e-35   Amborella trichopoda
ref|XP_009796709.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    137   3e-35   Nicotiana sylvestris
gb|KHG05533.1|  Glucan endo-1,3-beta-glucosidase                        137   4e-35   Gossypium arboreum [tree cotton]
ref|XP_004151673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    137   4e-35   
emb|CDP21469.1|  unnamed protein product                                137   5e-35   Coffea canephora [robusta coffee]
ref|XP_008223598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    137   7e-35   Prunus mume [ume]
ref|XP_006491986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    136   7e-35   Citrus sinensis [apfelsine]
ref|XP_004295910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    137   7e-35   Fragaria vesca subsp. vesca
dbj|BAK07810.1|  predicted protein                                      136   8e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002318439.2|  hypothetical protein POPTR_0012s02490g             136   9e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010048931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        136   1e-34   Eucalyptus grandis [rose gum]
emb|CDY20461.1|  BnaC04g05830D                                          135   1e-34   Brassica napus [oilseed rape]
ref|XP_007137073.1|  hypothetical protein PHAVU_009G097400g             134   2e-34   Phaseolus vulgaris [French bean]
ref|XP_011035318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    135   2e-34   Populus euphratica
ref|XP_007039107.1|  O-Glycosyl hydrolases family 17 protein            135   2e-34   
ref|XP_008376760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        135   2e-34   Malus domestica [apple tree]
gb|KJB83778.1|  hypothetical protein B456_013G263800                    135   2e-34   Gossypium raimondii
gb|KJB19861.1|  hypothetical protein B456_003G121900                    134   2e-34   Gossypium raimondii
emb|CDY53600.1|  BnaA05g34730D                                          135   3e-34   Brassica napus [oilseed rape]
ref|XP_009143300.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        135   3e-34   Brassica rapa
emb|CBI16129.3|  unnamed protein product                                133   3e-34   Vitis vinifera
ref|XP_004498531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    133   4e-34   
gb|KHN16491.1|  Glucan endo-1,3-beta-glucosidase                        133   5e-34   Glycine soja [wild soybean]
gb|KDP34495.1|  hypothetical protein JCGZ_11045                         134   6e-34   Jatropha curcas
gb|KJB53907.1|  hypothetical protein B456_009G010800                    134   8e-34   Gossypium raimondii
ref|XP_006435532.1|  hypothetical protein CICLE_v10033472mg             133   1e-33   Citrus clementina [clementine]
ref|XP_007220925.1|  hypothetical protein PRUPE_ppa023079mg             133   1e-33   Prunus persica
ref|XP_006486487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    133   1e-33   Citrus sinensis [apfelsine]
ref|XP_007016412.1|  O-Glycosyl hydrolases family 17 protein isof...    133   1e-33   
emb|CAN72975.1|  hypothetical protein VITISV_019488                     133   1e-33   Vitis vinifera
ref|XP_002281025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    133   1e-33   Vitis vinifera
ref|XP_008234701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        133   2e-33   Prunus mume [ume]
ref|XP_007016411.1|  O-Glycosyl hydrolases family 17 protein isof...    133   2e-33   
ref|XP_011025078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    133   2e-33   Populus euphratica
ref|XP_006411190.1|  hypothetical protein EUTSA_v10017897mg             133   2e-33   Eutrema salsugineum [saltwater cress]
ref|XP_002526252.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    132   2e-33   
ref|XP_007157802.1|  hypothetical protein PHAVU_002G099500g             132   3e-33   Phaseolus vulgaris [French bean]
gb|EMT11580.1|  Glucan endo-1,3-beta-glucosidase                        132   4e-33   
ref|XP_002298356.1|  glycosyl hydrolase family 17 family protein        131   5e-33   
ref|XP_009620579.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    130   6e-33   
gb|KFK27709.1|  hypothetical protein AALP_AA8G419000                    130   9e-33   Arabis alpina [alpine rockcress]
ref|XP_010519454.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    131   9e-33   Tarenaya hassleriana [spider flower]
ref|XP_011044676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   9e-33   Populus euphratica
ref|XP_011044679.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    130   1e-32   Populus euphratica
ref|NP_001119271.1|  O-Glycosyl hydrolases family 17 protein            130   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002532848.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    130   2e-32   Ricinus communis
gb|KJB23726.1|  hypothetical protein B456_004G111800                    129   2e-32   Gossypium raimondii
ref|XP_011015294.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    130   2e-32   Populus euphratica
gb|KDP35193.1|  hypothetical protein JCGZ_09352                         130   2e-32   Jatropha curcas
ref|NP_001031936.1|  O-Glycosyl hydrolases family 17 protein            130   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002459582.1|  hypothetical protein SORBIDRAFT_02g007050          130   2e-32   
ref|XP_010662898.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        129   3e-32   Vitis vinifera
gb|EAZ03332.1|  hypothetical protein OsI_25474                          129   3e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_002874188.1|  hydrolase, hydrolyzing O-glycosyl compounds        129   4e-32   
ref|XP_010421258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    129   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010267530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        129   4e-32   Nelumbo nucifera [Indian lotus]
ref|NP_001059262.1|  Os07g0240200                                       129   4e-32   
emb|CDX87130.1|  BnaC09g04450D                                          129   5e-32   
ref|XP_010519453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    129   5e-32   Tarenaya hassleriana [spider flower]
ref|XP_010109237.1|  Glucan endo-1,3-beta-glucosidase                   128   6e-32   
ref|XP_011046747.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    128   6e-32   Populus euphratica
ref|XP_010318035.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        127   7e-32   Solanum lycopersicum
ref|XP_011046750.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   7e-32   Populus euphratica
ref|XP_006295997.1|  hypothetical protein CARUB_v10025141mg             129   7e-32   Capsella rubella
ref|XP_010421259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   9e-32   
ref|XP_009799239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   1e-31   Nicotiana sylvestris
ref|XP_010493578.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        127   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010685761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    126   4e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006658422.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    126   5e-31   
ref|XP_004505325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   7e-31   Cicer arietinum [garbanzo]
ref|XP_004505326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   8e-31   
ref|XP_006350517.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    124   1e-30   Solanum tuberosum [potatoes]
ref|XP_006287713.1|  hypothetical protein CARUB_v10000922mg             125   1e-30   
ref|XP_010535497.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        124   1e-30   
ref|XP_004309121.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        124   2e-30   Fragaria vesca subsp. vesca
ref|XP_002321390.2|  hypothetical protein POPTR_0015s01240g             123   2e-30   
emb|CDY19838.1|  BnaA09g04910D                                          124   3e-30   Brassica napus [oilseed rape]
ref|XP_009111627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        124   3e-30   Brassica rapa
ref|XP_003588492.1|  Glucan endo-1,3-beta-glucosidase                   122   6e-30   
ref|NP_001130652.1|  uncharacterized protein LOC100191753 precursor     122   7e-30   Zea mays [maize]
ref|XP_011075984.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        121   2e-29   
ref|XP_010063141.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    121   2e-29   Eucalyptus grandis [rose gum]
ref|XP_008377317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   2e-29   Malus domestica [apple tree]
gb|EPS68882.1|  hypothetical protein M569_05882                         120   3e-29   Genlisea aurea
ref|XP_009586622.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    120   3e-29   
ref|XP_008783886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   4e-29   
gb|AES90042.2|  O-glycosyl hydrolase family 17 protein                  120   5e-29   Medicago truncatula
ref|XP_009374190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   5e-29   Pyrus x bretschneideri [bai li]
gb|EMS59735.1|  Glucan endo-1,3-beta-glucosidase 11                     120   5e-29   Triticum urartu
ref|XP_008783885.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   5e-29   
ref|NP_181494.1|  glycosyl hydrolase-17                                 120   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607845.1|  Glucan endo-1,3-beta-glucosidase                   120   6e-29   
gb|ABK24695.1|  unknown                                                 119   9e-29   Picea sitchensis
ref|XP_009374179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      119   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_006307574.1|  hypothetical protein CARUB_v10009196mg             119   1e-28   Capsella rubella
ref|XP_010671896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        118   1e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006827757.1|  hypothetical protein AMTR_s00009p00263650          119   2e-28   
ref|XP_010925705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   2e-28   
ref|XP_010925707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   2e-28   
ref|XP_009406752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   2e-28   
ref|XP_006424832.1|  hypothetical protein CICLE_v10028241mg             119   2e-28   Citrus clementina [clementine]
ref|XP_006488330.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   2e-28   Citrus sinensis [apfelsine]
gb|KDO72847.1|  hypothetical protein CISIN_1g0375832mg                  118   3e-28   Citrus sinensis [apfelsine]
ref|XP_002881667.1|  glycosyl hydrolase family 17 protein               118   4e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_010227646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   5e-28   Brachypodium distachyon [annual false brome]
ref|XP_010412950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    118   6e-28   
ref|XP_009421254.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    116   7e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007201010.1|  hypothetical protein PRUPE_ppa005375mg             117   7e-28   Prunus persica
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    116   1e-27   Elaeis guineensis
ref|XP_010505644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    118   1e-27   
emb|CAB80165.1|  putative protein (fragment)                            115   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EYU43261.1|  hypothetical protein MIMGU_mgv1a008785mg                115   2e-27   Erythranthe guttata [common monkey flower]
emb|CBI30910.3|  unnamed protein product                                115   2e-27   Vitis vinifera
ref|XP_010512954.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    118   2e-27   
ref|XP_006292633.1|  hypothetical protein CARUB_v10018875mg             115   2e-27   
ref|XP_002270153.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     115   2e-27   Vitis vinifera
ref|XP_008783477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      115   2e-27   Phoenix dactylifera
ref|NP_190241.1|  Glycosyl hydrolase superfamily protein                115   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855691.1|  hypothetical protein AMTR_s00044p00136160          113   2e-27   
ref|XP_006657020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   3e-27   Oryza brachyantha
ref|XP_009380510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   3e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380508.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010478704.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   4e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009380509.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    114   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_195174.6|  glucan endo-1,3-beta-glucosidase 7                    115   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002437077.1|  hypothetical protein SORBIDRAFT_10g020900          114   5e-27   Sorghum bicolor [broomcorn]
ref|XP_010499813.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    114   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010461089.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     114   6e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009114852.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     114   6e-27   Brassica rapa
emb|CDX93815.1|  BnaA09g24150D                                          114   7e-27   
ref|XP_008778544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   8e-27   Phoenix dactylifera
ref|XP_001780679.1|  predicted protein                                  113   9e-27   
ref|XP_010432409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    114   9e-27   Camelina sativa [gold-of-pleasure]
ref|NP_001050864.2|  Os03g0669300                                       110   1e-26   
emb|CDY45313.1|  BnaA03g52860D                                          115   2e-26   Brassica napus [oilseed rape]
ref|XP_006651673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    112   2e-26   
dbj|BAD54223.1|  putative beta-1,3-glucanase precursor                  112   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002877494.1|  predicted protein                                  112   2e-26   
gb|KGN49400.1|  hypothetical protein Csa_6G523410                       112   2e-26   Cucumis sativus [cucumbers]
ref|XP_008236880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      112   2e-26   Prunus mume [ume]
gb|EEE65821.1|  hypothetical protein OsJ_21560                          112   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002272900.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     112   3e-26   Vitis vinifera
emb|CBI40742.3|  unnamed protein product                                112   3e-26   Vitis vinifera
ref|XP_010478378.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    112   3e-26   Camelina sativa [gold-of-pleasure]
ref|NP_001057782.1|  Os06g0531000                                       112   3e-26   
ref|XP_002448791.1|  hypothetical protein SORBIDRAFT_06g033250          112   3e-26   Sorghum bicolor [broomcorn]
ref|XP_008392643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    112   3e-26   Malus domestica [apple tree]
ref|XP_010447074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    112   3e-26   Camelina sativa [gold-of-pleasure]
gb|EEC80746.1|  hypothetical protein OsI_23229                          112   3e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_009407686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    112   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008392644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    112   3e-26   Malus domestica [apple tree]
ref|XP_008392645.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    112   4e-26   Malus domestica [apple tree]
ref|XP_004965529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    112   4e-26   Setaria italica
emb|CDX69064.1|  BnaC01g03890D                                          112   4e-26   
ref|XP_010107844.1|  Glucan endo-1,3-beta-glucosidase 7                 112   4e-26   
ref|XP_002976327.1|  hypothetical protein SELMODRAFT_105037             111   4e-26   
ref|XP_008781529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    111   4e-26   
emb|CDY26296.1|  BnaA09g26470D                                          111   4e-26   Brassica napus [oilseed rape]
ref|XP_009115194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     111   5e-26   
tpg|DAA35302.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    112   5e-26   
ref|XP_006663687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    112   5e-26   
ref|NP_001151529.1|  LOC100285163 precursor                             111   5e-26   
ref|XP_010499522.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    111   6e-26   
gb|AAM96962.1|  putative beta-1,3-glucanase precursor                   111   7e-26   
ref|XP_010915632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   7e-26   
ref|XP_008466580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      111   9e-26   
ref|XP_008374135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   1e-25   
ref|XP_009138298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    111   1e-25   
ref|XP_002987317.1|  hypothetical protein SELMODRAFT_125909             110   1e-25   
ref|XP_008352157.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    110   1e-25   
ref|XP_004147788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    111   1e-25   
ref|XP_009138297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    111   1e-25   
ref|XP_010444969.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    111   1e-25   
ref|XP_010096392.1|  Glucan endo-1,3-beta-glucosidase 7                 110   1e-25   
ref|XP_010460784.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   1e-25   
emb|CDX99881.1|  BnaC05g23030D                                          110   1e-25   
ref|XP_010052055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     110   1e-25   
ref|XP_006304941.1|  hypothetical protein CARUB_v10011427mg             110   1e-25   
ref|XP_010279617.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   2e-25   
ref|XP_010279618.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   2e-25   
emb|CDX72483.1|  BnaC07g45050D                                          113   2e-25   
gb|KCW75916.1|  hypothetical protein EUGRSUZ_D00293                     110   2e-25   
ref|XP_004169494.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   2e-25   
gb|EMS57155.1|  Glucan endo-1,3-beta-glucosidase                        110   2e-25   
ref|XP_006415516.1|  hypothetical protein EUTSA_v10007753mg             110   2e-25   
ref|XP_008439628.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    109   2e-25   
ref|XP_002275642.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     110   2e-25   
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g             110   2e-25   
ref|XP_011470886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   2e-25   
ref|XP_004309523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   2e-25   
ref|XP_010549489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     109   2e-25   
ref|XP_010094541.1|  Glucan endo-1,3-beta-glucosidase 12                110   2e-25   
ref|XP_010942826.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      110   3e-25   
ref|XP_010507244.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    109   3e-25   
ref|XP_011085243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    109   3e-25   
emb|CDX90225.1|  BnaA08g17590D                                          109   3e-25   
ref|XP_009109623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    109   3e-25   
ref|XP_007042210.1|  O-Glycosyl hydrolases family 17 protein isof...    109   3e-25   
ref|XP_011096565.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    109   4e-25   
emb|CDY69080.1|  BnaCnng61800D                                          108   4e-25   
ref|XP_008439627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   4e-25   
ref|XP_004162616.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   4e-25   
ref|XP_010274875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   4e-25   
ref|XP_009785958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   4e-25   
gb|KFK44831.1|  hypothetical protein AALP_AA1G308300                    108   4e-25   
gb|KJB32497.1|  hypothetical protein B456_005G243100                    108   4e-25   
ref|XP_011096566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   4e-25   
gb|EEC78268.1|  hypothetical protein OsI_17962                          111   4e-25   
gb|AFS50098.1|  glucan endo-1,3-beta-glucosidase                        109   4e-25   
emb|CAJ86292.1|  H0124B04.9                                             112   5e-25   
ref|XP_002893598.1|  predicted protein                                  108   5e-25   
ref|XP_007042209.1|  O-Glycosyl hydrolases family 17 protein isof...    109   5e-25   
emb|CDX75437.1|  BnaA01g02650D                                          109   6e-25   
ref|XP_009592800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   6e-25   
ref|XP_009772777.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   6e-25   
ref|XP_002867117.1|  hypothetical protein ARALYDRAFT_491210             108   6e-25   
ref|XP_002282736.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    108   7e-25   
emb|CDO97058.1|  unnamed protein product                                108   7e-25   
ref|XP_010664681.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    109   7e-25   
gb|KJB32499.1|  hypothetical protein B456_005G243100                    108   7e-25   
gb|EEC68648.1|  hypothetical protein OsI_37085                          108   7e-25   
ref|NP_001068545.2|  Os11g0704600                                       108   8e-25   
ref|NP_174300.2|  glycosyl hydrolases family protein                    108   8e-25   
ref|XP_011024410.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    109   8e-25   
emb|CAA18827.1|  putative protein (fragment)                            107   8e-25   
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   8e-25   
gb|KDP38495.1|  hypothetical protein JCGZ_04420                         108   8e-25   
gb|AAG52058.1|AC022455_12  beta-1,3-glucanase precursor, putative...    108   8e-25   
gb|KHG11479.1|  hypothetical protein F383_06303                         108   9e-25   
gb|AAP44659.1|  putative beta 1,3-glucanase                             108   9e-25   
ref|XP_010542063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     108   9e-25   
ref|XP_008383474.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   1e-24   
ref|XP_007018100.1|  Glucan endo-1,3-beta-glucosidase, putative         108   1e-24   
gb|AAX95357.1|  glucan endo-1,3-beta-glucosidase precursor (ec 3....    108   1e-24   
gb|EMT31321.1|  Glucan endo-1,3-beta-glucosidase                        108   1e-24   
ref|XP_008358612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   1e-24   
gb|EAY91326.1|  hypothetical protein OsI_12942                          108   1e-24   
gb|KJB32496.1|  hypothetical protein B456_005G243100                    108   1e-24   
ref|XP_006360726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   1e-24   
ref|XP_008373395.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    108   1e-24   
ref|XP_002893744.1|  glycosyl hydrolase family 17 protein               107   1e-24   
ref|XP_002510373.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    107   1e-24   
ref|XP_010252096.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     107   1e-24   
ref|XP_009112198.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      108   2e-24   
ref|XP_004252615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   2e-24   
ref|XP_009372602.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    107   2e-24   
ref|XP_004293211.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      107   2e-24   
ref|XP_010263687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   2e-24   
gb|AFS50099.1|  glucan endo-1,3-beta-glucosidase                        107   2e-24   
gb|KFK33989.1|  hypothetical protein AALP_AA5G087500                    107   2e-24   
dbj|BAJ85927.1|  predicted protein                                      107   2e-24   
ref|XP_010553580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 10     107   2e-24   
gb|EYU45144.1|  hypothetical protein MIMGU_mgv1a006001mg                107   3e-24   
ref|XP_006412222.1|  hypothetical protein EUTSA_v10024968mg             107   3e-24   
gb|ABR16583.1|  unknown                                                 106   3e-24   
ref|XP_007025069.1|  Glycosyl hydrolase superfamily protein             106   3e-24   
gb|AAX95269.1|  glucan endo-1,3-beta-glucosidase precursor (ec 3....    106   3e-24   
ref|XP_009344063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   3e-24   
ref|XP_008225490.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   3e-24   
ref|XP_009344064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   3e-24   
ref|XP_009626249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   3e-24   
ref|XP_004134912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   3e-24   
ref|XP_008238068.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   3e-24   
gb|EMS56219.1|  Glucan endo-1,3-beta-glucosidase                        106   3e-24   
ref|XP_008225491.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   4e-24   
gb|KDP36766.1|  hypothetical protein JCGZ_08057                         106   4e-24   
ref|XP_009360891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     106   4e-24   
ref|XP_009360206.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   4e-24   
sp|P52409.1|E13B_WHEAT  RecName: Full=Glucan endo-1,3-beta-glucos...    106   5e-24   
ref|XP_006845039.1|  hypothetical protein AMTR_s00058p00220600          106   5e-24   
ref|XP_007211424.1|  hypothetical protein PRUPE_ppa007088mg             105   5e-24   
emb|CAN80621.1|  hypothetical protein VITISV_043431                     106   5e-24   
ref|XP_006409465.1|  hypothetical protein EUTSA_v10022641mg             107   5e-24   
ref|XP_006467461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    105   5e-24   
gb|KJB10702.1|  hypothetical protein B456_001G216900                    106   6e-24   
emb|CDY13362.1|  BnaC06g13950D                                          105   6e-24   
ref|XP_004301627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   6e-24   
gb|KDO78187.1|  hypothetical protein CISIN_1g016045mg                   105   6e-24   
ref|XP_006449699.1|  hypothetical protein CICLE_v10015646mg             105   6e-24   
ref|XP_002510704.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    106   6e-24   
gb|EYU33370.1|  hypothetical protein MIMGU_mgv1a018482mg                105   6e-24   
ref|XP_011034841.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   7e-24   
gb|KJB14206.1|  hypothetical protein B456_002G114200                    105   7e-24   
ref|XP_004968988.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   7e-24   
ref|XP_006476269.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    105   7e-24   
ref|XP_009595793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    105   7e-24   
ref|XP_008245888.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    105   7e-24   
ref|XP_004233126.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     105   8e-24   
ref|XP_003577202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    105   8e-24   
gb|AFU52665.1|  putative PD beta-1,3-glucanase 1                        105   8e-24   
ref|XP_010519110.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      105   8e-24   
gb|KJB10701.1|  hypothetical protein B456_001G216900                    105   8e-24   
ref|XP_004299094.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      106   8e-24   
ref|XP_010905996.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    105   9e-24   
ref|XP_004960035.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    105   9e-24   
ref|XP_010905995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    105   9e-24   
ref|XP_002300634.2|  hypothetical protein POPTR_0002s00860g             105   9e-24   
ref|XP_007209175.1|  hypothetical protein PRUPE_ppa006239mg             105   9e-24   
ref|XP_007209174.1|  hypothetical protein PRUPE_ppa006239mg             105   9e-24   
ref|XP_010540580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    105   1e-23   
gb|KFK30062.1|  hypothetical protein AALP_AA7G211800                    105   1e-23   
emb|CDX67530.1|  BnaA07g15700D                                          105   1e-23   
ref|XP_004149679.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    104   1e-23   
gb|KGN65539.1|  hypothetical protein Csa_1G436330                       104   1e-23   
ref|XP_009125220.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 10     104   1e-23   
ref|XP_006415143.1|  hypothetical protein EUTSA_v10007671mg             104   1e-23   
gb|KDP46246.1|  hypothetical protein JCGZ_10086                         105   2e-23   
gb|EEE52578.1|  hypothetical protein OsJ_34867                          107   2e-23   
ref|XP_002519678.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    104   2e-23   
emb|CDP07525.1|  unnamed protein product                                105   2e-23   
gb|KFK45032.1|  hypothetical protein AALP_AA1G335200                    104   2e-23   
gb|KJB57237.1|  hypothetical protein B456_009G154800                    103   2e-23   
gb|KHG00665.1|  hypothetical protein F383_20417                         104   2e-23   
ref|XP_004252276.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    104   2e-23   
gb|KDO76773.1|  hypothetical protein CISIN_1g015263mg                   104   2e-23   
gb|KJB57236.1|  hypothetical protein B456_009G154800                    103   2e-23   
ref|XP_002306099.1|  hypothetical protein POPTR_0004s16120g             103   2e-23   
gb|AAF31288.1|AC006424_17  CDS                                          104   2e-23   
gb|AFK44108.1|  unknown                                                 100   2e-23   
tpg|DAA63006.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    106   2e-23   
ref|XP_010110962.1|  Glucan endo-1,3-beta-glucosidase 11                103   2e-23   
ref|XP_008653189.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    106   2e-23   
ref|NP_174563.2|  glucan endo-1,3-beta-glucosidase 11                   103   3e-23   
ref|XP_002306003.2|  hypothetical protein POPTR_0004s13980g             103   3e-23   
ref|XP_007136171.1|  hypothetical protein PHAVU_009G024000g             104   3e-23   
ref|XP_010056028.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   3e-23   
ref|XP_010065396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    104   3e-23   
tpg|DAA63007.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    106   3e-23   
gb|KCW72602.1|  hypothetical protein EUGRSUZ_E01067                     103   3e-23   
ref|XP_011048644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    104   3e-23   
ref|XP_009801195.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    104   3e-23   
gb|KJB69824.1|  hypothetical protein B456_011G044700                    103   3e-23   
gb|KCW72601.1|  hypothetical protein EUGRSUZ_E01067                     103   3e-23   
gb|KJB69825.1|  hypothetical protein B456_011G044700                    103   3e-23   
ref|XP_010254870.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      104   3e-23   
ref|XP_011081364.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     103   3e-23   
ref|XP_002509479.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    103   3e-23   
gb|KDP38494.1|  hypothetical protein JCGZ_04419                         103   4e-23   
ref|XP_011070401.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   4e-23   
gb|EMS50259.1|  Glucan endo-1,3-beta-glucosidase 14                     103   4e-23   
ref|XP_010244978.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     103   4e-23   
gb|KHG05496.1|  hypothetical protein F383_30989                         103   4e-23   
ref|XP_010423738.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    104   4e-23   
gb|KHG28308.1|  hypothetical protein F383_11467                         103   4e-23   
ref|XP_007209985.1|  hypothetical protein PRUPE_ppa005142mg             103   4e-23   
ref|XP_011083694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      103   4e-23   
ref|XP_006583914.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   5e-23   
ref|XP_010530842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      104   5e-23   
emb|CDP18512.1|  unnamed protein product                                103   5e-23   
ref|XP_006583915.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   5e-23   
ref|XP_007222662.1|  hypothetical protein PRUPE_ppa004976mg             103   6e-23   
ref|XP_006384505.1|  hypothetical protein POPTR_0004s16120g             103   6e-23   
ref|XP_008444326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   6e-23   
gb|AFK46350.1|  unknown                                                 101   6e-23   
ref|XP_006299612.1|  hypothetical protein CARUB_v10015799mg             103   6e-23   
ref|XP_010467346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      103   6e-23   
ref|XP_006405276.1|  hypothetical protein EUTSA_v10027775mg             103   6e-23   
ref|XP_009758633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   6e-23   
ref|XP_011037536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   7e-23   
ref|XP_006583913.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   7e-23   
ref|XP_010668075.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     102   7e-23   
ref|XP_008788767.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   7e-23   
ref|XP_002886212.1|  glycosyl hydrolase family 17 protein               103   8e-23   
ref|XP_009364443.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    103   8e-23   
ref|XP_004251202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   8e-23   
ref|XP_010489192.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   8e-23   
ref|XP_010559242.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   9e-23   
ref|XP_003522947.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    102   9e-23   
ref|XP_006405275.1|  hypothetical protein EUTSA_v10027775mg             102   9e-23   
gb|KJB13749.1|  hypothetical protein B456_002G092600                    103   9e-23   
gb|KHG21190.1|  hypothetical protein F383_01641                         103   1e-22   
gb|KHG16903.1|  hypothetical protein F383_04540                         102   1e-22   
ref|XP_004982218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   1e-22   
ref|XP_009414127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   1e-22   
ref|XP_009365605.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    103   1e-22   
ref|XP_009758632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   1e-22   
ref|XP_010928243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   1e-22   
ref|XP_010489191.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   1e-22   
ref|XP_010481959.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   1e-22   



>ref|XP_009610601.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nicotiana tomentosiformis]
Length=494

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = +1

Query  22   MEMSLRPSPIFLFFLVSAFLFIHG---VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  192
            MEMS + +  FL FL  + +FI     V SIGVNYGTLG+NLPPP++VA+FLK+KT+ID+
Sbjct  1    MEMSNKKTSPFLSFLFISAIFIQCFPYVSSIGVNYGTLGNNLPPPSQVAQFLKDKTIIDK  60

Query  193  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  372
            IKIFDVNPDILRAFA TGI VTVTVPNGEI  L D GYA  +V ANIKPFYP TKI++IA
Sbjct  61   IKIFDVNPDILRAFANTGISVTVTVPNGEIPKLLDIGYAKSYVEANIKPFYPQTKIDVIA  120

Query  373  VGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            +GNE+LHW TPE+QN LV AMR+ Y AL++SGI
Sbjct  121  IGNEILHWETPEVQNKLVPAMRTFYQALIQSGI  153



>ref|XP_009791207.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=490

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = +1

Query  22   MEMSLRPSPIFLFFLVSAFLFIHG---VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  192
            MEMS + +  FL  L  + +FI     V SIGVNYGTLG+NLPPP++VA+FLK+KT+ID+
Sbjct  1    MEMSNKKTSPFLSILFISAIFIQCFPYVSSIGVNYGTLGNNLPPPSQVAQFLKDKTIIDK  60

Query  193  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  372
            IKIFDVNPDILRAFA TGI VTVTVPNGEI  L D GYA  +V ANIKPFYP TKI++IA
Sbjct  61   IKIFDVNPDILRAFANTGISVTVTVPNGEIHKLLDIGYAKSYVEANIKPFYPQTKIDVIA  120

Query  373  VGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            +GNE+LHW TPE+QN LV AMR+ Y AL++SGI
Sbjct  121  IGNEILHWETPEVQNKLVPAMRTFYQALIQSGI  153



>ref|XP_006345964.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=504

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 125/155 (81%), Gaps = 6/155 (4%)
 Frame = +1

Query  22   MEMSLRP--SPIFLFFLVSAFLFIHG---VRSIGVNYGTLGDNLPPPTEVARFLKEKTVI  186
            ME+S +   SP+F F  +S+ +FI     V S+GVNYGTLG+NLPPP++VA+FLK+KT+I
Sbjct  1    MEVSYKKITSPLFTFLFISS-IFIQCLPYVSSLGVNYGTLGNNLPPPSQVAQFLKDKTII  59

Query  187  DRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINI  366
            D+IKIFDVNPDIL+AFA T I VTVTVPNGEI  L D GYA  +V ANIKPFYP TKI++
Sbjct  60   DKIKIFDVNPDILKAFANTNISVTVTVPNGEIPKLLDIGYAKSYVEANIKPFYPQTKIDV  119

Query  367  IAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            IAVGNE+LHW TPE+QN LV AMR+LY AL +SGI
Sbjct  120  IAVGNEILHWETPEVQNKLVGAMRTLYQALTQSGI  154



>ref|XP_011091523.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=457

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  82   FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  261
            F+  V+SIGVNYGTLGDNLPPP +VA+FLKEKT IDRIKIFDVNPDILRAFA TGILV V
Sbjct  21   FLAAVQSIGVNYGTLGDNLPPPAQVAQFLKEKTTIDRIKIFDVNPDILRAFANTGILVAV  80

Query  262  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRS  441
            T+PNGEI  L DAGYA +W+AANI+PFYPATKIN I VGNE+LHWG   +++ LVAAMRS
Sbjct  81   TIPNGEIPGLTDAGYARRWLAANIQPFYPATKINYILVGNEILHWGPQNLRDNLVAAMRS  140

Query  442  LYNALVKSGI  471
            ++ AL+ SGI
Sbjct  141  VHQALLLSGI  150



>ref|XP_004239793.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Solanum lycopersicum]
Length=526

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 122/154 (79%), Gaps = 4/154 (3%)
 Frame = +1

Query  22   MEMSLRP--SPIFLFFLVSAFL--FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVID  189
            ME+S +   SP+F F  +S+    F   V  IGVNYGTLG+NLPPP++VA+FLK+KT+ID
Sbjct  1    MEVSNKKITSPLFTFLFISSIFIQFFPYVSCIGVNYGTLGNNLPPPSQVAQFLKDKTIID  60

Query  190  RIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINII  369
            +IKIFDVNPDIL+AFA T I VTVTVPN EI  L+D GYA  +V ANIKPFYP TKI++I
Sbjct  61   KIKIFDVNPDILKAFANTNISVTVTVPNSEIPKLQDIGYAKSYVEANIKPFYPQTKIDVI  120

Query  370  AVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            AVGNE+LHW TPE+QN LV AMR+LY AL +SGI
Sbjct  121  AVGNEILHWETPEVQNKLVGAMRTLYQALTQSGI  154



>ref|NP_001234416.1| beta-glucosidase 08 precursor [Solanum lycopersicum]
 gb|ACH56716.1| beta-glucosidase 08 [Solanum lycopersicum]
Length=459

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  52   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
            F+ FL++  LF+H V SIGVNYGTLG+NLPPP +VA+F+K+KTVIDR+KIFD+NPDILRA
Sbjct  7    FVLFLIAIALFLHDVTSIGVNYGTLGNNLPPPAQVAQFIKDKTVIDRVKIFDINPDILRA  66

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA TGI +TVTVPNGEI  L D  YA ++V  NIKP YP TK+++I VGNEVLHW TPE+
Sbjct  67   FANTGISLTVTVPNGEIPNLLDLAYARRYVEQNIKPHYPQTKMDVILVGNEVLHWDTPEV  126

Query  412  QNGLVAAMRSLYNALVKSGI  471
            QN LV AM+  Y AL  SG+
Sbjct  127  QNKLVPAMKVFYQALGLSGL  146



>gb|AHL24654.1| Fra e 9.01 allergen [Fraxinus excelsior]
Length=462

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = +1

Query  22   MEMSLRPSPIFLFFLVSAFLFIH--GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  195
            ME S R S  F+   V   L  H   V SIGVNYGTLG+NLPPP +VA+FLKEKT IDR+
Sbjct  1    MEFSKRHSLFFVLLFVYTILVQHFAAVNSIGVNYGTLGNNLPPPAQVAQFLKEKTTIDRV  60

Query  196  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  375
            K+FDVNPDILRAFAGTGI V VTVPNGEI  L +   A +WV  NIKPFYP TKIN I V
Sbjct  61   KLFDVNPDILRAFAGTGIFVAVTVPNGEIPNLVNMKNARRWVGDNIKPFYPQTKINYILV  120

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            GNEVLHWG   + + LV AMR+L+NAL++SGI
Sbjct  121  GNEVLHWGPQNVIDNLVGAMRALHNALIRSGI  152



>ref|NP_001275174.1| glucan endo-1,3-beta-glucosidase-like precursor [Solanum tuberosum]
 gb|AFU52649.1| beta-1,3-glucanase 14 [Solanum tuberosum]
Length=462

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 2/148 (1%)
 Frame = +1

Query  28   MSLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  207
            +S + S I  FF+++  LF+H V SIGVNYGTLG+NLPPP +VA+F+K+KTVIDR+KIFD
Sbjct  4    ISSKTSFILFFFVIA--LFLHDVTSIGVNYGTLGNNLPPPAQVAQFIKDKTVIDRVKIFD  61

Query  208  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  387
            +NPDILRAFA TGI +TVTVPNGEI  L D  YA ++V  NIKP YP TKI+++ VGNEV
Sbjct  62   INPDILRAFANTGISLTVTVPNGEIPNLLDLAYARRYVEQNIKPHYPQTKIDVVLVGNEV  121

Query  388  LHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            LHW TPE+QN LV AM+  Y AL  SG+
Sbjct  122  LHWDTPEVQNKLVPAMKVFYQALGLSGL  149



>gb|AHL24655.1| Fra e 9.02 allergen [Fraxinus excelsior]
Length=468

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = +1

Query  22   MEMSLRPSPIFLFFLVSAFLFIH--GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  195
            ME S R S  F+   V   L  H   V SIGVNYGTLG+NLPPP +VA+FLKEKT IDR+
Sbjct  1    MEFSKRHSLFFVLLFVYTILVQHFAAVNSIGVNYGTLGNNLPPPAQVAQFLKEKTTIDRV  60

Query  196  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  375
            K+FDVNPDILR FAGTGI V VTVPNGEI  L +   A +WV  NIKPFYP TKIN I V
Sbjct  61   KLFDVNPDILRTFAGTGIFVAVTVPNGEIPNLVNMKNARRWVGDNIKPFYPQTKINYILV  120

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            GNEVLHWG   + + LV AMR+L+NAL++SGI
Sbjct  121  GNEVLHWGAQNVIDNLVGAMRALHNALIRSGI  152



>ref|XP_009593199.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana tomentosiformis]
Length=464

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +1

Query  37   RPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  216
            RPS + +     A LF   V SIGVNYGTLG+NLPPP +VA+FLK+KTVIDRIKIFD+NP
Sbjct  5    RPSMLLVLIFFVAPLFFPAVNSIGVNYGTLGNNLPPPAQVAQFLKDKTVIDRIKIFDINP  64

Query  217  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
            DILRAFA TGI VTVTVPNGEI  L D  YA +++ ANIKPFYP TKI++I VGNEVLHW
Sbjct  65   DILRAFANTGISVTVTVPNGEIPNLLDISYARRYIDANIKPFYPQTKIDVILVGNEVLHW  124

Query  397  GTPEMQNGLVAAMRSLYNALVKSGI  471
              P++Q  LV AM++ Y AL +SG+
Sbjct  125  DGPDIQMKLVPAMKTFYQALGQSGL  149



>ref|XP_009789910.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=463

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 113/145 (78%), Gaps = 1/145 (1%)
 Frame = +1

Query  37   RPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  216
            RPS + L  L    LF   V SIGVNYGTLG+NLPPP +VA+FLK+KTVIDRIKIFD+NP
Sbjct  5    RPS-LLLLILFVVPLFFPAVNSIGVNYGTLGNNLPPPAQVAQFLKDKTVIDRIKIFDINP  63

Query  217  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
            DILRAFA TGI VTVTVPNGEI  L D  YA +++ ANIKPFYP TKI++I VGNEVLHW
Sbjct  64   DILRAFANTGISVTVTVPNGEIPNLLDISYARRYIDANIKPFYPQTKIDVILVGNEVLHW  123

Query  397  GTPEMQNGLVAAMRSLYNALVKSGI  471
              P++Q  LV AM++ Y AL +SG+
Sbjct  124  DGPDIQMKLVPAMKTFYQALGQSGL  148



>gb|EYU33213.1| hypothetical protein MIMGU_mgv1a006294mg [Erythranthe guttata]
Length=449

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            V SIGVNYGT+GDNLPPP +VA+FLK+KT IDRIKIFD NPDILRAF+GTGILV VTVPN
Sbjct  20   VESIGVNYGTMGDNLPPPAQVAQFLKDKTTIDRIKIFDANPDILRAFSGTGILVAVTVPN  79

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            GEI  L D G A +WVAANI+PF+P TKIN I VGNE+LHWG   + + LV+AMRSL+ A
Sbjct  80   GEIPSLTDPGNARRWVAANIQPFHPQTKINYILVGNEILHWGPQNLVDNLVSAMRSLHTA  139

Query  454  LVKSGI  471
            L  SGI
Sbjct  140  LSLSGI  145



>gb|EPS63364.1| glycoside hydrolase, partial [Genlisea aurea]
Length=435

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = +1

Query  79   LFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  258
            L    V SIGVNYGTL DNLPPP EVA FL+++T IDR+KIFD+NPDILRAFAGTGI V 
Sbjct  7    LLFPAVDSIGVNYGTLADNLPPPLEVAHFLRDRTTIDRVKIFDINPDILRAFAGTGISVA  66

Query  259  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMR  438
            VTVPNG+I  L DAG A +WVAANI+PFYP TKI+ I VGNE+LHWG   +++ LVAAMR
Sbjct  67   VTVPNGDIPSLTDAGNAQRWVAANIQPFYPQTKIDSILVGNEILHWGPQNLRDSLVAAMR  126

Query  439  SLYNALVKSGI  471
            +L  ALV +G+
Sbjct  127  TLQRALVAAGV  137



>emb|CDP00093.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   186 bits (473),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 2/139 (1%)
 Frame = +1

Query  61   FLVSAFLFIH--GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  234
            FLV A    H   V+SIGVNYGT+ DNLPPP +V +F+K+KT IDR+KIFDVNPDI+RAF
Sbjct  13   FLVFALFIQHFSAVQSIGVNYGTVADNLPPPAQVVQFIKDKTFIDRVKIFDVNPDIIRAF  72

Query  235  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
            A TGIL+TVTVPNGEI  L +  YA +WV  +IKPFYP TKIN IAVGNEVLHWG   + 
Sbjct  73   ANTGILLTVTVPNGEIPNLTNIRYARRWVNEHIKPFYPQTKINYIAVGNEVLHWGPQNLI  132

Query  415  NGLVAAMRSLYNALVKSGI  471
            + LVAAMR+L+ ALVK+GI
Sbjct  133  DNLVAAMRTLHQALVKNGI  151



>gb|EPS69142.1| hypothetical protein M569_05624, partial [Genlisea aurea]
Length=349

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +1

Query  85   IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVT  264
            I  V SIGVNYGT+ +NLPPP +VA+F+K+KT IDR+KIFDVNPDILRAFA TGILV+VT
Sbjct  18   ISAVHSIGVNYGTIANNLPPPAQVAQFIKQKTFIDRVKIFDVNPDILRAFANTGILVSVT  77

Query  265  VPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSL  444
            VPNGEI  L +  YA +WV+ NIKPF+P T+IN I VGNE+LHWG     + LV AM++L
Sbjct  78   VPNGEIPNLTNIRYARRWVSVNIKPFHPQTRINYILVGNEILHWGPQAAVDNLVLAMKTL  137

Query  445  YNALVKSGI  471
            + AL + GI
Sbjct  138  HRALNREGI  146



>ref|XP_011101632.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=456

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  85   IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVT  264
            I  V+SIGVNYGTLG+NLPPP +VA+FLKEKT++D +KIFDVNPDILRAFA TGI VT+T
Sbjct  21   ITTVQSIGVNYGTLGNNLPPPAQVAQFLKEKTIVDGVKIFDVNPDILRAFANTGIHVTIT  80

Query  265  VPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSL  444
            VPN +I  L     A +WVAANIKPFYP TKI+ + VGNE+LHWG   +++ LVAAMR+L
Sbjct  81   VPNDQIPNLTVVRNARRWVAANIKPFYPQTKIHYVLVGNEILHWGPQNLRDNLVAAMRTL  140

Query  445  YNALVKSGI  471
            Y AL   GI
Sbjct  141  YKALRMEGI  149



>ref|XP_010091462.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXC36948.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=186

 Score =   167 bits (424),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  282
            IG NYGTLG+NLPPP +V  FLK +T +DRIKIFD NPDILRAFA +GI VTVTV NGEI
Sbjct  55   IGFNYGTLGNNLPPPLQVVNFLKTQTTVDRIKIFDANPDILRAFADSGIAVTVTVGNGEI  114

Query  283  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  462
            + L D   A +WV+ NIKPFYP T+IN IAVGNEV+HWG   M   LV AM+SLY+AL+ 
Sbjct  115  VGLTDPKAARRWVSTNIKPFYPRTRINYIAVGNEVIHWGDKVMVANLVPAMKSLYHALLL  174

Query  463  SGI  471
             GI
Sbjct  175  EGI  177



>ref|XP_003552703.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Glycine max]
Length=454

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
               IG+NYGTLGDNLPPP  VA FLK KT IDR+KI+DVNPDILRAFAG+GI VTVT PN
Sbjct  22   AHGIGINYGTLGDNLPPPAAVANFLKTKTTIDRVKIYDVNPDILRAFAGSGISVTVTAPN  81

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L     A QWVA +IKPF+P TKIN I VG+EVLHWG   M  GLV AMR+L++A
Sbjct  82   GDIAALTKIDSARQWVATHIKPFHPQTKINYILVGSEVLHWGDTNMIRGLVPAMRTLHSA  141

Query  454  LVKSGI  471
            L+  GI
Sbjct  142  LLAEGI  147



>ref|XP_003622030.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES78248.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=448

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            V SIGVNYGTL DNLPPP  VA FLK  T++DR+KIFDV+P IL+AFA TGI VTVT PN
Sbjct  20   VNSIGVNYGTLADNLPPPATVANFLKTNTIVDRVKIFDVSPQILQAFANTGISVTVTAPN  79

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A QWV   IKPFYPATKIN I VG+EVLHWG   M  GLV AMR+L++A
Sbjct  80   GDIAALGNINSARQWVQQKIKPFYPATKINYILVGSEVLHWGDGNMIRGLVPAMRTLHSA  139

Query  454  LVKSGI  471
            LV  GI
Sbjct  140  LVAEGI  145



>ref|XP_004516968.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=450

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            V SIGVNYGTLGDNLPPPT VA FLK  T+IDR+KI+DV+P IL+AFA TGI VTVT PN
Sbjct  21   VNSIGVNYGTLGDNLPPPTTVANFLKTNTIIDRVKIYDVSPQILQAFANTGIAVTVTAPN  80

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A QWV  NIKPF+P TKIN I VG+EVLHWG   M + LV AMR+L++A
Sbjct  81   GDIATLTNIDSARQWVVRNIKPFHPMTKINYILVGSEVLHWGDNNMIHSLVPAMRTLHSA  140

Query  454  LVKSGI  471
            L+  GI
Sbjct  141  LLAEGI  146



>ref|XP_007220314.1| hypothetical protein PRUPE_ppa005160m1g, partial [Prunus persica]
 gb|EMJ21513.1| hypothetical protein PRUPE_ppa005160m1g, partial [Prunus persica]
Length=330

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            +IGVNYGTL DNLPPP +VA FLK +T ID++KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   AIGVNYGTLADNLPPPAQVANFLKTQTNIDKVKIFDANPDIIKAFANTNISLTITIPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A +WV  ++KPFYP TKIN IA+GNEVLHWG   ++N LV AMR+ +NALV
Sbjct  82   IPSLTKLRTARRWVVDHVKPFYPQTKINYIAMGNEVLHWGDDNLKNSLVPAMRTFHNALV  141

Query  460  KSGI  471
            + GI
Sbjct  142  REGI  145



>ref|XP_008233624.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=478

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            +IGVNYGTL DNLPPP +VA FLK +T ID++KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   AIGVNYGTLADNLPPPAQVANFLKTQTNIDKVKIFDANPDIIKAFANTNISLTITIPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A +WV  ++KPFYP TKIN IA+GNEVLHWG   ++N LV AMR+ +NALV
Sbjct  82   IPSLTKLRAARRWVVDHVKPFYPQTKINYIAMGNEVLHWGDDNLKNSLVPAMRTFHNALV  141

Query  460  KSGI  471
            + GI
Sbjct  142  REGI  145



>ref|XP_004307514.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=477

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 103/139 (74%), Gaps = 5/139 (4%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  234
            LFF ++   +     SIGVNYGTL DNLPPP +VA F+K +T+ID +KIFDVNPDI+RAF
Sbjct  12   LFFQLATTAY-----SIGVNYGTLADNLPPPAQVANFIKTQTIIDAVKIFDVNPDIIRAF  66

Query  235  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
            A TGI +T+T+PNGEI  L     A ++VA +I+PFYPATK   I +GNE+LHWG    +
Sbjct  67   ANTGISLTITIPNGEIPGLTTLDGAKRYVAQHIQPFYPATKFKYILMGNEILHWGDAAQK  126

Query  415  NGLVAAMRSLYNALVKSGI  471
            NGLV AM+ LY AL+++GI
Sbjct  127  NGLVPAMKMLYAALIQAGI  145



>gb|EYU19897.1| hypothetical protein MIMGU_mgv1a006105mg [Erythranthe guttata]
Length=457

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  282
            IGVNYG LGDNLPPP +VA+FLK+KT IDR+KIF VN DIL+AFAGTGILV+VT+PNGEI
Sbjct  25   IGVNYGILGDNLPPPAQVAQFLKDKTTIDRVKIFGVNADILQAFAGTGILVSVTIPNGEI  84

Query  283  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
              L +  YA +++AANIKPF+P TK   I VGNE+LHWG  ++++ LVAAM S+  AL
Sbjct  85   PNLANIHYARRYIAANIKPFHPQTKFQYILVGNEILHWGPQDLRDNLVAAMHSVNKAL  142



>ref|XP_011470609.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=702

 Score =   164 bits (416),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 77/123 (63%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTLGDNLPPP++VA FLK +T+ID +KIFD+NPDI+RAFA +GI +T+T+PNG+
Sbjct  20   SIGVNYGTLGDNLPPPSQVANFLKTQTIIDSLKIFDMNPDIIRAFANSGISLTITLPNGD  79

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +   A +W+  NIKPFYPAT I  I VG EVLHWG    ++ LVAAMR+L NAL 
Sbjct  80   IPTLTNPRAARRWIQQNIKPFYPATLIRYICVGTEVLHWGDDAQKSNLVAAMRTLNNALR  139

Query  460  KSG  468
              G
Sbjct  140  VEG  142



>ref|XP_008342287.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=343

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A +WV  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM++L+NALV
Sbjct  82   IPKLIKLRIARRWVVDHVKPFYPASKIKYIAMGNEVLHWGDDALKSNLVPAMKTLHNALV  141

Query  460  KSGI  471
            + GI
Sbjct  142  REGI  145



>ref|XP_007139210.1| hypothetical protein PHAVU_008G010600g [Phaseolus vulgaris]
 gb|ESW11204.1| hypothetical protein PHAVU_008G010600g [Phaseolus vulgaris]
Length=443

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
              SIG+NYGTLGDNLPPP  VA FLK +T IDR+KI+DVNP IL+AFA +GI +TVT PN
Sbjct  22   AHSIGINYGTLGDNLPPPATVANFLKTRTTIDRVKIYDVNPQILQAFANSGISMTVTAPN  81

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  LK    A QWV ++IKPF+P TKI  I VG+EVLHWG  +M  GL  A+R+L+ A
Sbjct  82   GDIAVLKQIDTARQWVVSHIKPFHPQTKIEYILVGSEVLHWGDADMIRGLTPAIRTLHAA  141

Query  454  LVKSGI  471
            L+  GI
Sbjct  142  LLAEGI  147



>dbj|BAB40807.1| endo-1,3-beta-glucanase-like protein [Pyrus pyrifolia]
Length=397

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A +WV  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM++L+NALV
Sbjct  82   IPKLIKLRTAPRWVVDHVKPFYPASKIKYIAMGNEVLHWGDDALKSNLVPAMKTLHNALV  141

Query  460  KSGI  471
            + GI
Sbjct  142  REGI  145



>emb|CAB85903.1| beta-1,3 glucanase [Pisum sativum]
Length=453

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = +1

Query  76   FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  255
            F  +  V SIGVNYGTLGDNLPPP  VA FLK  T+ID +KIFDV+P IL+AFA TGI V
Sbjct  18   FHLVATVTSIGVNYGTLGDNLPPPATVANFLKTNTIIDSVKIFDVSPQILQAFANTGISV  77

Query  256  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  435
            TVT PNG+I  L     A QWV  +IKPF+P TKIN I VG+EV HWG   M   LV AM
Sbjct  78   TVTAPNGDIEALAKIDSARQWVVTHIKPFHPQTKINYILVGSEVFHWGDSVMIRNLVPAM  137

Query  436  RSLYNALVKSGI  471
            R+L++AL+  GI
Sbjct  138  RTLHSALLAEGI  149



>ref|XP_008382814.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Malus 
domestica]
Length=396

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A +WV  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM++L+NALV
Sbjct  82   IPKLIKLRIARRWVVDHVKPFYPASKIKYIAMGNEVLHWGDDALKSNLVPAMKTLHNALV  141

Query  460  KSGI  471
            + GI
Sbjct  142  REGI  145



>ref|XP_009357725.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=397

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A +WV  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM++L+NALV
Sbjct  82   IPKLIKLRTARRWVVDHVKPFYPASKIKYIAMGNEVLHWGDDALKSNLVPAMKTLHNALV  141

Query  460  KSGI  471
            + GI
Sbjct  142  REGI  145



>ref|XP_008343598.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=343

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+TVPNGE
Sbjct  22   SIGVNYGTLADNLPPPAKVADFIKTQTKIDAVKLFDANPDIIKAFANTNISLTITVPNGE  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  LK+   A +W+  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM + ++AL 
Sbjct  82   IPSLKNLQTARRWITDHVKPFYPASKIKYIALGNEVLHWGDDALKSSLVPAMETFHSALA  141

Query  460  KSGI  471
            + GI
Sbjct  142  QEGI  145



>ref|XP_004147695.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 gb|KGN50541.1| hypothetical protein Csa_5G181480 [Cucumis sativus]
Length=441

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  91   GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  270
             V +IGVNYGTLG+NL PP EVA FLK KT IDR+KIFD NPDILRAFAG+GILVTVTV 
Sbjct  23   AVFAIGVNYGTLGNNLRPPAEVANFLKTKTKIDRVKIFDTNPDILRAFAGSGILVTVTVG  82

Query  271  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  450
            NG I  L D  +A +WVAA+I PF+P T+I+ IAVGNE++H     +   LV AMRSL+ 
Sbjct  83   NGLIPNLADLAFAREWVAAHIAPFHPQTRIHYIAVGNEIIHSNDKPLIARLVPAMRSLHR  142

Query  451  ALVKSGI  471
            ALV +GI
Sbjct  143  ALVLAGI  149



>ref|XP_008382813.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Malus 
domestica]
Length=486

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A +WV  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM++L+NALV
Sbjct  82   IPKLIKLRIARRWVVDHVKPFYPASKIKYIAMGNEVLHWGDDALKSNLVPAMKTLHNALV  141

Query  460  KSGI  471
            + GI
Sbjct  142  REGI  145



>ref|XP_004167482.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
Length=447

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  91   GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  270
             V +IGVNYGTLG+NL PP EVA FLK KT IDR+KIFD NPDILRAFAG+GILVTVTV 
Sbjct  23   AVFAIGVNYGTLGNNLRPPAEVANFLKTKTKIDRVKIFDTNPDILRAFAGSGILVTVTVG  82

Query  271  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  450
            NG I  L D  +A +WVAA+I PF+P T+I+ IAVGNE++H     +   LV AMRSL+ 
Sbjct  83   NGLIPNLADLAFAREWVAAHIAPFHPQTRIHYIAVGNEIIHSNDKPLIARLVPAMRSLHR  142

Query  451  ALVKSGI  471
            ALV +GI
Sbjct  143  ALVLAGI  149



>emb|CBI31680.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = +1

Query  52   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
            F+ F VSA LF     SIGVNYGTL DNLPPP +VA FLK +T ID+IKIFD NPDILRA
Sbjct  11   FVIFGVSALLFSATAYSIGVNYGTLADNLPPPAQVANFLKTRTTIDQIKIFDSNPDILRA  70

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA TGI VT+TV NG+I  +     A  WVA +I PFYP+TKIN +AVGNE++      +
Sbjct  71   FASTGIGVTITVGNGDIPAITKLPAARDWVATHILPFYPSTKINYVAVGNEIMATADKNL  130

Query  412  QNGLVAAMRSLYNALVKSGI  471
               LV AM++L+NALV + I
Sbjct  131  IGHLVPAMKALHNALVLAKI  150



>ref|XP_008461659.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=449

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 101/141 (72%), Gaps = 5/141 (4%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            IFL   +S  +F     +IGVNYGTLG+NL PP EV  FLK KT IDR+KIFD NPDILR
Sbjct  13   IFLLLQISTTVF-----AIGVNYGTLGNNLRPPAEVVNFLKTKTKIDRVKIFDTNPDILR  67

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AFAG+GILVTVTV NGEI  L +  +A  WVA +I PF+P T+I+ IAVGNE++H     
Sbjct  68   AFAGSGILVTVTVGNGEIPALGNLAFARAWVAEHIAPFHPQTRIHYIAVGNEIIHSNDKP  127

Query  409  MQNGLVAAMRSLYNALVKSGI  471
            +   LV AMRSL+ ALV +GI
Sbjct  128  LIARLVPAMRSLHRALVLAGI  148



>ref|XP_011029669.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=448

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = +1

Query  52   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
             L F  +AF       +IGVNYGTL +NLP P+EVA FLK +T ID IKIFD NPDILRA
Sbjct  19   LLHFSTTAF-------AIGVNYGTLANNLPSPSEVASFLKTQTTIDSIKIFDTNPDILRA  71

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA + I VTVTV NG+I  L D   A+QWVA NIKP+YP T+I +IAVGNE+L  G  E 
Sbjct  72   FANSNITVTVTVGNGDIPALVDVNTASQWVANNIKPYYPQTRIKLIAVGNEILFTGNKEW  131

Query  412  QNGLVAAMRSLYNALVKSGI  471
             + LV  M+SL+ ALV +GI
Sbjct  132  ISRLVPCMKSLHQALVHAGI  151



>ref|XP_009357726.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Pyrus x bretschneideri]
Length=492

 Score =   157 bits (396),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 72/124 (58%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+TVPNGE
Sbjct  22   SIGVNYGTLADNLPPPAKVADFIKTQTNIDAVKLFDANPDIIKAFANTNISLTITVPNGE  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  LK+   A +W+  ++KPFYPA+KI  IA+GNEVLHWG   +++ LV AM + ++AL 
Sbjct  82   IPSLKNLQTARRWITDHVKPFYPASKIKYIALGNEVLHWGDDALKSSLVPAMETFHSALA  141

Query  460  KSGI  471
            + GI
Sbjct  142  QEGI  145



>ref|XP_002283647.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
Length=447

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = +1

Query  52   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
            F+ F VSA LF     SIGVNYGTL DNLPPP +VA FLK +T ID+IKIFD NPDILRA
Sbjct  11   FVIFGVSALLFSATAYSIGVNYGTLADNLPPPAQVANFLKTRTTIDQIKIFDSNPDILRA  70

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA TGI VT+TV NG+I  +     A  WVA +I PFYP+TKIN +AVGNE++      +
Sbjct  71   FASTGIGVTITVGNGDIPAITKLPAARDWVATHILPFYPSTKINYVAVGNEIMATADKNL  130

Query  412  QNGLVAAMRSLYNALVKSGI  471
               LV AM++L+NALV + I
Sbjct  131  IGHLVPAMKALHNALVLAKI  150



>ref|XP_010534498.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Tarenaya hassleriana]
Length=449

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 104/143 (73%), Gaps = 4/143 (3%)
 Frame = +1

Query  52   FLFFLVSAFLFIH---GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  222
             L  + +A LF+H   G+ ++GVNYGTLG NLP P +VA F++ +T ID +KIFDVNPDI
Sbjct  11   LLLVISAAVLFLHLPDGISAVGVNYGTLG-NLPSPADVANFIRTRTTIDSVKIFDVNPDI  69

Query  223  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGT  402
            LRAFAG+GI V VTVPNGEI  L +   A +W AANIKPF+P T+I  I+VGNE+L  G 
Sbjct  70   LRAFAGSGISVVVTVPNGEIPALVNTRQARRWGAANIKPFHPQTRIKYISVGNEILLTGD  129

Query  403  PEMQNGLVAAMRSLYNALVKSGI  471
              M + LV AM SL+ AL++SGI
Sbjct  130  SNMISNLVPAMNSLHRALIRSGI  152



>gb|ACM45718.1| endo-1,3-beta-glucanase [Pyrus pyrifolia]
Length=454

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLADNLPPPAQVANFIKTQTTIDAVKLFDANPDIIKAFANTNISLTITIPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +   A  W+  ++KPFYPATKI  IA+G+EVLHWG   +++ LV AMR+ +NAL+
Sbjct  82   IQSLINLRTARHWIIDHVKPFYPATKIKYIAMGSEVLHWGDDALKSSLVPAMRTFHNALI  141

Query  460  KSGI  471
              GI
Sbjct  142  GEGI  145



>gb|ABK95730.1| unknown [Populus trichocarpa]
Length=448

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = +1

Query  52   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
             L F  +AF       +IGVNYGTL +NLP P++VA FLK +T ID IKIFD NPDILRA
Sbjct  19   LLHFSTTAF-------AIGVNYGTLANNLPSPSQVASFLKTQTTIDSIKIFDTNPDILRA  71

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA + I VTVTV NG+I  L D   A+QWVA NIKP+YP T+I +IAVGNE+L  G  E 
Sbjct  72   FANSNITVTVTVGNGDIPALVDVNAASQWVANNIKPYYPQTRIKLIAVGNEILFTGNKEW  131

Query  412  QNGLVAAMRSLYNALVKSGI  471
             + LV  M+SL+ ALV +GI
Sbjct  132  ISRLVPCMKSLHQALVHAGI  151



>ref|XP_002312097.1| hypothetical protein POPTR_0008s05600g [Populus trichocarpa]
 gb|EEE89464.1| hypothetical protein POPTR_0008s05600g [Populus trichocarpa]
Length=448

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 98/140 (70%), Gaps = 7/140 (5%)
 Frame = +1

Query  52   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
             L F  +AF       +IGVNYGTL +NLP P++VA FLK +T ID IKIFD NPDILRA
Sbjct  19   LLHFSTTAF-------AIGVNYGTLANNLPSPSQVASFLKTQTTIDSIKIFDTNPDILRA  71

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA + I VTVTV NG+I  L D   A+QWVA NIKP+YP T+I +IAVGNE+L  G  E 
Sbjct  72   FANSNITVTVTVGNGDIPALVDVNAASQWVANNIKPYYPQTRIKLIAVGNEILFTGNKEW  131

Query  412  QNGLVAAMRSLYNALVKSGI  471
             + LV  M+SL+ ALV +GI
Sbjct  132  ISRLVPCMKSLHQALVHAGI  151



>ref|XP_002878033.1| hypothetical protein ARALYDRAFT_485970 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54292.1| hypothetical protein ARALYDRAFT_485970 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  84

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M N L+ AMR+L NA
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMINNLLPAMRNLNNA  144

Query  454  LVKSGI  471
            LV++G+
Sbjct  145  LVRAGV  150



>ref|XP_008371690.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=454

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLADNLPPPAQVADFIKTQTNIDAVKLFDANPDIIKAFANTNISLTITIPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +   A  W+  ++KPFYPATKI  IA+G+EVLHWG   ++  LV AMR+ +NAL+
Sbjct  82   IQSLINLRTARHWIIDHVKPFYPATKIKYIAMGSEVLHWGDDALKASLVPAMRTFHNALI  141

Query  460  KSGI  471
            + GI
Sbjct  142  REGI  145



>gb|KJB73920.1| hypothetical protein B456_011G261000 [Gossypium raimondii]
Length=366

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 99/146 (68%), Gaps = 0/146 (0%)
 Frame = +1

Query  31   SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  210
            SL    +FLF   + F       +IGVNYG + DNLP PTEVA F+K KT+ D +KIFD 
Sbjct  3    SLTSLQLFLFLSTTVFNLFSSTAAIGVNYGMVADNLPSPTEVANFIKTKTIFDSVKIFDT  62

Query  211  NPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVL  390
            NP++LRAF  TGI +TVT+PNGEI  L + G A+ WV ANI+PF+P T+I  I++GNEV+
Sbjct  63   NPNVLRAFTNTGITMTVTIPNGEIPNLANEGAASAWVNANIQPFHPQTRIKYISIGNEVV  122

Query  391  HWGTPEMQNGLVAAMRSLYNALVKSG  468
                P   +GLV AM++L  AL K+G
Sbjct  123  LLDNPVHIHGLVPAMKALTEALRKAG  148



>ref|XP_008362701.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase-like 
[Malus domestica]
Length=473

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL DNLPPP +VA FLK +T ID +KIFD NPDI++AFA + I +T+TVPNGE
Sbjct  22   SIGVNYGTLADNLPPPAQVANFLKTQTNIDAVKIFDANPDIIKAFANSNISLTITVPNGE  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A +W+  ++KPFYPA+KI  I +GNEVLHWG   +++ LV AM++L NALV
Sbjct  82   IPSLTKLRTARRWIIDHVKPFYPASKIKYIGMGNEVLHWGDDALKSSLVPAMKTLNNALV  141

Query  460  KSGI  471
              GI
Sbjct  142  LEGI  145



>ref|XP_009357727.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=454

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLADNLPPPAQVANFIKTETTIDAVKLFDANPDIIKAFANTNISLTITIPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +   A  W+  ++KPFYPA+KI  IA+G+EVLHWG   +++ L  AMR+ +NAL+
Sbjct  82   IQSLINLRTARHWIIDHVKPFYPASKIKYIAMGSEVLHWGDDAIRSSLAPAMRTFHNALI  141

Query  460  KSGI  471
            + GI
Sbjct  142  REGI  145



>gb|AAM66982.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=449

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = +1

Query  64   LVSAFLFIHGV-RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  240
              + FL I  V  +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  15   CAAVFLTIPAVISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDNVKIFDVNPDILRAFAG  73

Query  241  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  420
            TGI V VTVPNG+I  L +   A +WV+ NI PF+P TKI  I+VGNE+L  G   M N 
Sbjct  74   TGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGNEILLTGDNNMINN  133

Query  421  LVAAMRSLYNALVKSGI  471
            L+ AMR+L NALV++G+
Sbjct  134  LLPAMRNLNNALVRAGV  150



>ref|NP_191103.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 emb|CAB75901.1| beta-1, 3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAN12934.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEE79383.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=449

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = +1

Query  64   LVSAFLFIHGV-RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  240
              + FL I  V  +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  15   CAAVFLTIPAVISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAG  73

Query  241  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  420
            TGI V VTVPNG+I  L +   A +WV+ NI PF+P TKI  I+VGNE+L  G   M N 
Sbjct  74   TGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGNEILLTGDNNMINN  133

Query  421  LVAAMRSLYNALVKSGI  471
            L+ AMR+L NALV++G+
Sbjct  134  LLPAMRNLNNALVRAGV  150



>gb|AAK76666.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=449

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 101/137 (74%), Gaps = 2/137 (1%)
 Frame = +1

Query  64   LVSAFLFIHGV-RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  240
              + FL I  V  +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  15   CAAVFLTIPAVISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAG  73

Query  241  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  420
            TGI V VTVPNG+I  L +   A +WV+ NI PF+P TKI  I+VGNE+L  G   M N 
Sbjct  74   TGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGNEILLTGDNNMINN  133

Query  421  LVAAMRSLYNALVKSGI  471
            L+ AMR+L NALV++G+
Sbjct  134  LLPAMRNLNNALVRAGV  150



>ref|XP_006403459.1| hypothetical protein EUTSA_v10010363mg [Eutrema salsugineum]
 gb|ESQ44912.1| hypothetical protein EUTSA_v10010363mg [Eutrema salsugineum]
Length=456

 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = +1

Query  70   SAFLFI---HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  240
            SA +FI     + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  16   SAVVFITFPAAISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAG  74

Query  241  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  420
            TGI V VTVPNG+I  L +   A +WV+ANI P++P TKI  I+VGNE+L  G   M + 
Sbjct  75   TGISVVVTVPNGDIPALANGRQARRWVSANILPYHPQTKIKYISVGNEILLTGDNNMISN  134

Query  421  LVAAMRSLYNALVKSGI  471
            L+ AMR+L NALV++G+
Sbjct  135  LLPAMRNLNNALVRAGV  151



>ref|XP_002530862.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF31536.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=447

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            ++GVNYGTL +NLPPP++VA FLK +T+ID IKIFD NPDILRAFA TGI VTVTV NG+
Sbjct  27   ALGVNYGTLANNLPPPSQVANFLKTQTIIDSIKIFDTNPDILRAFANTGITVTVTVGNGD  86

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +A  A +WV  NIKP+YP TKIN IAVGNE+L  G  +    LV  M++L++ALV
Sbjct  87   IPALSEAHAARRWVNNNIKPYYPQTKINRIAVGNEILMSGVQDWIAHLVPCMKALHHALV  146

Query  460  KSGI  471
             +GI
Sbjct  147  LAGI  150



>ref|XP_010922329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=447

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  282
            IGVNYGTL DNLPPPT+VA FLKE+T IDR+K+FD NPD++RAFAGTGI V +T PNG+I
Sbjct  26   IGVNYGTLADNLPPPTQVAAFLKERTFIDRVKLFDSNPDLIRAFAGTGISVMITAPNGDI  85

Query  283  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  462
              L     A  WVAA++ PFYPAT I++IAVGNE++  G   +   LV AMRSL  ALV+
Sbjct  86   PSLAKLPGAQAWVAAHVAPFYPATNISLIAVGNEIMATGDRFLIAHLVPAMRSLSAALVQ  145

Query  463  SGI  471
            +G 
Sbjct  146  AGF  148



>ref|XP_002890613.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66872.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score =   143 bits (361),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +1

Query  133  NLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAA  312
            NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPNG+I  L +   A 
Sbjct  1    NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPNGDIPALTNGRQAR  60

Query  313  QWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            +WV+ANI PF+P TKI  I+VGNE+L  G   M N L+ AMR+L NALV++GI
Sbjct  61   RWVSANILPFHPQTKIKYISVGNEILLTGDNNMINNLLPAMRNLNNALVRAGI  113



>ref|XP_010690550.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=465

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 4/140 (3%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            IF FF     L +    SIGVNYGT+ DNLPPP +VA FLK KT I++IK+FD NPDI+R
Sbjct  12   IFSFF----HLNLGSAWSIGVNYGTVADNLPPPAQVAEFLKTKTTINKIKLFDTNPDIVR  67

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AFA +GI V++T+PNGEI  L     A QWVA +I PF P + I  + VGNEVLHWG   
Sbjct  68   AFANSGIAVSITLPNGEIPNLVQLSAAKQWVATHITPFVPQSNIIRVLVGNEVLHWGPQN  127

Query  409  MQNGLVAAMRSLYNALVKSG  468
            + + LV AMR+LY AL ++G
Sbjct  128  LIDNLVPAMRTLYQALQQAG  147



>ref|XP_010690542.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=488

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 4/140 (3%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            IF FF     L +    SIGVNYGT+ DNLPPP +VA FLK KT I++IK+FD NPDI+R
Sbjct  12   IFSFF----HLNLGSAWSIGVNYGTVADNLPPPAQVAEFLKTKTTINKIKLFDTNPDIVR  67

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AFA +GI V++T+PNGEI  L     A QWVA +I PF P + I  + VGNEVLHWG   
Sbjct  68   AFANSGIAVSITLPNGEIPNLVQLSAAKQWVATHITPFVPQSNIIRVLVGNEVLHWGPQN  127

Query  409  MQNGLVAAMRSLYNALVKSG  468
            + + LV AMR+LY AL ++G
Sbjct  128  LIDNLVPAMRTLYQALQQAG  147



>ref|XP_010504397.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=453

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  29   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  87

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WV+ANI PF+P T I  I+VGNE+L  G   M N L+ AMR+L NA
Sbjct  88   GDIPALANGLQARRWVSANILPFHPQTMIKYISVGNEILLSGDNNMINNLLPAMRNLNNA  147

Query  454  LVKSGI  471
            LV++G+
Sbjct  148  LVRAGV  153



>ref|XP_010516112.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=453

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  29   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  87

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WV+ANI PF+P T I  I+VGNE+L  G   M N L+ AMR+L NA
Sbjct  88   GDIPALANGLQARRWVSANILPFHPQTMIKYISVGNEILLSGDNNMINNLLPAMRNLNNA  147

Query  454  LVKSGI  471
            LV++G+
Sbjct  148  LVRAGV  153



>ref|XP_002530863.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF31537.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=457

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = +1

Query  28   MSLRPSPIFLFFLVSAFLFIHG-VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIF  204
            M+ +     L  L+S F  +   + +IGVNYGTLG+NLPPP++VA+F+K +T+ID IKIF
Sbjct  1    MTTKTHHRHLLLLISTFFHLSTTIFAIGVNYGTLGNNLPPPSQVAKFIKTQTIIDSIKIF  60

Query  205  DVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNE  384
            D NPD+LRAFA TGI VTVTV NG+I  L +   A +WV ANI PFYP T+IN I VGNE
Sbjct  61   DTNPDVLRAFANTGISVTVTVGNGDIPALANINNARRWVVANIAPFYPRTRINRIVVGNE  120

Query  385  VLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            +L          LV AMR+++NAL+ + I
Sbjct  121  ILASANKAWITNLVPAMRNIHNALLSARI  149



>ref|XP_006291113.1| hypothetical protein CARUB_v10017225mg [Capsella rubella]
 gb|EOA24011.1| hypothetical protein CARUB_v10017225mg [Capsella rubella]
Length=454

 Score =   150 bits (378),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  30   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  88

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
             +I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M N L+ AMR+L NA
Sbjct  89   VDIPALANGVQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMINNLLPAMRNLNNA  148

Query  454  LVKSGI  471
            LV++G+
Sbjct  149  LVRAGV  154



>ref|XP_011027355.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Populus euphratica]
Length=457

 Score =   150 bits (378),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL ++LP P++VA FLK +T+ID IKIFD NPDILR FA T I VTVTV NG+
Sbjct  28   SIGVNYGTLANDLPSPSQVASFLKTQTIIDSIKIFDTNPDILRGFANTNITVTVTVGNGD  87

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L DA  A +WVA NI+ FYP T+I +IAVGNE+L  G  E  + LV  M+SL+ ALV
Sbjct  88   IPALVDANAAGRWVANNIEQFYPQTRIKLIAVGNEILFSGNKEWISHLVPCMKSLHQALV  147

Query  460  KSGI  471
            ++GI
Sbjct  148  RAGI  151



>emb|CDY62387.1| BnaCnng40170D [Brassica napus]
Length=449

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 104/145 (72%), Gaps = 4/145 (3%)
 Frame = +1

Query  46   PIFLFFLVSA---FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  216
            P   F L SA   F F   + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+V+P
Sbjct  6    PFISFLLFSAAVLFTFPAAISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVDP  64

Query  217  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
            +ILRAFAGTGI V VTVPNG+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  
Sbjct  65   NILRAFAGTGISVVVTVPNGDIPALANGMQARRWVSANILPFHPQTKIKYISVGNEILLT  124

Query  397  GTPEMQNGLVAAMRSLYNALVKSGI  471
            G     + L+ AMR++ +ALV++G+
Sbjct  125  GDNNTISKLLPAMRTINSALVRAGV  149



>ref|XP_010034118.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Eucalyptus grandis]
 gb|KCW50205.1| hypothetical protein EUGRSUZ_J00013 [Eucalyptus grandis]
Length=451

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  282
            IGVNYGTLGDNLPPP +VA F+K +T+I+R+KIFD NPDILRAFA TGI +TVT  NG+I
Sbjct  24   IGVNYGTLGDNLPPPAQVANFIKSQTIINRVKIFDTNPDILRAFADTGIAMTVTAGNGDI  83

Query  283  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  462
              L    YA QWVA NI PFYP T+I  + VGNE++H     +   L+ AMR+L+NALV 
Sbjct  84   PALTRLAYARQWVAINIAPFYPRTRIVRVLVGNEIIHSQDKRLVVNLLPAMRTLHNALVL  143

Query  463  SG  468
            +G
Sbjct  144  AG  145



>emb|CDY53692.1| BnaA07g37860D [Brassica napus]
Length=449

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 105/145 (72%), Gaps = 4/145 (3%)
 Frame = +1

Query  46   PIFLFFLVSA---FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  216
            P+  F L+SA     F   + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+V+P
Sbjct  6    PLISFLLISAAVLLTFPAAISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVDP  64

Query  217  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
            +ILRAFAGTGI V VTVPNG+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  
Sbjct  65   NILRAFAGTGISVVVTVPNGDIPALANGMQARRWVSANILPFHPQTKIKYISVGNEILLT  124

Query  397  GTPEMQNGLVAAMRSLYNALVKSGI  471
            G     + L+ AMR++ +ALV++G+
Sbjct  125  GDNNTISKLLPAMRTINSALVRAGV  149



>ref|XP_009343476.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Pyrus x bretschneideri]
Length=479

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL DNLPPP +VA FLK +T ID +KIFD NPDI++AFA + I +T+TVPN E
Sbjct  28   SIGVNYGTLADNLPPPAQVANFLKTQTNIDAVKIFDANPDIIKAFANSNISLTITVPNSE  87

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A  W+  ++KPFYPA+KI  I +GNEVLHWG   +++ LV AM++L NALV
Sbjct  88   IPSLTKLRTARLWIIDHVKPFYPASKIKYIGMGNEVLHWGDDALKSSLVPAMKTLNNALV  147

Query  460  KSGI  471
              GI
Sbjct  148  LEGI  151



>emb|CDY41232.1| BnaC08g26260D [Brassica napus]
Length=451

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = +1

Query  28   MSLRPSPIFLFFLVSA-FLFIHG-VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKI  201
            M+  P  I L  L +A FL +   + SIGVNYGTLG NLPPPT+VA FLK +T ID +KI
Sbjct  1    MAKAPPSISLLLLSAAVFLTLPATISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKI  59

Query  202  FDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGN  381
            F+VNPDI+RAFAGTGI V VTVPNG+I  L +   A +WVAANI+PF+P TKI  I+VGN
Sbjct  60   FNVNPDIIRAFAGTGISVVVTVPNGDIPALANGVQARRWVAANIQPFHPQTKIKYISVGN  119

Query  382  EVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            E+L  G   M   L+ AM++L  AL  +G+
Sbjct  120  EILLSGDDNMIKNLLPAMKNLNAALFHAGV  149



>gb|KCW85568.1| hypothetical protein EUGRSUZ_B02365, partial [Eucalyptus grandis]
Length=346

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 8/142 (6%)
 Frame = +1

Query  55   LFFLVSAFLFI--------HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  210
            LF L +A  F+            +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD 
Sbjct  4    LFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFDA  63

Query  211  NPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVL  390
            NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVGNE+L
Sbjct  64   NPDILRAFAGTGIAVTVTVGNGDIISLSKLPSAQAWVSANILPFHPKTLINRIAVGNEIL  123

Query  391  HWGTPEMQNGLVAAMRSLYNAL  456
                  +   L+ AM++L++AL
Sbjct  124  ATSDKTLIARLLPAMKALHSAL  145



>ref|XP_008802734.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Phoenix dactylifera]
Length=451

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL DNLPPP +VA FLKE T IDR+K+FD NPD++RAFAGTGI V +T PNG+
Sbjct  26   SIGVNYGTLADNLPPPAQVAAFLKESTFIDRVKLFDSNPDLIRAFAGTGISVMITAPNGD  85

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A  WVAAN+ P YPAT I++IAVGNE++  G   +   LV AMRSL  AL 
Sbjct  86   IPSLAKLPGARAWVAANVAPLYPATNISLIAVGNEIMATGDRSLIAHLVPAMRSLSAALG  145

Query  460  KSGI  471
            ++G 
Sbjct  146  QAGF  149



>emb|CDY41234.1| BnaC08g26240D [Brassica napus]
Length=455

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI V VTVPN
Sbjct  27   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISVVVTVPN  85

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WV+ANI+PF+P TKI  I+VGNE+L  G   M   L+ AM++L  A
Sbjct  86   GDIPALANGVQARRWVSANIQPFHPQTKIKYISVGNEILLSGDDNMIKNLLPAMKNLNAA  145

Query  454  LVKSGI  471
            LV++G+
Sbjct  146  LVRAGV  151



>ref|XP_010043554.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Eucalyptus 
grandis]
Length=354

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 8/142 (6%)
 Frame = +1

Query  55   LFFLVSAFLFI--------HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  210
            LF L +A  F+            +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD 
Sbjct  4    LFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFDA  63

Query  211  NPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVL  390
            NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVGNE+L
Sbjct  64   NPDILRAFAGTGIAVTVTVGNGDIISLSKLPSAQAWVSANILPFHPKTLINRIAVGNEIL  123

Query  391  HWGTPEMQNGLVAAMRSLYNAL  456
                  +   L+ AM++L++AL
Sbjct  124  ATSDKTLIARLLPAMKALHSAL  145



>ref|XP_002315222.2| hypothetical protein POPTR_0010s21130g [Populus trichocarpa]
 gb|EEF01393.2| hypothetical protein POPTR_0010s21130g [Populus trichocarpa]
Length=477

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL ++LP P++VA FLK +T+ID IKIFD NPDILR FA T I VTVTV NG+
Sbjct  28   SIGVNYGTLANDLPSPSQVANFLKTQTIIDSIKIFDTNPDILRGFANTNITVTVTVGNGD  87

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L DA  A++WVA NI+ FYP T+I +IAVGNE+L  G  E  + LV  ++SL+ ALV
Sbjct  88   IPALVDANAASRWVANNIEQFYPQTRIKLIAVGNEILFTGNKEWISHLVPCIKSLHQALV  147

Query  460  KSGI  471
            ++GI
Sbjct  148  RAGI  151



>ref|XP_010043553.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Eucalyptus 
grandis]
Length=410

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +1

Query  31   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  207
            +L P    +FFL V+         +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD
Sbjct  3    NLFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFD  62

Query  208  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  387
             NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVGNE+
Sbjct  63   ANPDILRAFAGTGIAVTVTVGNGDIISLSKLPSAQAWVSANILPFHPKTLINRIAVGNEI  122

Query  388  LHWGTPEMQNGLVAAMRSLYNAL  456
            L      +   L+ AM++L++AL
Sbjct  123  LATSDKTLIARLLPAMKALHSAL  145



>ref|XP_009103956.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=449

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 104/145 (72%), Gaps = 4/145 (3%)
 Frame = +1

Query  46   PIFLFFLVSA---FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  216
            P+  F L+SA     F   + SIGVNYGTLG NLPPPT+VA FLK +  ID +KIF+V+P
Sbjct  6    PLISFLLISAAVLLTFPAAISSIGVNYGTLG-NLPPPTQVANFLKTQASIDSVKIFNVDP  64

Query  217  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
            +ILRAFAGTGI V VTVPNG+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  
Sbjct  65   NILRAFAGTGISVVVTVPNGDIPALANGMQARRWVSANILPFHPQTKIKYISVGNEILLT  124

Query  397  GTPEMQNGLVAAMRSLYNALVKSGI  471
            G     + L+ AMR++ +ALV++G+
Sbjct  125  GDNNTISKLLPAMRTINSALVRAGV  149



>gb|KCW85570.1| hypothetical protein EUGRSUZ_B02367 [Eucalyptus grandis]
Length=460

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 8/142 (6%)
 Frame = +1

Query  55   LFFLVSAFLFI--------HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  210
            LF L +A  F+            +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD 
Sbjct  4    LFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFDA  63

Query  211  NPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVL  390
            NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVGNE+L
Sbjct  64   NPDILRAFAGTGIAVTVTVGNGDIISLSKLPAAQAWVSANILPFHPKTLINRIAVGNEIL  123

Query  391  HWGTPEMQNGLVAAMRSLYNAL  456
                  +   L+ AM++L++AL
Sbjct  124  ATSDKNLIARLLPAMKALHSAL  145



>ref|XP_010043555.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
 gb|KCW85569.1| hypothetical protein EUGRSUZ_B02367 [Eucalyptus grandis]
Length=501

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 97/142 (68%), Gaps = 8/142 (6%)
 Frame = +1

Query  55   LFFLVSAFLFI--------HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  210
            LF L +A  F+            +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD 
Sbjct  4    LFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFDA  63

Query  211  NPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVL  390
            NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVGNE+L
Sbjct  64   NPDILRAFAGTGIAVTVTVGNGDIISLSKLPAAQAWVSANILPFHPKTLINRIAVGNEIL  123

Query  391  HWGTPEMQNGLVAAMRSLYNAL  456
                  +   L+ AM++L++AL
Sbjct  124  ATSDKNLIARLLPAMKALHSAL  145



>gb|KFK34786.1| hypothetical protein AALP_AA5G193500 [Arabis alpina]
Length=447

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + +IGVNYGTLG NLPPP++VA F+K +T ID +KIF+V+P+ILRAFAG+GI V VTVPN
Sbjct  22   ISAIGVNYGTLG-NLPPPSQVANFIKTRTSIDSVKIFNVDPNILRAFAGSGISVVVTVPN  80

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WVAANI P++P TKI  I+VGNE+L  G   M N L+ AMR+L NA
Sbjct  81   GDIPALANGRQARRWVAANILPYHPQTKIKYISVGNEILLTGDNNMINNLLPAMRNLNNA  140

Query  454  LVKSGI  471
            LV++G+
Sbjct  141  LVRAGV  146



>ref|XP_009116237.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=453

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI V VTVPN
Sbjct  26   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISVVVTVPN  84

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M   L+ AM++L  A
Sbjct  85   GDIPALANGVQARRWVSANILPFHPQTKIKYISVGNEILLSGDDNMIKNLLPAMKNLNAA  144

Query  454  LVKSGI  471
            LV++G+
Sbjct  145  LVRAGV  150



>emb|CDY40218.1| BnaA09g35000D [Brassica napus]
Length=453

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI V VTVPN
Sbjct  26   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISVVVTVPN  84

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M   L+ AM++L  A
Sbjct  85   GDIPALANGVQARRWVSANILPFHPQTKIKYISVGNEILLSGDDNMIKNLLPAMKNLNAA  144

Query  454  LVKSGI  471
            LV++G+
Sbjct  145  LVRAGV  150



>emb|CDY02936.1| BnaC04g25500D [Brassica napus]
Length=452

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + +IGVNYGTLG NLPPPTEVA FLK +T ID +KIF+V+P+ILRAFAGTGI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPTEVANFLKTQTSIDSVKIFNVDPNILRAFAGTGISVVVTVPN  84

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M + L+ AMR+L  A
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMISNLLPAMRNLNKA  144

Query  454  LVKSGI  471
            LV++G+
Sbjct  145  LVRAGV  150



>ref|XP_009116238.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=450

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  76   FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  255
            F     + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI +
Sbjct  19   FTLPAAISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISL  77

Query  256  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  435
             VTVPNG+I  L +   A +WVAANI+PF+P TKI  I+VGNE+L  G   M   L+ AM
Sbjct  78   VVTVPNGDIPALANGVQARRWVAANIQPFHPQTKIKYISVGNEILLSGDDNMIKNLLPAM  137

Query  436  RSLYNALVKSGI  471
            ++L  AL  +G+
Sbjct  138  KNLNAALFHAGV  149



>ref|XP_010427314.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=452

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  28   ISAIGVNYGTLG-NLPPPTQVANFIKTQTTIDSVKIFDVNPDILRAFAGTGISVVVTVPN  86

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WV+ANI PF P T I  I+VGNE+L  G   M N L+ AM +L NA
Sbjct  87   GDIPALANGLQARRWVSANILPFNPQTIIKYISVGNEILLSGDNNMINNLLPAMMNLNNA  146

Query  454  LVKSGI  471
            LV++G+
Sbjct  147  LVRAGV  152



>ref|XP_009405069.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 99/141 (70%), Gaps = 2/141 (1%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            +F+  L S+   + G+ SIGVNYGT+ DNLPPP +VA FLK+ T+IDRIK++D NPDI+R
Sbjct  18   LFVLILFSSASAVSGL-SIGVNYGTIADNLPPPPQVAAFLKDHTIIDRIKLYDANPDIIR  76

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQ-WVAANIKPFYPATKINIIAVGNEVLHWGTP  405
            AFAGT I VT+T PNGEI     +  AA  WVAAN+ PF PAT+I ++ VGNE+L+ G  
Sbjct  77   AFAGTPISVTITAPNGEIPSFASSREAADAWVAANVAPFVPATRITLVLVGNEILNTGDA  136

Query  406  EMQNGLVAAMRSLYNALVKSG  468
             +   LV AM SL  AL  +G
Sbjct  137  GLMERLVPAMVSLSGALSAAG  157



>gb|KDP44958.1| hypothetical protein JCGZ_01458 [Jatropha curcas]
Length=446

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  67   VSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  243
            +S FL +    + +GVNYGTL +NLPPP +VA FLK +T+ID IKIFD NP+IL+AFA T
Sbjct  12   ISTFLHLFTTSAALGVNYGTLANNLPPPAQVANFLKTETIIDSIKIFDTNPEILKAFANT  71

Query  244  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGL  423
             I VTVTV NG+I  L +A  A +WVA NIKP+YP TKIN+IA+GNE+L  G  +    L
Sbjct  72   NITVTVTVGNGDIPSLSNARAARRWVANNIKPYYPQTKINLIAIGNEILMSGVQDWIAHL  131

Query  424  VAAMRSLYNALV  459
            V  M+++++ALV
Sbjct  132  VPCMKAIHHALV  143



>emb|CDY40219.1| BnaA09g35010D [Brassica napus]
Length=450

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI + VTVPN
Sbjct  25   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISLVVTVPN  83

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WVAANI+PF+P TKI  I+VGNE+L  G   M   L+ AM++L  A
Sbjct  84   GDIPALANGVQARRWVAANIQPFHPQTKIKYISVGNEILLSGDDNMIKNLLPAMKNLNAA  143

Query  454  LVKSGI  471
            L  +G+
Sbjct  144  LFHAGV  149



>ref|XP_010256938.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=455

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +1

Query  91   GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  270
             V SI VNYGTLG+NLPPP +VA F+K++T+ID++KIFD NPDILRAFA TGI +TVTV 
Sbjct  29   AVYSIDVNYGTLGNNLPPPAQVATFIKQRTIIDKVKIFDTNPDILRAFANTGIAITVTVG  88

Query  271  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  450
            NG+I  L +   A  WVA  I PFYP TKIN IAVGNE++      +   +V AM+SL+ 
Sbjct  89   NGDIPQLANLPAARNWVATKITPFYPQTKINRIAVGNEIMATADKNLIIHMVPAMKSLHA  148

Query  451  ALVKSGI  471
            AL  +GI
Sbjct  149  ALRLAGI  155



>emb|CDX76097.1| BnaA04g03610D [Brassica napus]
Length=451

 Score =   145 bits (365),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + +IGVNYGTLG NLPPP EVA FLK +T ID +KIF+V+P+ILRAFAGTGI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPNEVANFLKTQTSIDSVKIFNVDPNILRAFAGTGISVVVTVPN  84

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M + L+ AMR+L  A
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMISNLLPAMRNLNKA  144

Query  454  LVKSGI  471
            LV++G+
Sbjct  145  LVRAGV  150



>ref|XP_010937626.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=450

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL DNLPPP++VA FLK  T IDR+K+FD NPD++RAFAGTGI + +TVPNG+
Sbjct  24   SIGVNYGTLADNLPPPSQVAAFLKANTFIDRVKLFDSNPDLIRAFAGTGISLMITVPNGD  83

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            +  L     A  WVA N+ PF+PAT I+++AVGNEV+      +   LV AMRSL  AL 
Sbjct  84   VPSLAKLPAARTWVANNVAPFHPATNISLLAVGNEVMATADRNLIAHLVPAMRSLSAALA  143

Query  460  KSGI  471
            ++G 
Sbjct  144  EAGF  147



>ref|XP_009345986.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +1

Query  61   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  240
            F     + +    SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPDILR FAG
Sbjct  15   FSACHVILLTTAYSIGVNYGTIADNLPPPSKVATFLKTKTTIDRVKIFDANPDILRVFAG  74

Query  241  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  420
            T I VTVTV NG++  L     A  WVA NI PF+P T IN IAVGNE+L     ++   
Sbjct  75   TNIAVTVTVGNGDVPALAKLSAAQSWVADNILPFHPRTTINRIAVGNEILATSDKDLIAH  134

Query  421  LVAAMRSLYNAL  456
            L+ AM+SL++AL
Sbjct  135  LLPAMKSLHSAL  146



>ref|XP_009345982.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +1

Query  61   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  240
            F     + +    SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPDILR FAG
Sbjct  15   FSACHVILLTTAYSIGVNYGTIADNLPPPSKVATFLKTKTTIDRVKIFDANPDILRVFAG  74

Query  241  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  420
            T I VTVTV NG++  L     A  WVA NI PF+P T IN IAVGNE+L     ++   
Sbjct  75   TNIAVTVTVGNGDVPALAKLSAAQSWVADNILPFHPRTTINRIAVGNEILATSDKDLIAH  134

Query  421  LVAAMRSLYNAL  456
            L+ AM+SL++AL
Sbjct  135  LLPAMKSLHSAL  146



>ref|XP_009353665.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 90/132 (68%), Gaps = 0/132 (0%)
 Frame = +1

Query  61   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  240
            F     + +    SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPDILR FAG
Sbjct  15   FSACHVILLTTAYSIGVNYGTIADNLPPPSKVATFLKTKTTIDRVKIFDANPDILRVFAG  74

Query  241  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  420
            T I VTVTV NG++  L     A  WVA NI PF+P T IN IAVGNE+L     ++   
Sbjct  75   TNIAVTVTVGNGDVPALAKLSAAQSWVADNILPFHPRTTINRIAVGNEILATSDKDLIAH  134

Query  421  LVAAMRSLYNAL  456
            L+ AM+SL++AL
Sbjct  135  LLPAMKSLHSAL  146



>ref|XP_009139167.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=451

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            + +IGVNYGTLG NLPPP EVA FLK +T ID +KIF+V+P+ILRAFAG GI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPNEVANFLKTQTSIDSVKIFNVDPNILRAFAGPGISVVVTVPN  84

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L +   A +WV+ANI PF+P TKI  I+VGNE+L  G   M + L+ AMR+L  A
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMISNLLPAMRNLNKA  144

Query  454  LVKSGI  471
            LV++G+
Sbjct  145  LVRAGV  150



>ref|XP_007009341.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
 gb|EOY18151.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
Length=440

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = +1

Query  82   FIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGIL  252
            F+H V S   +GVNYG + DNLP P EVA F+K KT+ D +KIFD NPD+LRAFA T I 
Sbjct  9    FLHLVTSATALGVNYGMIADNLPSPYEVANFIKTKTIFDSVKIFDTNPDVLRAFANTDIS  68

Query  253  VTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAA  432
            VTVTV NG+I  L +   A +WV  +I+PFYP TKI  I+VGNE+L +   +  N LV A
Sbjct  69   VTVTVANGQIPSLTNVRAARRWVNNHIRPFYPQTKIKYISVGNEILLFNVQDQINNLVPA  128

Query  433  MRSLYNALVKSGI  471
            M+SL+ AL K+GI
Sbjct  129  MKSLHLALAKAGI  141



>ref|XP_003561280.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brachypodium 
distachyon]
Length=475

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            I++F  + A  F     +IGVNYGT GDNL PP+ VA FL  +T IDR+K+FD NPD+LR
Sbjct  18   IYVFLAIVAQPFTT-TTAIGVNYGTKGDNLAPPSTVAAFLANRTRIDRVKLFDTNPDMLR  76

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AFAGTGI V VT  NG+I  L     AA WVA+N+ PFYPAT+I+++AVGNE++    P 
Sbjct  77   AFAGTGISVMVTAANGDIPILATTQGAAAWVASNVAPFYPATEISLVAVGNEIMDTHDPS  136

Query  409  MQNGLVAAMRSL  444
            + + LV AMR+L
Sbjct  137  LIDSLVPAMRTL  148



>ref|XP_004959111.1| PREDICTED: uncharacterized protein LOC101782084 [Setaria italica]
Length=1022

 Score =   145 bits (367),  Expect = 7e-37, Method: Composition-based stats.
 Identities = 74/137 (54%), Positives = 97/137 (71%), Gaps = 2/137 (1%)
 Frame = +1

Query  64   LVSAFLFIHG--VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  237
            ++SAFL +      +IGVNYGT GDNLPPP +VA FL  +T IDR+K+FD N D++RAFA
Sbjct  14   VLSAFLLVIAPYAAAIGVNYGTKGDNLPPPAKVASFLANRTRIDRVKLFDTNADMVRAFA  73

Query  238  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  417
            GTGI +TVT  NG+I  L     AA WV+AN+ P+YPAT I+++AVGNE++      + N
Sbjct  74   GTGIALTVTAANGDIPKLATKDGAAAWVSANVAPYYPATDISLVAVGNEIMATADKTLIN  133

Query  418  GLVAAMRSLYNALVKSG  468
             LV AMR+L  ALV +G
Sbjct  134  SLVPAMRALKAALVAAG  150



>ref|XP_006350772.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=448

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 100/145 (69%), Gaps = 5/145 (3%)
 Frame = +1

Query  46   PIFLFFLVSAFLFIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  216
            PIF  F+    L  +GV S   +G+NYGT+ DNLPPP++VA F+++ T +++IKIFD NP
Sbjct  9    PIFSSFIF--LLLCNGVSSDYLLGINYGTVADNLPPPSQVAAFIRDHTTLNKIKIFDANP  66

Query  217  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
            +I+RAFA TG+ VTVTVPNG+I  +     A  WV  N+ PFYP T+I+ I +GNEV+  
Sbjct  67   EIIRAFADTGVWVTVTVPNGDIWSVSKPTAAQWWVEQNVVPFYPRTRIDRICIGNEVMAT  126

Query  397  GTPEMQNGLVAAMRSLYNALVKSGI  471
            G   +   LV AMR+++ AL+ +GI
Sbjct  127  GDKNLIAHLVPAMRAIHEALLAAGI  151



>gb|KJB37375.1| hypothetical protein B456_006G202300 [Gossypium raimondii]
Length=509

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 96/138 (70%), Gaps = 2/138 (1%)
 Frame = +1

Query  58   FFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  237
             FLVS F  + GV SIGVNYGT+ +NLPPP +VA FL E TVI+R+K++D NPDIL+AFA
Sbjct  63   LFLVSTF--VPGVGSIGVNYGTVANNLPPPPQVAHFLLESTVINRVKLYDANPDILKAFA  120

Query  238  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  417
             TGI VTVTVPN +I  L    +A QWV  N++P+ PAT I  I VGNEV+      +  
Sbjct  121  HTGIAVTVTVPNDQIPRLTKLNFARQWVEDNVQPYTPATNIVRILVGNEVITTADKMLIG  180

Query  418  GLVAAMRSLYNALVKSGI  471
             LV AM++L+ ALV + +
Sbjct  181  NLVPAMQTLHTALVAASL  198



>ref|XP_010106478.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXC10654.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=489

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            S+GVNYGT+ DNLPPP++VA FLK +T IDR+KIFD NPDILRAFAGTGI VTVTV NG+
Sbjct  26   SVGVNYGTVADNLPPPSQVATFLKTRTTIDRVKIFDANPDILRAFAGTGIAVTVTVGNGD  85

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            +  L     A  WVA NI PF+P T IN IAVGNE++      +   L+ AM++L++AL
Sbjct  86   VPSLAKLPAAQSWVANNILPFHPKTIINSIAVGNEIVATSDKSLIAHLLPAMKALHSAL  144



>ref|XP_008810606.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Phoenix dactylifera]
Length=351

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYG + DNLPPP +VA FLK  T IDR+K+FD NPD +RAFAGTGI + +TVPNG+
Sbjct  22   SIGVNYGAVADNLPPPPQVAAFLKANTFIDRVKLFDSNPDFIRAFAGTGISLMITVPNGD  81

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            +  L     A  W+A N+ PF+PAT I+++AVGNEV+      +   LV AMRSL  AL 
Sbjct  82   VPSLAKVPAARAWIANNVAPFHPATNISLLAVGNEVMATADRNLIAHLVPAMRSLSTALA  141

Query  460  KSGI  471
            ++G 
Sbjct  142  EAGF  145



>ref|XP_010043552.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
Length=462

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 97/143 (68%), Gaps = 1/143 (1%)
 Frame = +1

Query  31   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  207
            SL P    +FFL V+         +IG+NYGT+ DNLPPP++VA FLK KT IDR+KIF 
Sbjct  3    SLFPLTAAVFFLSVACPHLSRAAYTIGINYGTIADNLPPPSKVATFLKTKTTIDRVKIFH  62

Query  208  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  387
             +PDILRAFAGTGI VTV+V N +I+ L     A  WV+ANI PFYP T IN IA+GNE+
Sbjct  63   ASPDILRAFAGTGIAVTVSVGNEDIVSLSKLPAAKSWVSANILPFYPKTLINRIAMGNEI  122

Query  388  LHWGTPEMQNGLVAAMRSLYNAL  456
            L      +   L+ AM++L++AL
Sbjct  123  LATSDKTLIASLLPAMKALHSAL  145



>gb|KCW85567.1| hypothetical protein EUGRSUZ_B02364 [Eucalyptus grandis]
Length=489

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 97/143 (68%), Gaps = 1/143 (1%)
 Frame = +1

Query  31   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  207
            SL P    +FFL V+         +IG+NYGT+ DNLPPP++VA FLK KT IDR+KIF 
Sbjct  3    SLFPLTAAVFFLSVACPHLSRAAYTIGINYGTIADNLPPPSKVATFLKTKTTIDRVKIFH  62

Query  208  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  387
             +PDILRAFAGTGI VTV+V N +I+ L     A  WV+ANI PFYP T IN IA+GNE+
Sbjct  63   ASPDILRAFAGTGIAVTVSVGNEDIVSLSKLPAAKSWVSANILPFYPKTLINRIAMGNEI  122

Query  388  LHWGTPEMQNGLVAAMRSLYNAL  456
            L      +   L+ AM++L++AL
Sbjct  123  LATSDKTLIASLLPAMKALHSAL  145



>ref|XP_007205054.1| hypothetical protein PRUPE_ppa004320mg [Prunus persica]
 gb|EMJ06253.1| hypothetical protein PRUPE_ppa004320mg [Prunus persica]
Length=516

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPD+LRAFA T I VTVTV NG+
Sbjct  32   SIGVNYGTIADNLPPPSQVATFLKTKTTIDRVKIFDANPDMLRAFADTKIAVTVTVGNGD  91

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            +  L     A  WV+ANI PF+P T IN IAVGNE+L     ++   L+ AM+SL+ AL
Sbjct  92   VPALAKLSAAQAWVSANILPFHPRTIINRIAVGNEILATSDKDLIAHLLPAMKSLHEAL  150



>ref|XP_010264453.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=454

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL ++LP P++VA FLK+ T ID++KIFD NPD+L+AFA TGI +TV+V NG+
Sbjct  33   SIGVNYGTLANDLPLPSQVAAFLKQSTTIDKVKIFDTNPDVLQAFANTGIAITVSVGNGD  92

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A  WVA +I PF+P TKIN IAVGNE++      +   L+ AMRSL+ ALV
Sbjct  93   IPALSKLPAAQDWVATHISPFHPQTKINRIAVGNEIVATSDKNLIAHLLPAMRSLHAALV  152

Query  460  KSGI  471
            K+GI
Sbjct  153  KAGI  156



>ref|XP_002312098.1| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE89465.1| glucan endo-1 family protein [Populus trichocarpa]
Length=454

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            +IGVNYGTLG+NLPPP++VA F+K +T+ID IKIFD N DIL AFA TGI VTVTV NG+
Sbjct  29   AIGVNYGTLGNNLPPPSQVANFIKTQTIIDSIKIFDTNHDILNAFANTGITVTVTVGNGD  88

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +   A  WVAANI PF+P T+IN I VGNE++        + LV AMR+++ AL+
Sbjct  89   IPSLANLNSARGWVAANIAPFHPQTRINRIVVGNEIMATANKPWISNLVPAMRTIHKALL  148

Query  460  KSGI  471
             +GI
Sbjct  149  LAGI  152



>ref|NP_001151227.1| glucan endo-1,3-beta-glucosidase precursor [Zea mays]
 gb|ACG42046.1| glucan endo-1,3-beta-glucosidase precursor [Zea mays]
Length=498

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            +IGVNYGT GDNLPPP  VA FL  +T IDR+K+FD NPD++RAFAGTGI V VT  NG+
Sbjct  29   AIGVNYGTKGDNLPPPATVASFLANRTRIDRVKLFDTNPDMVRAFAGTGIAVMVTAGNGD  88

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L     A  WVAAN+ P+YP+T I++++VGNE++      + + LV AMR+L  ALV
Sbjct  89   IPKLATKDGAGAWVAANVAPYYPSTDISLVSVGNEIMDTADKALISNLVPAMRALKAALV  148

Query  460  KSG  468
             +G
Sbjct  149  AAG  151



>ref|XP_011029787.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=451

 Score =   140 bits (352),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            +IGVNYGTLG+NLPPP++VA F+K +T+ID IKIFD N DIL AFA TGI VTVTV NG+
Sbjct  26   AIGVNYGTLGNNLPPPSQVANFIKTQTIIDSIKIFDTNHDILNAFANTGITVTVTVGNGD  85

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +   A  WVAANI PF+P T+IN I VGNE++        + LV AMR+++ AL+
Sbjct  86   IPSLANLNSARGWVAANIAPFHPRTRINRIVVGNEIMATANKPWISNLVPAMRTIHKALL  145

Query  460  KSGI  471
             +GI
Sbjct  146  LAGI  149



>ref|XP_008437641.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=499

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 99/144 (69%), Gaps = 2/144 (1%)
 Frame = +1

Query  46   PIFLFFLVSAFLFIHGVR--SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  219
            P FL  ++   + I GV   SIGVNYGT+ DNLPPP++VA FL + T+IDR+++FD +PD
Sbjct  40   PTFLLLILPTLIQIQGVNGGSIGVNYGTVADNLPPPSKVAAFLLDNTIIDRVRLFDADPD  99

Query  220  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  399
            ILRAFA TGI V++T+PN +I  L    +A +W+  NI+P+ PAT I  + VGNEVL   
Sbjct  100  ILRAFAHTGISVSITIPNDQIPRLVKPNFAEEWIKFNIQPYIPATNIIRVLVGNEVLSTA  159

Query  400  TPEMQNGLVAAMRSLYNALVKSGI  471
               +   LV AM+SL+ ALV++ +
Sbjct  160  NKLLIANLVPAMQSLHTALVEASL  183



>gb|KHG22731.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=465

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 96/141 (68%), Gaps = 2/141 (1%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            +   FLVS    + GV SIGVNYGT+ +NLPPP +VA FL E TVI+R+K++D NPDIL+
Sbjct  16   VISLFLVSTL--VPGVGSIGVNYGTVANNLPPPPQVAHFLLESTVINRVKLYDANPDILK  73

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AFA TGI VTVTVPN +I  L    +A QWV  N++P+ PAT I  I VGNEV+      
Sbjct  74   AFAHTGIAVTVTVPNDQIPRLTKLNFARQWVEDNVQPYTPATNIVRILVGNEVITTADKM  133

Query  409  MQNGLVAAMRSLYNALVKSGI  471
            +   LV AM++L+ ALV + +
Sbjct  134  LIGNLVPAMQTLHTALVAASL  154



>ref|XP_004145947.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 ref|XP_004160391.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
Length=497

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 98/144 (68%), Gaps = 2/144 (1%)
 Frame = +1

Query  46   PIFLFFLVSAFLFIHGVR--SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  219
            P FL  ++     I GV   SIGVNYGT+ DNLPPP++VA FL + T+IDR+++FD +PD
Sbjct  41   PTFLLLILPTLFQIQGVNGGSIGVNYGTVADNLPPPSKVAAFLLDNTIIDRVRLFDADPD  100

Query  220  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  399
            ILRAFA TGI V++T+PN +I  L    +A +W+  NI+P+ PAT I  + VGNEVL   
Sbjct  101  ILRAFAHTGISVSITIPNDQIPRLVKPNFAEEWIKFNIQPYIPATNIIRVLVGNEVLSTA  160

Query  400  TPEMQNGLVAAMRSLYNALVKSGI  471
               +   LV AM+SL+ AL+++ +
Sbjct  161  NKLLIANLVPAMQSLHTALIEASL  184



>emb|CDP05033.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 96/145 (66%), Gaps = 6/145 (4%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVR------SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  216
            L  ++SA L +  V       ++GVNYGT+ DNLPPP EVA FL E T+I+R+++FD NP
Sbjct  5    LVHVISALLLVASVNIQGIEGTVGVNYGTVADNLPPPAEVAHFLLENTIINRVRLFDANP  64

Query  217  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
            +IL AFA TGI +T+TVPN EI  L +  +A QWV ANI P +PAT I  I VGNEV+  
Sbjct  65   EILEAFAHTGIAITLTVPNNEIPQLTNLSFAQQWVTANITPHFPATNIVRILVGNEVISS  124

Query  397  GTPEMQNGLVAAMRSLYNALVKSGI  471
             +  +   LV AM++L+ ALV   +
Sbjct  125  ASKLLITSLVPAMQTLHTALVAESL  149



>ref|XP_006394688.1| hypothetical protein EUTSA_v10004182mg [Eutrema salsugineum]
 gb|ESQ31974.1| hypothetical protein EUTSA_v10004182mg [Eutrema salsugineum]
Length=458

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 103/158 (65%), Gaps = 2/158 (1%)
 Frame = +1

Query  4    NLILKIMEMSLRPSPIFLFFLVSAFL-FIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEK  177
            N +L     S   SPI +F +V A + F  G   SIGVNYGTL +NLPPP +VA FL   
Sbjct  2    NYMLLFFSCSWVISPISMFTMVVALIIFSTGANASIGVNYGTLANNLPPPRQVAEFLLHS  61

Query  178  TVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATK  357
            TVI+RI++FD +P ILRAFA TGI VTVTVPN +I  L +  +A QW++ +I+P +P+T 
Sbjct  62   TVINRIRLFDADPQILRAFAHTGIAVTVTVPNHQITHLTNLSFAEQWISDHIQPHFPSTN  121

Query  358  INIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            I  I VGNEV+      +   LV AM+SL+ ALV + +
Sbjct  122  IIRILVGNEVISTANHLLIRTLVPAMQSLHTALVSASL  159



>ref|XP_009419749.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 92/129 (71%), Gaps = 5/129 (4%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYG   +NLPPP +VA FLK++T IDR+K+FD NPD++RAFAGTGI + +TVPNG+
Sbjct  40   SIGVNYGAYANNLPPPAQVAAFLKDRTFIDRVKLFDANPDMIRAFAGTGISLMITVPNGD  99

Query  280  IIPL-----KDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSL  444
            I  L       +  A+ WVA+++ PFYPAT I+++AVGNEVL      +   LV AMRSL
Sbjct  100  IASLASRSSAPSPAASAWVASHVAPFYPATNISLVAVGNEVLATADRNLIAHLVPAMRSL  159

Query  445  YNALVKSGI  471
            Y AL  +G 
Sbjct  160  YAALSAAGF  168



>gb|KGN49838.1| hypothetical protein Csa_5G139170 [Cucumis sativus]
Length=493

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 98/144 (68%), Gaps = 2/144 (1%)
 Frame = +1

Query  46   PIFLFFLVSAFLFIHGVR--SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  219
            P FL  ++     I GV   SIGVNYGT+ DNLPPP++VA FL + T+IDR+++FD +PD
Sbjct  41   PTFLLLILPTLFQIQGVNGGSIGVNYGTVADNLPPPSKVAAFLLDNTIIDRVRLFDADPD  100

Query  220  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  399
            ILRAFA TGI V++T+PN +I  L    +A +W+  NI+P+ PAT I  + VGNEVL   
Sbjct  101  ILRAFAHTGISVSITIPNDQIPRLVKPNFAEEWIKFNIQPYIPATNIIRVLVGNEVLSTA  160

Query  400  TPEMQNGLVAAMRSLYNALVKSGI  471
               +   LV AM+SL+ AL+++ +
Sbjct  161  NKLLIANLVPAMQSLHTALIEASL  184



>ref|XP_004241225.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum lycopersicum]
Length=449

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 98/147 (67%), Gaps = 6/147 (4%)
 Frame = +1

Query  49   IFLFFLVSAFLF------IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  210
             F   + S+F+F      + G   +G+NYGT+ DNLPPPT+VA F+++ T +++IKIFD 
Sbjct  5    CFFLPIFSSFVFLLLCNGVSGDYLLGINYGTVADNLPPPTQVAAFIRDHTTLNKIKIFDA  64

Query  211  NPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVL  390
            NP+I+RAFA TGI VTVTV NG+I  +     A  WV  N+ PFYP T+I+ I VGNEV+
Sbjct  65   NPEIIRAFADTGIWVTVTVSNGDIWSVSKPTAAQWWVEQNVVPFYPRTRIDRICVGNEVV  124

Query  391  HWGTPEMQNGLVAAMRSLYNALVKSGI  471
              G   +   LV AMR+++ AL+ +GI
Sbjct  125  ATGDKNLIGHLVPAMRAIHEALLAAGI  151



>ref|XP_007013798.1| O-Glycosyl hydrolases family 17 protein, putative isoform 2, 
partial [Theobroma cacao]
 gb|EOY31417.1| O-Glycosyl hydrolases family 17 protein, putative isoform 2, 
partial [Theobroma cacao]
Length=459

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
            +F L++ FL +    + +GVNYG   DNLP P+ VA F+K +T+ D +K+FD NP++LRA
Sbjct  41   IFLLLAIFLHLFTTTTALGVNYGMAADNLPSPSVVANFIKTQTIFDSVKMFDANPEVLRA  100

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA TGI VTVTV NG+I  L +   A +WVA +I PFYP TKI  I  G+EVL     + 
Sbjct  101  FANTGISVTVTVGNGDIPALTNTVVARRWVAQHISPFYPQTKIKYICAGSEVLFSNITDW  160

Query  412  QNGLVAAMRSLYNALVKSGI  471
             N LV AMRSL+ ALVK+GI
Sbjct  161  INNLVPAMRSLHYALVKAGI  180



>ref|XP_007013797.1| O-Glycosyl hydrolases family 17 protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY31416.1| O-Glycosyl hydrolases family 17 protein, putative isoform 1 [Theobroma 
cacao]
Length=483

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
            +F L++ FL +    + +GVNYG   DNLP P+ VA F+K +T+ D +K+FD NP++LRA
Sbjct  41   IFLLLAIFLHLFTTTTALGVNYGMAADNLPSPSVVANFIKTQTIFDSVKMFDANPEVLRA  100

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA TGI VTVTV NG+I  L +   A +WVA +I PFYP TKI  I  G+EVL     + 
Sbjct  101  FANTGISVTVTVGNGDIPALTNTVVARRWVAQHISPFYPQTKIKYICAGSEVLFSNITDW  160

Query  412  QNGLVAAMRSLYNALVKSGI  471
             N LV AMRSL+ ALVK+GI
Sbjct  161  INNLVPAMRSLHYALVKAGI  180



>ref|XP_008457482.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=573

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 88/119 (74%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGT+ +NLPPPT+VA FLK +T IDR+KIFD NPDILRAFAGTGI +TV++ NG+
Sbjct  103  SIGVNYGTVANNLPPPTQVAAFLKSRTSIDRVKIFDANPDILRAFAGTGIALTVSIANGD  162

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            I  L     A  WVA NI PF+P T IN IAVGNE+L      +   L+ AM+++++AL
Sbjct  163  IPALAKLPAAQSWVANNILPFHPTTLINHIAVGNEILATSDKNLIAHLLPAMKAIHSAL  221



>gb|KHF99783.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=510

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 95/146 (65%), Gaps = 5/146 (3%)
 Frame = +1

Query  34   LRPSPIFLFFLVSAFLFIH-----GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            L  + + +FF  S  L I       V +IGVNYGT+ DNLP PT+VA+FLK KT IDRIK
Sbjct  4    LSATKLLIFFFFSCHLSIFSSTATAVYTIGVNYGTVADNLPTPTQVAKFLKSKTNIDRIK  63

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  378
            IFD NPDIL+AFAGTGI VTVTV NG+I  L     A  W+  NI P++P T I  IAVG
Sbjct  64   IFDTNPDILKAFAGTGISVTVTVGNGDIPSLAKLPGAKAWIEKNILPYHPKTIIRYIAVG  123

Query  379  NEVLHWGTPEMQNGLVAAMRSLYNAL  456
            NE+L      +   L+ AM++L +AL
Sbjct  124  NEILATSDKTLIAYLLPAMKALRSAL  149



>ref|XP_006441150.1| hypothetical protein CICLE_v10020075mg [Citrus clementina]
 gb|ESR54390.1| hypothetical protein CICLE_v10020075mg [Citrus clementina]
Length=460

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 101/153 (66%), Gaps = 3/153 (2%)
 Frame = +1

Query  22   MEMSLRPSPIF--LFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  192
            M+ +  P P F  L  +V +   IHG   SIGVNYGT+ +NLPPPT VA FL E T+I+R
Sbjct  1    MDKAQIPLPTFTILLLVVVSISLIHGSEGSIGVNYGTVANNLPPPTHVAHFLLESTIINR  60

Query  193  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  372
            +++FD +P ++RAFA TGI VTVTVPN +I  L    +A QW+  NI+P+ PAT I  I 
Sbjct  61   VRLFDADPKMIRAFAHTGIAVTVTVPNDQIPYLTKLNFAEQWLKNNIQPYTPATNIVRIL  120

Query  373  VGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            VGNE+L   +  +   LV AM++L+ ALV + +
Sbjct  121  VGNEILSTASKLLIASLVPAMQTLHTALVGASL  153



>ref|XP_009384878.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 89/129 (69%), Gaps = 6/129 (5%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  282
            +GVNYG   DNLPPP +VA FLK++T +DR+K+FD NPDI+RAFAGTGI + +TVPNG+I
Sbjct  29   VGVNYGAFADNLPPPAQVAAFLKDRTFVDRVKLFDANPDIIRAFAGTGISLMITVPNGDI  88

Query  283  IPL------KDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSL  444
              L        +  A+ WVA N+ PFYPAT I++IAVGNEVL      +   LV AMRSL
Sbjct  89   PSLASRRSSAPSPAASAWVAINVAPFYPATNISLIAVGNEVLATSDRNLIAHLVPAMRSL  148

Query  445  YNALVKSGI  471
              AL  SG 
Sbjct  149  SAALAASGF  157



>ref|XP_006846179.1| hypothetical protein AMTR_s00012p00207210 [Amborella trichopoda]
 gb|ERN07854.1| hypothetical protein AMTR_s00012p00207210 [Amborella trichopoda]
Length=481

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 100/155 (65%), Gaps = 7/155 (5%)
 Frame = +1

Query  19   IMEMSLRPSPIFLFFLVSAFLFIHGV----RSIGVNYGTLGDNLPPPTEVARFLKEKTVI  186
            + ++ L+P    L  L+S F  I  +     SIGVNYGTL DNLPPP +VA FLK +T I
Sbjct  1    MADVRLQPP---LTSLISYFCIILSLGLKASSIGVNYGTLADNLPPPAQVATFLKTQTYI  57

Query  187  DRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINI  366
            DRIK+F  +P IL+AFA TGI V ++  N EI+PL  A  AAQWVA ++ PF PATKI  
Sbjct  58   DRIKLFGADPAILQAFANTGISVVISAANDEIVPLSKAPAAAQWVADHVLPFVPATKIIA  117

Query  367  IAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            I+VGNEVL      +   L+ AMRSL+ ALV   +
Sbjct  118  ISVGNEVLATSDKNLIAHLLPAMRSLHTALVNRNL  152



>ref|XP_009796709.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase-like 
[Nicotiana sylvestris]
Length=436

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 96/141 (68%), Gaps = 4/141 (3%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            IF FF   +     G   IGVNYGT+ DNLPPPT+VA F++++T +++IKI D NP+I+R
Sbjct  14   IFFFFCNGSL----GGYLIGVNYGTVADNLPPPTQVAAFIRDQTTVNKIKIVDANPEIIR  69

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AF+ TG+ VT+TVPNG+I+ +     A  WV  N+ P+YP TKI+ I VGNEV+      
Sbjct  70   AFSNTGVWVTITVPNGDILTVSKPAGAQSWVDENVVPYYPHTKIDRICVGNEVIATSDKN  129

Query  409  MQNGLVAAMRSLYNALVKSGI  471
            +   LV AM++++ AL++ GI
Sbjct  130  LIAHLVPAMKAIHEALLQVGI  150



>gb|KHG05533.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=443

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 91/140 (65%), Gaps = 1/140 (1%)
 Frame = +1

Query  55   LFFLVSAFL-FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
            +F L+   L       SIGVNYG   DNLPPP+ VA FL+ +T+ D +K+FD NPD+LRA
Sbjct  4    VFILIGVLLQLFTATTSIGVNYGMTADNLPPPSVVANFLRTQTIFDSVKLFDANPDVLRA  63

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA TGI V+VTV NG+I  L +   A +WVA +I PF+P TKI  I VG EVL     + 
Sbjct  64   FANTGISVSVTVGNGDIPGLTNTVTARRWVADHISPFHPQTKIKYICVGTEVLFSKNDDW  123

Query  412  QNGLVAAMRSLYNALVKSGI  471
             N LV AMRSL+ AL K+G 
Sbjct  124  INNLVPAMRSLHYALNKAGF  143



>ref|XP_004151673.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 ref|XP_004168987.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 gb|KGN65723.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=489

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGT+ +NLPPP++VA FLK  T IDR+KIFD NPDILRAFAGTGI +TV+V NG+
Sbjct  23   SIGVNYGTVANNLPPPSQVAAFLKSHTSIDRVKIFDANPDILRAFAGTGIALTVSVANGD  82

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            I  L     A  WVA NI PF+P T IN IAVGNE+L      +   L+ AM+++++AL
Sbjct  83   IPALAKLPAAQSWVANNILPFHPTTLINHIAVGNEILATSDKNLIAHLLPAMKAIHSAL  141



>emb|CDP21469.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 103/155 (66%), Gaps = 8/155 (5%)
 Frame = +1

Query  31   SLRPSPIFLF---FLVSAFLFIH-----GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVI  186
            S  P+  FLF   F++    F+H        +IGVNYGT+ DNLPPP +VA F+K++T I
Sbjct  5    SSSPAKPFLFSISFVIFLHHFLHHWAVAAGYAIGVNYGTVADNLPPPAQVASFIKDQTSI  64

Query  187  DRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINI  366
            D+IKIFD NPDI+RAFA + + +T+TV NG+++ +     A  WV+ N+ P+YP TKI+ 
Sbjct  65   DKIKIFDANPDIIRAFANSNVSLTITVGNGDVLAVSKLPAAQSWVSTNVLPYYPQTKIHR  124

Query  367  IAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            I VGNEV+  G   +   LV+AM+S++ AL  +GI
Sbjct  125  IDVGNEVIATGDRSLIAHLVSAMKSVHEALRLAGI  159



>ref|XP_008223598.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=517

 Score =   137 bits (345),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 71/124 (57%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD N D+LRAFA T I VTVTV NG+
Sbjct  32   SIGVNYGTIADNLPPPSQVATFLKTKTTIDRVKIFDANADMLRAFADTKIAVTVTVGNGD  91

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            +  L     A  WV+ANI PF+P T IN IAVGNE+L     ++   L+ +M+SL+ AL 
Sbjct  92   VPALAKLSAAQAWVSANILPFHPRTIINRIAVGNEILATSDKDLIAHLLPSMKSLHEALQ  151

Query  460  KSGI  471
             + I
Sbjct  152  LANI  155



>ref|XP_006491986.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
 gb|KDO59627.1| hypothetical protein CISIN_1g043079mg [Citrus sinensis]
Length=460

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 99/149 (66%), Gaps = 3/149 (2%)
 Frame = +1

Query  22   MEMSLRPSPIF--LFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  192
            M+ +  P P F  L  +V +   IHG   SIGVNYGT+ +NLPPPT VA FL E T+I+R
Sbjct  1    MDKAQIPLPTFTILLLVVVSISLIHGSEGSIGVNYGTVANNLPPPTHVAHFLLESTIINR  60

Query  193  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  372
            +++FD +P ++RAFA TGI VTVTVPN +I  L    +A QW+  NI+P+ PAT I  I 
Sbjct  61   VRLFDADPKMIRAFAHTGIAVTVTVPNDQIPYLTKLNFAEQWLKNNIQPYTPATNIVRIF  120

Query  373  VGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            VGNE+L   +  +   LV AM++L+ ALV
Sbjct  121  VGNEILSTASKLLIASLVPAMQTLHTALV  149



>ref|XP_004295910.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=515

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  70   SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGI  249
            SAF  I    +IGVNYGT+ +NLPPP++VA FLK KT IDR+KIF+ +P +LRAFA TGI
Sbjct  14   SAFHVIL-TSAIGVNYGTVANNLPPPSQVATFLKTKTTIDRVKIFNTDPAVLRAFANTGI  72

Query  250  LVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVA  429
             VTVTV NG + PL     A  WVA NI PFYP T IN IAVGNE+L     ++   L+ 
Sbjct  73   AVTVTVGNGNVPPLAKLPAAQSWVADNILPFYPRTNINRIAVGNEILATSDKDLIAHLLP  132

Query  430  AMRSLYNAL  456
            AM++L++AL
Sbjct  133  AMKALHSAL  141



>dbj|BAK07810.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   136 bits (343),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 93/140 (66%), Gaps = 5/140 (4%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            I +F  V+ F        IGVNYGT GDNLP P +VA FL  +T IDR+K+FD NPD++R
Sbjct  18   ICIFLAVAPF-----STPIGVNYGTKGDNLPSPAKVAAFLVTRTNIDRVKLFDTNPDVVR  72

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AFAGTGI V VT  NG+I  L     A  WVA NI P+YPAT I+++AVGNE++      
Sbjct  73   AFAGTGISVMVTAGNGDIPGLATQNGADAWVATNIAPYYPATDISLVAVGNEIMDTADKN  132

Query  409  MQNGLVAAMRSLYNALVKSG  468
            + + LV+AM++L  ALV +G
Sbjct  133  LISNLVSAMQTLKAALVTAG  152



>ref|XP_002318439.2| hypothetical protein POPTR_0012s02490g [Populus trichocarpa]
 gb|EEE96659.2| hypothetical protein POPTR_0012s02490g [Populus trichocarpa]
Length=460

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  234
            +  L SAF  +    SIGVNYGT+ DNLPPP +VA FL E T+I+R+++FD N +I++AF
Sbjct  16   ILLLASAFNILGAEGSIGVNYGTVADNLPPPAQVAHFLLESTIINRVRLFDTNTEIIQAF  75

Query  235  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
            A TGI +T+TVPN +I  L + G+A +WV +N++P+ PAT I  I VGNEV+        
Sbjct  76   AHTGIAITITVPNDQIPHLTNLGFAQEWVKSNVQPYVPATNIVRILVGNEVISIENKLSV  135

Query  415  NGLVAAMRSLYNALVKSGI  471
              LV AM++L+ ALV++ +
Sbjct  136  ASLVPAMKALHTALVRASL  154



>ref|XP_010048931.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Eucalyptus grandis]
 gb|KCW89128.1| hypothetical protein EUGRSUZ_A01445 [Eucalyptus grandis]
Length=476

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 91/140 (65%), Gaps = 1/140 (1%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
            +F L+ +  F+ G R+ IGVNYGT+ DNLPPP +VA FL E T IDRI++FD +PDIL+A
Sbjct  21   VFLLLCSSFFMEGARAGIGVNYGTVADNLPPPAQVAHFLLESTTIDRIRLFDADPDILKA  80

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA TGI +TVTVPN  I  L     A  WV  N++P+ PAT I  I VGNEVL      +
Sbjct  81   FANTGIAITVTVPNDLIPQLAKLSNAQDWVRTNVEPYVPATDIVRILVGNEVLATANRLL  140

Query  412  QNGLVAAMRSLYNALVKSGI  471
               LV +MR L+ AL  + +
Sbjct  141  LGNLVMSMRMLHAALANASL  160



>emb|CDY20461.1| BnaC04g05830D [Brassica napus]
Length=450

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 91/142 (64%), Gaps = 1/142 (1%)
 Frame = +1

Query  46   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  225
            P  L   V  FL      +IG+NYGT G NLPPP +V  F+K KT+ID +KI+D NPDIL
Sbjct  11   PSLLLASVVIFLLSSKTSAIGINYGTQG-NLPPPQQVVDFIKTKTIIDSVKIYDANPDIL  69

Query  226  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTP  405
            RA +GTGI VT+ VPNG I  L +   A QWV AN+ PF+  TKI  I VGNE+L     
Sbjct  70   RALSGTGIDVTIMVPNGNIPALANVENARQWVGANVLPFHQQTKIKYICVGNEILLTKDN  129

Query  406  EMQNGLVAAMRSLYNALVKSGI  471
             + + L+ AM+SL+ AL  SG+
Sbjct  130  NLISNLIPAMQSLHEALKVSGL  151



>ref|XP_007137073.1| hypothetical protein PHAVU_009G097400g [Phaseolus vulgaris]
 gb|ESW09067.1| hypothetical protein PHAVU_009G097400g [Phaseolus vulgaris]
Length=380

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  282
            IGVNYGT+  NLPPP++VA+FL + T I+R++IFD NP+IL AFA TGI VT+TVPN +I
Sbjct  32   IGVNYGTVASNLPPPSKVAKFLSKSTTINRVRIFDANPEILHAFANTGIEVTITVPNDQI  91

Query  283  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  462
              + +  +A QWV  N++PF PATK+  I VGNEVL      + + LV AM++L+ ALV 
Sbjct  92   PQITNLTFAQQWVKTNVQPFLPATKLIRILVGNEVLSTANKLLISNLVPAMQTLHVALVT  151

Query  463  SGI  471
            + +
Sbjct  152  ASL  154



>ref|XP_011035318.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=504

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 95/154 (62%), Gaps = 4/154 (3%)
 Frame = +1

Query  7    LILKIMEMSLRPSPIFLFFLVSAFLFIHGVRS----IGVNYGTLGDNLPPPTEVARFLKE  174
            ++L  +       P  LF L+  F +     S    +GVNYGT+ +NLP P++VA FLK 
Sbjct  1    MLLHFLSSEKMAKPRTLFLLLFTFYYHFSSSSAAYTVGVNYGTVANNLPSPSQVASFLKT  60

Query  175  KTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPAT  354
            +T IDR+KIFD NPDILRAFA TGI VTVTV NG+I  L     A  W+AANI PF+P T
Sbjct  61   QTTIDRVKIFDTNPDILRAFANTGISVTVTVGNGDIPSLAKLPAAQSWIAANILPFHPQT  120

Query  355  KINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
             I  IAVGNEVL      +    + AM++L +AL
Sbjct  121  SIKYIAVGNEVLATSDKVLIAHTLPAMKALTSAL  154



>ref|XP_007039107.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY23608.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=482

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 99/148 (67%), Gaps = 7/148 (5%)
 Frame = +1

Query  49   IFLFFLVSAFLF------IHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  207
            +F   LV+A LF      + GV  +IG+NYGT+ +NLPPP +VA FL E TVI+R+++FD
Sbjct  25   VFSSVLVAAILFFLASTPVRGVEGTIGINYGTVANNLPPPAQVAHFLLESTVINRVRLFD  84

Query  208  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEV  387
             NPDIL+AFA TGI +TVTVPN +I  L     A QWV  NI+P+ PAT I  I VGNEV
Sbjct  85   ANPDILKAFAHTGIAITVTVPNDQIPRLTKLNLAQQWVEDNIQPYTPATNIVRILVGNEV  144

Query  388  LHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            +      +   LV A+++L+ ALV++ +
Sbjct  145  ISTANKLLIGSLVPAVQTLHTALVEASL  172



>ref|XP_008376760.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Malus domestica]
Length=465

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 92/139 (66%), Gaps = 1/139 (1%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
              L  LVS F+   G  SIGVNYGT+  +LPPP +VA FL E T+I+R+++FD NPDILR
Sbjct  14   CILLLLVSIFV-QGGEGSIGVNYGTMASDLPPPAKVAHFLLESTIINRVRLFDTNPDILR  72

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AFA TGI VT+T+PN +I  L     A QW+  N++P  PAT I  I VGNEVL      
Sbjct  73   AFAHTGIAVTITIPNDQIPHLTKIRSAQQWLKTNVQPHIPATNIVRILVGNEVLSTTNKL  132

Query  409  MQNGLVAAMRSLYNALVKS  465
               GLV AM++L+NALV +
Sbjct  133  FITGLVPAMQALHNALVDA  151



>gb|KJB83778.1| hypothetical protein B456_013G263800 [Gossypium raimondii]
Length=510

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 93/146 (64%), Gaps = 5/146 (3%)
 Frame = +1

Query  34   LRPSPIFLFFLVSAFLFIH-----GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            L  + + +FF  S  L I       V +IGVNYGT+ DNLP P +VA FLK KT IDRIK
Sbjct  4    LSATKLLIFFFFSCHLSIFSSTATAVYTIGVNYGTIADNLPTPAQVANFLKTKTNIDRIK  63

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  378
            IFD NPDIL+AFAGTGI VTVTV NG+I  L     A  W+  NI P++P T I  IAVG
Sbjct  64   IFDTNPDILKAFAGTGISVTVTVGNGDIPSLAKLPGAKAWIEKNILPYHPKTIIRYIAVG  123

Query  379  NEVLHWGTPEMQNGLVAAMRSLYNAL  456
            NE+L      +   L+ AM++L +AL
Sbjct  124  NEILATSDKTLIAHLLPAMKALRSAL  149



>gb|KJB19861.1| hypothetical protein B456_003G121900 [Gossypium raimondii]
Length=367

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 98/154 (64%), Gaps = 6/154 (4%)
 Frame = +1

Query  28   MSLRPSPIFL-----FFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVID  189
            M   PS  +L     FFL S FL   GV  +IGVNYGT+  NLPPP +VA FL E T+I 
Sbjct  1    MHHSPSTSYLVMLISFFLASKFLLFPGVEGTIGVNYGTVASNLPPPAQVAHFLVESTIIS  60

Query  190  RIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINII  369
            R+++FD + +IL+AFA TGI ++VTVPN EI  L    +A QWV  NI+P+ P T I  I
Sbjct  61   RVRLFDADSNILKAFAHTGIAISVTVPNDEIPRLTKLNFAQQWVENNIQPYTPNTNIVRI  120

Query  370  AVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
             VGNEVL      +   +V AM++L++AL ++ +
Sbjct  121  LVGNEVLSTANKLLIGSVVPAMQNLHSALFEASL  154



>emb|CDY53600.1| BnaA05g34730D [Brassica napus]
Length=450

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 90/142 (63%), Gaps = 1/142 (1%)
 Frame = +1

Query  46   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  225
            P  L   V  FL      +IG+NYGT G NLPPP +V  F+K KT+ID +KI+D NPDIL
Sbjct  11   PSLLLASVMIFLLSSKTSAIGINYGTQG-NLPPPQQVVEFIKTKTIIDSVKIYDANPDIL  69

Query  226  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTP  405
            RA +GTGI VT+ VPNG I  L +   A QWV AN+ PF+  TKI  I VGNE+L     
Sbjct  70   RALSGTGIDVTIMVPNGNIPALANVENARQWVGANVLPFHQQTKIKYICVGNEILLTKDN  129

Query  406  EMQNGLVAAMRSLYNALVKSGI  471
             + + L+ AM+SL  AL  SG+
Sbjct  130  NLISNLIPAMQSLLEALKVSGL  151



>ref|XP_009143300.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Brassica rapa]
Length=448

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 90/142 (63%), Gaps = 1/142 (1%)
 Frame = +1

Query  46   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  225
            P  L   V  FL      +IG+NYGT G NLPPP +V  F+K KT+ID +KI+D NPDIL
Sbjct  11   PSLLLASVVIFLLSSKTSAIGINYGTQG-NLPPPQQVVEFIKTKTIIDSVKIYDANPDIL  69

Query  226  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTP  405
            RA +GTGI VT+ VPNG I  L +   A QWV AN+ PF+  TKI  I VGNE+L     
Sbjct  70   RALSGTGIDVTIMVPNGNIPALANVENARQWVGANVLPFHQQTKIKYICVGNEILLTKDN  129

Query  406  EMQNGLVAAMRSLYNALVKSGI  471
             + + L+ AM+SL  AL  SG+
Sbjct  130  NLISNLIPAMQSLLEALKVSGL  151



>emb|CBI16129.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            V SIGVNYGT+ DNL  P+EVA F+K+KT+ DR+KIFD NPDI+ AFA TGI +TVTV N
Sbjct  21   VYSIGVNYGTVADNLASPSEVAAFIKDKTIFDRVKIFDTNPDIINAFANTGIGLTVTVVN  80

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
             +I  L     A  WVA NI PFY  TKIN I VGNE+   G  ++   LV AM++++ A
Sbjct  81   LDIPKLVHPNEATNWVATNIVPFYQKTKINYICVGNEITMSGISDLIVNLVPAMKAIHAA  140

Query  454  LVKSGI  471
            L  +GI
Sbjct  141  LQAAGI  146



>ref|XP_004498531.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like, partial [Cicer 
arietinum]
Length=360

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 95/137 (69%), Gaps = 3/137 (2%)
 Frame = +1

Query  61   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  240
            FL+ +F  + G   IGVNYGTLG+NLPPP++VA+FL   T I++++IFD NP+IL AFA 
Sbjct  3    FLLKSFAEVQG---IGVNYGTLGNNLPPPSQVAKFLLHSTTINQVRIFDANPEILHAFAN  59

Query  241  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  420
            TGI +T+T+PN +I  + +   A QW+  N++PF P+T I  I VGNEVL      + + 
Sbjct  60   TGIEITITIPNDQIPNITNLTLAQQWIKTNVQPFIPSTNIIRILVGNEVLSTANKLLIST  119

Query  421  LVAAMRSLYNALVKSGI  471
            LV AM++L+ AL+ S +
Sbjct  120  LVPAMQTLHIALMTSSL  136



>gb|KHN16491.1| Glucan endo-1,3-beta-glucosidase [Glycine soja]
Length=360

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 90/128 (70%), Gaps = 1/128 (1%)
 Frame = +1

Query  88   HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTV  267
            HG+  IGVNYGT+ +NLPPP  VA+FL + T I ++++FD NP+ILRAF  TGI VT+TV
Sbjct  28   HGI-GIGVNYGTVANNLPPPAMVAKFLSKSTTIKKVRLFDANPEILRAFGNTGIEVTITV  86

Query  268  PNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLY  447
            PN +I  + +  YA QWV  N++PF PATK+  I VGNEVL      + + LV AM++L+
Sbjct  87   PNDQIPDITNLTYAQQWVKTNVQPFIPATKLIRILVGNEVLSTANKLLVSTLVPAMQTLH  146

Query  448  NALVKSGI  471
             ALV + +
Sbjct  147  VALVAASL  154



>gb|KDP34495.1| hypothetical protein JCGZ_11045 [Jatropha curcas]
Length=494

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGT+ DNLP P++VA FLK KT IDRIKIFD NPDILRAFA TGI VTVTV NG+
Sbjct  26   SIGVNYGTVADNLPTPSQVANFLKTKTTIDRIKIFDANPDILRAFANTGISVTVTVGNGD  85

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            I  L     A  W+AANI P++P T I  IAVGNE+L      +    + AM++L +AL
Sbjct  86   IPSLAKLPAAKAWIAANILPYHPKTIIKYIAVGNEILATSDKSLIAHTLPAMKALKSAL  144



>gb|KJB53907.1| hypothetical protein B456_009G010800 [Gossypium raimondii]
Length=443

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 89/140 (64%), Gaps = 1/140 (1%)
 Frame = +1

Query  55   LFFLVSAFL-FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
            +F L+   L        IGVNYG   DNLPPP+ VA FLK +T+ D +K+FD NPD+LRA
Sbjct  4    VFILIGVLLQLFTATTGIGVNYGMTADNLPPPSVVANFLKTQTIFDSVKLFDANPDVLRA  63

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA TGI V+VT+ NG+I  L +   A +WVA +I PF+P TKI  I VG EVL       
Sbjct  64   FANTGISVSVTIGNGDIPGLTNTVTARRWVADHISPFHPQTKIKYICVGTEVLFSKNDVW  123

Query  412  QNGLVAAMRSLYNALVKSGI  471
             N LV AMRSL+ AL K+G 
Sbjct  124  INNLVPAMRSLHYALNKAGF  143



>ref|XP_006435532.1| hypothetical protein CICLE_v10033472mg [Citrus clementina]
 gb|ESR48772.1| hypothetical protein CICLE_v10033472mg [Citrus clementina]
Length=449

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
              +IGVNYGT+ +NLP P EVA FLK KT ID IK+FD NP+ILRAFA T I VTV+V N
Sbjct  26   TSAIGVNYGTIANNLPKPAEVANFLKTKTTIDAIKLFDANPEILRAFANTNISVTVSVGN  85

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L     A  WVAANI PFYP+TKI  + VGNE++     +    LV AM+S+  A
Sbjct  86   GDIPALVQLPAAKNWVAANIVPFYPSTKIIRVVVGNEIMQSANKDWIYNLVPAMKSINKA  145

Query  454  LVKSGI  471
            L+++GI
Sbjct  146  LIEAGI  151



>ref|XP_007220925.1| hypothetical protein PRUPE_ppa023079mg [Prunus persica]
 gb|EMJ22124.1| hypothetical protein PRUPE_ppa023079mg [Prunus persica]
Length=470

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  234
            L  LVS F+      SIGVNYGT+ ++LPPPT VA FL E T+I+R+++FD NPDIL+AF
Sbjct  16   LLLLVSIFIQGGVQGSIGVNYGTVANDLPPPTHVAHFLLESTIINRVRLFDANPDILQAF  75

Query  235  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
            A TGI VT+TVPN +I  L    +A QW+ +N++P+  AT I  I +GNEVL        
Sbjct  76   AHTGIAVTITVPNDQIPHLTKLSFAQQWLKSNVQPYVQATNIVRILIGNEVLSTTNKLFI  135

Query  415  NGLVAAMRSLYNALVKSGI  471
             GLV AM++L+ ALV + +
Sbjct  136  AGLVPAMQTLHAALVDASL  154



>ref|XP_006486487.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
Length=449

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
              +IGVNYGT+ +NLP P EVA FLK KT ID IK+FD NP+ILRAFA T I VTV+V N
Sbjct  26   TSAIGVNYGTIANNLPKPAEVANFLKTKTTIDAIKLFDANPEILRAFANTNISVTVSVGN  85

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L     A  WVAANI PFYP+TKI  + VGNE++     +    LV AM+S+  A
Sbjct  86   GDIPALVQLPAAKNWVAANIVPFYPSTKIIRVVVGNEIMQSANKDWIYNLVPAMKSINKA  145

Query  454  LVKSGI  471
            L+++GI
Sbjct  146  LIEAGI  151



>ref|XP_007016412.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOY34031.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=428

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 91/145 (63%), Gaps = 3/145 (2%)
 Frame = +1

Query  31   SLRPSPIFLFFLVSAFLF---IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKI  201
            +L  + +F  F     +F        SIGVNYGT+ DNLPPP +VA FLK KT IDR+KI
Sbjct  3    TLSATKLFFLFTFHVTIFSSTTTAAYSIGVNYGTVADNLPPPPQVANFLKTKTNIDRVKI  62

Query  202  FDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGN  381
            FD NPDIL+AFA TGI VTVTV NG+I  L     A  W+A NI P +P T I  IAVGN
Sbjct  63   FDANPDILKAFANTGISVTVTVGNGDIPSLAKLPGAQSWIADNILPHHPQTIIRYIAVGN  122

Query  382  EVLHWGTPEMQNGLVAAMRSLYNAL  456
            E+L      +   L+ AM++L +AL
Sbjct  123  EILATSDKSLIAHLLPAMKALRSAL  147



>emb|CAN72975.1| hypothetical protein VITISV_019488 [Vitis vinifera]
Length=443

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = +1

Query  91   GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  270
             V SIGVNYGT+ DNL  P+EVA F+K+KT+ DR+KIFD NPDI+ AFA TGI +TVTV 
Sbjct  20   AVYSIGVNYGTVADNLASPSEVAAFIKDKTIFDRVKIFDTNPDIINAFANTGIGLTVTVV  79

Query  271  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYN  450
            N +I  L     A  WVA NI PFY  TKIN I VGNE+   G  ++   LV AM++++ 
Sbjct  80   NLDIPKLVHPNEATNWVATNIVPFYQKTKINYICVGNEITMSGISDLIVNLVPAMKAIHA  139

Query  451  ALVKSGI  471
            AL  +GI
Sbjct  140  ALQAAGI  146



>ref|XP_002281025.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Vitis vinifera]
Length=444

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
            V SIGVNYGT+ DNL  P+EVA F+K+KT+ DR+KIFD NPDI+ AFA TGI +TVTV N
Sbjct  21   VYSIGVNYGTVADNLASPSEVAAFIKDKTIFDRVKIFDTNPDIINAFANTGIGLTVTVVN  80

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
             +I  L     A  WVA NI PFY  TKIN I VGNE+   G  ++   LV AM++++ A
Sbjct  81   LDIPKLVHPNEATNWVATNIVPFYQKTKINYICVGNEITMSGISDLIVNLVPAMKAIHAA  140

Query  454  LVKSGI  471
            L  +GI
Sbjct  141  LQAAGI  146



>ref|XP_008234701.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Prunus mume]
Length=468

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  234
            L  LVS F+      SIGVNYGT+ ++LPPPT VA FL E T+I+R+++FD NPDIL+AF
Sbjct  16   LLLLVSIFIQGGVQGSIGVNYGTVANDLPPPTHVAHFLLESTIINRVRLFDANPDILQAF  75

Query  235  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
            A TGI VT+TVPN +I  L    +A QW+ +N++P+  AT I  I +GNEVL        
Sbjct  76   AHTGIAVTITVPNDQIPHLTKLSFAQQWLKSNVQPYVQATNIVRILIGNEVLSTTNKLFI  135

Query  415  NGLVAAMRSLYNALVKSGI  471
             GLV AM++L+ ALV + +
Sbjct  136  AGLVPAMQTLHAALVDASL  154



>ref|XP_007016411.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY34030.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=497

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 91/145 (63%), Gaps = 3/145 (2%)
 Frame = +1

Query  31   SLRPSPIFLFFLVSAFLF---IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKI  201
            +L  + +F  F     +F        SIGVNYGT+ DNLPPP +VA FLK KT IDR+KI
Sbjct  3    TLSATKLFFLFTFHVTIFSSTTTAAYSIGVNYGTVADNLPPPPQVANFLKTKTNIDRVKI  62

Query  202  FDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGN  381
            FD NPDIL+AFA TGI VTVTV NG+I  L     A  W+A NI P +P T I  IAVGN
Sbjct  63   FDANPDILKAFANTGISVTVTVGNGDIPSLAKLPGAQSWIADNILPHHPQTIIRYIAVGN  122

Query  382  EVLHWGTPEMQNGLVAAMRSLYNAL  456
            E+L      +   L+ AM++L +AL
Sbjct  123  EILATSDKSLIAHLLPAMKALRSAL  147



>ref|XP_011025078.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=491

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  234
            +  L SAF  +    SIGVNYGT+ DNLPPP +VA FL E T+I+R+++FD N +I++AF
Sbjct  47   ILLLASAFNILGVEGSIGVNYGTVADNLPPPAQVAHFLLESTIINRVRLFDTNTEIIQAF  106

Query  235  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
            A TGI +TVTVPN +I  L   G+A +WV +N++P+ PAT I  I VGNEV+        
Sbjct  107  AHTGIAITVTVPNDQIPHLTKLGFAQEWVRSNVQPYVPATNIVRILVGNEVISNENKLFV  166

Query  415  NGLVAAMRSLYNALVKSGI  471
              LV AM++L+ ALV + +
Sbjct  167  ASLVPAMKALHTALVGASL  185



>ref|XP_006411190.1| hypothetical protein EUTSA_v10017897mg [Eutrema salsugineum]
 gb|ESQ52643.1| hypothetical protein EUTSA_v10017897mg [Eutrema salsugineum]
Length=553

 Score =   133 bits (334),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 76/140 (54%), Positives = 94/140 (67%), Gaps = 4/140 (3%)
 Frame = +1

Query  58   FFLVSAFLF-IHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
              LVSA +F +  V S +G+NYGTLG NLPPP +V  F+K KT+ D +KIFD NPDILRA
Sbjct  13   LLLVSAVIFQLSAVTSAVGINYGTLG-NLPPPQQVVDFIKTKTIFDSVKIFDANPDILRA  71

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
             AG+GI VT+TVPNG I  L +   A QWVAAN+ PF+  T I  I VGNE+L      +
Sbjct  72   LAGSGIHVTITVPNGNIPALANLENARQWVAANVLPFHQTT-IKYICVGNEILLTKDMNL  130

Query  412  QNGLVAAMRSLYNALVKSGI  471
             + LV AM+SL  AL  SG+
Sbjct  131  ISNLVPAMQSLTEALKASGL  150



>ref|XP_002526252.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF36121.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=476

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 98/151 (65%), Gaps = 6/151 (4%)
 Frame = +1

Query  37   RPSPIFLFFLVSAFLFIHGV------RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            R S      +V+A LF+          ++GVNYGT+ +NLPPP +VA FL E T+I+R++
Sbjct  3    RESAALYASMVTAILFLQSTIIPGAEGTLGVNYGTVANNLPPPAQVANFLVESTIINRVR  62

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  378
            +FD N +IL+AFA TGI VTVTVPN +I  L    +A QWV +NI+P+ PAT I  I VG
Sbjct  63   LFDTNREILQAFAHTGIEVTVTVPNDQIPRLTKLNFAQQWVKSNIQPYVPATNIIRILVG  122

Query  379  NEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            NEV+      +  GLV AM++L+ ALV + +
Sbjct  123  NEVISTANKMLIAGLVPAMQTLHTALVGASL  153



>ref|XP_007157802.1| hypothetical protein PHAVU_002G099500g [Phaseolus vulgaris]
 gb|ESW29796.1| hypothetical protein PHAVU_002G099500g [Phaseolus vulgaris]
Length=507

 Score =   132 bits (332),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 84/126 (67%), Gaps = 0/126 (0%)
 Frame = +1

Query  79   LFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  258
            L+      IGVNYGT+ DNLPPP+ VA F+K +T IDR+K+FD NPD+LRAFAGTGI +T
Sbjct  24   LYASYTTKIGVNYGTVADNLPPPSTVAAFIKSQTTIDRVKLFDANPDMLRAFAGTGISIT  83

Query  259  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMR  438
            VTVPN  I  L     A  W++ NI PF P T +  IAVGNEVL      +   ++  M+
Sbjct  84   VTVPNAAIPSLSTLPAAQAWLSENILPFLPQTAVTRIAVGNEVLATSDKTLIAHILPTMK  143

Query  439  SLYNAL  456
            SL++AL
Sbjct  144  SLHDAL  149



>gb|EMT11580.1| Glucan endo-1,3-beta-glucosidase [Aegilops tauschii]
Length=552

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 92/140 (66%), Gaps = 5/140 (4%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            +   FLV A L      +IGVNYGT GDNLP P +VA FL  +T IDR+K+FD NPDI+R
Sbjct  16   VMCIFLVIAPLST----AIGVNYGTKGDNLPSPAKVA-FLVTRTNIDRVKLFDTNPDIVR  70

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AFAGTGI V VT  NG+I  L     A  WVA NI P+YPAT I+++AVGNE++      
Sbjct  71   AFAGTGISVMVTAGNGDIPGLATQTGADSWVATNIAPYYPATDISLVAVGNEIMDTADKN  130

Query  409  MQNGLVAAMRSLYNALVKSG  468
            +   LV AM++L  ALV +G
Sbjct  131  LIGNLVPAMQTLKAALVTAG  150



>ref|XP_002298356.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE83161.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=457

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            ++GVNYGT+ +NLP P++VA FLK +T IDR+KIFD NPDILRAFA TGI VTVTV NG+
Sbjct  26   TVGVNYGTVANNLPSPSQVASFLKTQTTIDRVKIFDTNPDILRAFANTGISVTVTVGNGD  85

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            I  L     A  W+AANI PF+P T I  IAVGNEVL      +    + AM++L +AL
Sbjct  86   IPSLAKLPAAQSWIAANILPFHPQTSIKYIAVGNEVLATSDKVLIAHTLPAMKALTSAL  144



>ref|XP_009620579.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
[Nicotiana tomentosiformis]
Length=365

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  282
            IGVNYG + DNL PPT+V  F++++T I++IKIFD NP+I+ AFA TGI +T+TVPNG I
Sbjct  28   IGVNYGXVTDNLLPPTQVTAFIRDQTTINKIKIFDANPEIIHAFANTGIWLTITVPNGNI  87

Query  283  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  462
            + +  +  A  WV  N+ P+YP TKI+ I VGNEV+      +   LV AM++++ AL++
Sbjct  88   LSVSKSAGATTWVNENVVPYYPHTKIDRICVGNEVIATSDKNLIAHLVPAMKAIHEALLQ  147

Query  463  SGI  471
            +GI
Sbjct  148  AGI  150



>gb|KFK27709.1| hypothetical protein AALP_AA8G419000, partial [Arabis alpina]
Length=441

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD NP IL++FA TGI VTVT+PN +
Sbjct  11   SIGVNYGTLANNLPPPHQVAEFLLHSTVINRIRLFDANPQILQSFANTGIAVTVTIPNNQ  70

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +  ++ QW++ +I P +P+T I  I VGNEV+  G   +   L+ AM+SL+ ALV
Sbjct  71   IPLLTNLTFSQQWISHHINPHFPSTNIIRILVGNEVISTGNHLLIRSLIPAMQSLHTALV  130

Query  460  KSGI  471
             + +
Sbjct  131  SASL  134



>ref|XP_010519454.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Tarenaya 
hassleriana]
Length=486

 Score =   131 bits (329),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = +1

Query  82   FIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  258
            F+ GV  SIGVNYGTL +NL PP +VA FL   TVI+R+++FD +P ILR+F+GTGI  +
Sbjct  29   FVSGVEASIGVNYGTLANNLQPPRQVAEFLLRSTVINRVRLFDTDPQILRSFSGTGIATS  88

Query  259  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMR  438
            VTVPN  I  L +  +A QW++ +I+PF+P+T I  I VGNEVL  G   +   LV AM+
Sbjct  89   VTVPNDLIPNLTNLSFAQQWLSLSIQPFFPSTNIVRILVGNEVLSTGNRLLIGNLVPAMQ  148

Query  439  SLYNAL  456
            SL+ AL
Sbjct  149  SLHTAL  154



>ref|XP_011044676.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Populus 
euphratica]
 ref|XP_011044677.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Populus 
euphratica]
 ref|XP_011044678.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Populus 
euphratica]
Length=398

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  61   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  237
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  238  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  417
             TGI VTVTV N +I  L + G+A +W+ +N++P    T I  I VGNEV+      +  
Sbjct  91   HTGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNEVISTANKLLIA  150

Query  418  GLVAAMRSLYNALVKSGI  471
             LV AM++L+ ALV + +
Sbjct  151  SLVPAMQTLHTALVGASL  168



>ref|XP_011044679.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Populus 
euphratica]
Length=393

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +1

Query  61   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  237
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  238  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  417
             TGI VTVTV N +I  L + G+A +W+ +N++P    T I  I VGNEV+      +  
Sbjct  91   HTGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNEVISTANKLLIA  150

Query  418  GLVAAMRSLYNALVKSGI  471
             LV AM++L+ ALV + +
Sbjct  151  SLVPAMQTLHTALVGASL  168



>ref|NP_001119271.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AED93291.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=452

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TGI VTVTVPN +
Sbjct  29   SIGVNYGTLANNLPPPQQVAEFLLHSTVINRIRLFDTDPQILQAFANTGIAVTVTVPNDQ  88

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +   A QW++ +I+P +P+T I  I VGNEV+      +   L+ AM+SL+ ALV
Sbjct  89   IPHLTNLSSAKQWISDHIQPHFPSTNIIRILVGNEVISTADHLLIRTLIPAMQSLHTALV  148

Query  460  KSGI  471
             + +
Sbjct  149  SASL  152



>ref|XP_002532848.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF29526.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=488

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            ++GVNYGT+ +NLPPP++VA FLK +T I+ IKIFD NPDILRAFA TGI VTVTV NG+
Sbjct  24   TVGVNYGTVANNLPPPSQVAAFLKSQTTINSIKIFDANPDILRAFANTGISVTVTVGNGD  83

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            I  L     A  W+++NI PFYP T I  IAVGNE+L      +    + AM++L +AL
Sbjct  84   IPSLSKLDAAKSWISSNILPFYPQTLIKYIAVGNEILATADKNLIAHTLPAMKALKSAL  142



>gb|KJB23726.1| hypothetical protein B456_004G111800 [Gossypium raimondii]
Length=380

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 95/152 (63%), Gaps = 3/152 (2%)
 Frame = +1

Query  19   IMEMSLRPSPIFLFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  195
            I  +S R   +  FFL  A   + G   +IGVNYGT+ +NLPPP +VA FL E TVI+R+
Sbjct  6    ISMLSSRLVAVISFFL--ALTLVKGFEGTIGVNYGTVANNLPPPAQVAHFLLESTVINRV  63

Query  196  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  375
            ++FD NP+ILRAFA TG+ VT++VPN +I  L    +A QWV   I+P  PAT I  I V
Sbjct  64   RLFDANPEILRAFAHTGVAVTISVPNDQIPDLTKLNFAQQWVEDYIQPHTPATNIVRILV  123

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            GNEV+      +   LV AM +L  ALV + +
Sbjct  124  GNEVISTANKLLIVSLVTAMETLQTALVAASL  155



>ref|XP_011015294.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=496

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 90/144 (63%), Gaps = 4/144 (3%)
 Frame = +1

Query  37   RPSPIFLFFLVSAFLFIH----GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIF  204
            +P  +FL      + F         ++GVNYGT+ +NLP P++VA FLK +T IDR+KIF
Sbjct  3    KPRTLFLLLFTFYYHFSSSSSSAAYTVGVNYGTVANNLPSPSQVASFLKTQTTIDRVKIF  62

Query  205  DVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNE  384
            D N DILRAFA TGI VTVTV NG+I  L     A  W+AANI PF+P T I  IAVGNE
Sbjct  63   DTNQDILRAFANTGISVTVTVGNGDIPSLAKLPAAQSWIAANILPFHPQTSIKYIAVGNE  122

Query  385  VLHWGTPEMQNGLVAAMRSLYNAL  456
            VL      +    + AM++L +AL
Sbjct  123  VLATSDKVLIAHTLPAMKALTSAL  146



>gb|KDP35193.1| hypothetical protein JCGZ_09352 [Jatropha curcas]
Length=478

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 93/136 (68%), Gaps = 0/136 (0%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  234
            ++FL S  LF     ++GVNYGTL +NLPPP +VA FL + T+I+R+K+FD N +IL+AF
Sbjct  17   IWFLESTLLFQGVEATLGVNYGTLANNLPPPAKVADFLVQSTIINRVKLFDTNTEILQAF  76

Query  235  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
            A TGI VTVTVP+ +I  L    ++ +W+ +NI+P+ PAT I  I VGNEVL      + 
Sbjct  77   AHTGIAVTVTVPDDQIPHLTKLNFSQEWLKSNIQPYIPATNIIRILVGNEVLSTANKLLI  136

Query  415  NGLVAAMRSLYNALVK  462
              LV AM++L+ ALV 
Sbjct  137  ASLVPAMQTLHTALVS  152



>ref|NP_001031936.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AED93290.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=458

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TGI VTVTVPN +
Sbjct  29   SIGVNYGTLANNLPPPQQVAEFLLHSTVINRIRLFDTDPQILQAFANTGIAVTVTVPNDQ  88

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +   A QW++ +I+P +P+T I  I VGNEV+      +   L+ AM+SL+ ALV
Sbjct  89   IPHLTNLSSAKQWISDHIQPHFPSTNIIRILVGNEVISTADHLLIRTLIPAMQSLHTALV  148

Query  460  KSGI  471
             + +
Sbjct  149  SASL  152



>ref|XP_002459582.1| hypothetical protein SORBIDRAFT_02g007050 [Sorghum bicolor]
 gb|EER96103.1| hypothetical protein SORBIDRAFT_02g007050 [Sorghum bicolor]
Length=545

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            +IGVNYGT GDNLPPP  VA FL  +T IDR+K+FD NPD++RAFAGTGI + VT  NG+
Sbjct  33   AIGVNYGTKGDNLPPPATVASFLANRTRIDRVKLFDTNPDMVRAFAGTGIALMVTAGNGD  92

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  435
            I  L     AA WV+AN+ P+YP T I+++ VGNE++  G   + + LV AM
Sbjct  93   IPKLATKDGAAAWVSANVAPYYPKTDISLVLVGNEIMDTGDASLISNLVPAM  144



>ref|XP_010662898.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
 emb|CBI23036.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 96/134 (72%), Gaps = 4/134 (3%)
 Frame = +1

Query  64   LVSAFLFIHGV--RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  237
            L+ A +F  GV   +IGVNYGT+ ++LPPP+EVARFL E T I+R+++FD +P++++AFA
Sbjct  9    LLLASVFFQGVVEGNIGVNYGTVANDLPPPSEVARFLLESTTINRVRMFDADPEMIQAFA  68

Query  238  GTGILVTVTVPNGEIIP-LKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
             TGI VTVTVPN E+IP L    +A QWV  N++P+ PAT +  I VGNEVL      + 
Sbjct  69   HTGIAVTVTVPN-ELIPRLTKLSFAQQWVKTNVQPYVPATNLIRILVGNEVLSTANKLLI  127

Query  415  NGLVAAMRSLYNAL  456
             GLV AM++L+ AL
Sbjct  128  AGLVPAMQTLHTAL  141



>gb|EAZ03332.1| hypothetical protein OsI_25474 [Oryza sativa Indica Group]
Length=501

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 93/130 (72%), Gaps = 0/130 (0%)
 Frame = +1

Query  79   LFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  258
            + +    +IGVNYGT GDNLPPP  VA+FL  +T IDR+K+FD NPDI++AFAGTGI V 
Sbjct  21   ILLPSAAAIGVNYGTKGDNLPPPATVAKFLANRTRIDRVKLFDTNPDIVKAFAGTGITVM  80

Query  259  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMR  438
            VT  NG+I  L     AA WVAANI P+YPAT I+++AVGNE+++     +  GLV AMR
Sbjct  81   VTAGNGDIPTLGTKDGAAAWVAANIAPYYPATDISLVAVGNEIINTADNALIGGLVPAMR  140

Query  439  SLYNALVKSG  468
            +L  ALV +G
Sbjct  141  TLRAALVAAG  150



>ref|XP_002874188.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50447.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
Length=443

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TGI +TVTVPN +
Sbjct  15   SIGVNYGTLANNLPPPQQVAEFLLHSTVINRIRLFDTDPHILQAFANTGIAITVTVPNDQ  74

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +   A QW++  I+P +P+T I  I VGNEV+      +   L+ AM+SL+ ALV
Sbjct  75   IPHLTNLSSAKQWISDQIQPHFPSTNIIRILVGNEVISTANHLLIRTLIPAMQSLHTALV  134

Query  460  KSGI  471
             + +
Sbjct  135  STSL  138



>ref|XP_010421258.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Camelina 
sativa]
Length=453

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 98/159 (62%), Gaps = 3/159 (2%)
 Frame = +1

Query  4    NLILKIMEMSLRPSPIFLFFLVSAFLFI---HGVRSIGVNYGTLGDNLPPPTEVARFLKE  174
            N +L  +  S   S + +F LV   +         SIGVNYGTL +NLPPP +VA FL  
Sbjct  2    NYVLPFLYFSSFTSSVSMFNLVGLLIICLTGGAEASIGVNYGTLANNLPPPHQVAEFLLH  61

Query  175  KTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPAT  354
             TVI+R+++FD +P IL+AFA TGI VTVTVPN ++  L +   A +W++  I+P YP+T
Sbjct  62   STVINRVRLFDADPQILQAFANTGIAVTVTVPNDQVPHLTNLTSAQKWISDQIQPHYPST  121

Query  355  KINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
             I  I VGNEV+      +   LV AM+SL+ ALV + +
Sbjct  122  NIIRILVGNEVISTANHLLIRTLVPAMQSLHTALVSASL  160



>ref|XP_010267530.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=455

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
            L  L++A L + GV+ +IGVNYGT+ +NLPPP EVA FL E+T I+R+++FD NP IL+A
Sbjct  16   LLLLIAATL-VGGVQGTIGVNYGTIANNLPPPAEVAHFLLEETTINRVRLFDANPAILQA  74

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA TGI VT+TVPN +I  L    +A  WV +N+ P+ P+T I  I VGNEVL      +
Sbjct  75   FAHTGIAVTITVPNQQIPDLTKLSFAQHWVKSNVLPYTPSTNIIRILVGNEVLSTANKLL  134

Query  412  QNGLVAAMRSLYNALV  459
               LV AM++L+ ALV
Sbjct  135  IASLVPAMQNLHTALV  150



>ref|NP_001059262.1| Os07g0240200 [Oryza sativa Japonica Group]
 dbj|BAC83528.1| putative glucan endo-1,3-beta-glucosidase precursor [Oryza sativa 
Japonica Group]
 dbj|BAF21176.1| Os07g0240200 [Oryza sativa Japonica Group]
 gb|EAZ39236.1| hypothetical protein OsJ_23659 [Oryza sativa Japonica Group]
 dbj|BAG91193.1| unnamed protein product [Oryza sativa Japonica Group]
Length=501

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 93/130 (72%), Gaps = 0/130 (0%)
 Frame = +1

Query  79   LFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  258
            + +    +IGVNYGT GDNLPPP  VA+FL  +T IDR+K+FD NPDI++AFAGTGI V 
Sbjct  21   ILLPSAAAIGVNYGTKGDNLPPPATVAKFLANRTRIDRVKLFDTNPDIVKAFAGTGITVM  80

Query  259  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMR  438
            VT  NG+I  L     AA WVAANI P+YPAT I+++AVGNE+++     +  GLV AMR
Sbjct  81   VTAGNGDIPTLGTKDGAAAWVAANIAPYYPATDISLVAVGNEIINTADNALIGGLVPAMR  140

Query  439  SLYNALVKSG  468
            +L  ALV +G
Sbjct  141  TLRAALVAAG  150



>emb|CDX87130.1| BnaC09g04450D [Brassica napus]
Length=465

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TG+ VTVTV N +
Sbjct  33   SIGVNYGTLANNLPPPRQVAEFLLHSTVINRIRLFDADPQILQAFAHTGVAVTVTVSNDQ  92

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +  +A +W++ +I+P +P+T I  I VGNEV+  G   +   LV AM+SL+ ALV
Sbjct  93   IPHLTNLSFAQRWISDHIQPHFPSTNIIRILVGNEVISTGNHLLIRNLVPAMQSLHTALV  152

Query  460  KSGI  471
             + +
Sbjct  153  SASL  156



>ref|XP_010519453.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Tarenaya 
hassleriana]
Length=532

 Score =   129 bits (324),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 64/119 (54%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL +NL PP +VA FL   TVI+R+++FD +P ILR+F+GTGI  +VTVPN  
Sbjct  82   SIGVNYGTLANNLQPPRQVAEFLLRSTVINRVRLFDTDPQILRSFSGTGIATSVTVPNDL  141

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            I  L +  +A QW++ +I+PF+P+T I  I VGNEVL  G   +   LV AM+SL+ AL
Sbjct  142  IPNLTNLSFAQQWLSLSIQPFFPSTNIVRILVGNEVLSTGNRLLIGNLVPAMQSLHTAL  200



>ref|XP_010109237.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXC21417.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=478

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 90/139 (65%), Gaps = 0/139 (0%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  234
            L  LV +     G  +IGVNYGT+ DNLPPP+EVA FL E T I+R+++FD +PDILRAF
Sbjct  20   LSLLVISTFLQGGHGAIGVNYGTVADNLPPPSEVAHFLVESTTINRVRLFDADPDILRAF  79

Query  235  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
            A TGI VTVTVPN +I  L     A +W+  N++P  PAT I  I VGNEVL      + 
Sbjct  80   AHTGITVTVTVPNDQIPRLTKLPAAHEWLKTNVQPHVPATNIVRILVGNEVLSTANKLLI  139

Query  415  NGLVAAMRSLYNALVKSGI  471
              LV A+++L  +LV  G+
Sbjct  140  ASLVPALQALQASLVDLGL  158



>ref|XP_011046747.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Populus 
euphratica]
 ref|XP_011046748.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Populus 
euphratica]
Length=398

 Score =   128 bits (321),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  61   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  237
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  238  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  417
              GI VTVTV N +I  L + G+A +W+ +N++P    T I  I VGNEV+      +  
Sbjct  91   HKGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNEVISTANKLLIA  150

Query  418  GLVAAMRSLYNALVKSGI  471
             LV AM++L+ ALV + +
Sbjct  151  SLVPAMQTLHTALVGASL  168



>ref|XP_010318035.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Solanum lycopersicum]
Length=378

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  79   LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  255
            +F+ GV  +IGVNYGT+ DNLPPP +VA FL+E T I R+++FD NP+IL+AFA TGI V
Sbjct  23   IFLQGVEGTIGVNYGTVADNLPPPVQVASFLRESTFIRRVRLFDANPEILKAFANTGISV  82

Query  256  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  435
            TV VPN  I  L    +A QWV  N+ P+ PAT I  I VGNEV+      +   LV AM
Sbjct  83   TVNVPNDLIPQLTMLSFAQQWVEINVLPYVPATNIVRILVGNEVISTANKLLIVSLVPAM  142

Query  436  RSLYNALVKSGI  471
             +L+  LV+  +
Sbjct  143  ETLHAVLVEKSL  154



>ref|XP_011046750.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Populus 
euphratica]
Length=393

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +1

Query  61   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  237
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  238  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQN  417
              GI VTVTV N +I  L + G+A +W+ +N++P    T I  I VGNEV+      +  
Sbjct  91   HKGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNEVISTANKLLIA  150

Query  418  GLVAAMRSLYNALVKSGI  471
             LV AM++L+ ALV + +
Sbjct  151  SLVPAMQTLHTALVGASL  168



>ref|XP_006295997.1| hypothetical protein CARUB_v10025141mg [Capsella rubella]
 gb|EOA28895.1| hypothetical protein CARUB_v10025141mg [Capsella rubella]
Length=540

 Score =   129 bits (323),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 73/152 (48%), Positives = 94/152 (62%), Gaps = 3/152 (2%)
 Frame = +1

Query  22   MEMSLRPSPIFLFFLVSAFLF-IHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  195
            M  + R S +    +V+A +F +  V S IG+NYGTLG NL PP +V  F+K KT +D +
Sbjct  1    MAKTTRCSTLPFLPIVAAMIFQLSAVTSAIGINYGTLG-NLQPPQQVVDFIKTKTKLDSV  59

Query  196  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  375
            KIFD NPDILR  AGT I VT+ VPNG I  + D   A QWVAAN+ PF+   K   + V
Sbjct  60   KIFDANPDILRGLAGTEISVTIMVPNGNIPAMVDVANARQWVAANVLPFHQQIKFKYLCV  119

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            GNE+L      + + LV AM+SL  AL  SG+
Sbjct  120  GNEILVSKDNNLISNLVPAMKSLNEALKASGL  151



>ref|XP_010421259.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   127 bits (320),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL +NLPPP +VA FL   TVI+R+++FD +P IL+AFA TGI VTVTVPN +
Sbjct  19   SIGVNYGTLANNLPPPHQVAEFLLHSTVINRVRLFDADPQILQAFANTGIAVTVTVPNDQ  78

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            +  L +   A +W++  I+P YP+T I  I VGNEV+      +   LV AM+SL+ ALV
Sbjct  79   VPHLTNLTSAQKWISDQIQPHYPSTNIIRILVGNEVISTANHLLIRTLVPAMQSLHTALV  138

Query  460  KSGI  471
             + +
Sbjct  139  SASL  142



>ref|XP_009799239.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=386

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 91/146 (62%), Gaps = 7/146 (5%)
 Frame = +1

Query  55   LFFLVSAFLFI------HGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  213
            L  L+ A LF+       GV  +IG+NYGT+ DNLPPP +VARFL E T I R+++FD N
Sbjct  9    LVHLLGALLFVLTPILTQGVEGTIGINYGTVADNLPPPVQVARFLLESTFISRVRLFDAN  68

Query  214  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLH  393
            P+IL+AFA TGI VTV VPN  I  L    +A QWV  N+ P  PAT I  I VGNEV+ 
Sbjct  69   PEILKAFARTGIAVTVNVPNDLIPHLLKLSFARQWVEYNVLPHVPATNIVRILVGNEVIS  128

Query  394  WGTPEMQNGLVAAMRSLYNALVKSGI  471
                 +   LV AM +L+ A+V+  +
Sbjct  129  TANKLLIGSLVPAMETLHAAIVERSL  154



>ref|XP_010493578.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Camelina sativa]
Length=457

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 96/156 (62%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    NLILKIMEMSLRPSPIFLFFLVSAFLFI---HGVRSIGVNYGTLGDNLPPPTEVARFLKE  174
            N +L  +  S   S + +F LV   +         SIGVNYGTL +NLPPP +VA FL  
Sbjct  2    NYVLPFLYFSSFTSSVSMFNLVGLLIICLTGGADASIGVNYGTLANNLPPPHQVAEFLLH  61

Query  175  KTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPAT  354
             TVI+R+++FD +P IL+AFA TGI VTVTVPN +I  L +   A +W++  I+P +P+T
Sbjct  62   STVINRVRLFDADPQILQAFANTGIAVTVTVPNDQIPHLTNLTSAQKWISDQIQPHFPST  121

Query  355  KINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  462
             I  I VGNEV+      +   LV AM+SL+ ALV 
Sbjct  122  NIIRILVGNEVISTANHLLIRTLVPAMQSLHTALVS  157



>ref|XP_010685761.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Beta vulgaris 
subsp. vulgaris]
Length=454

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  282
            IG NYG + DNLPPP+ VA+FL  +T +  +K+FD +P IL+AFA TGI +TV +PN ++
Sbjct  29   IGANYGRVADNLPPPSSVAKFLTSQTTLTSVKLFDCDPQILQAFANTGISLTVNIPNSDV  88

Query  283  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  462
            IPL D   A  WVA +I P++P T I  IAVGNE+   G  ++ +  V +M+SL+ AL  
Sbjct  89   IPLSDPTNAQSWVATHILPYHPQTIIRYIAVGNEIHFSGDKQLISNAVNSMKSLHQALKS  148

Query  463  SGI  471
            + +
Sbjct  149  ANL  151



>ref|XP_006658422.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Oryza brachyantha]
Length=471

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  282
            IGVNYGT GDNLPPP  VA FL  +T IDR+K+FD NPDI++AFAGTGI V VT  NG+I
Sbjct  34   IGVNYGTKGDNLPPPATVAAFLANRTRIDRVKLFDTNPDIVKAFAGTGITVMVTAGNGDI  93

Query  283  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALVK  462
              L     AA WVAANI P+YPAT I+++AVGNE+++     + +GLV AMR+L  ALV 
Sbjct  94   PTLGTKDGAAAWVAANIAPYYPATDISLVAVGNEIINTADNGLISGLVPAMRTLRAALVA  153

Query  463  SG  468
            +G
Sbjct  154  AG  155



>ref|XP_004505325.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Cicer 
arietinum]
Length=492

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 81/126 (64%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
              +IGVNYGT+ DNLPPP+ VA FLK +T I+ IK++D NPDILRAFA TGI VTVT  N
Sbjct  21   TNTIGVNYGTVADNLPPPSTVATFLKSQTTINHIKLYDANPDILRAFANTGISVTVTAAN  80

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L     A  W+  NI P++P T  N IAVGNE++      +   L+ AM +L  A
Sbjct  81   GDIPSLSKLPSAKSWITTNILPYHPKTIFNRIAVGNEIIATSDKNLIAHLLPAMEALQKA  140

Query  454  LVKSGI  471
            L  S +
Sbjct  141  LTLSNL  146



>ref|XP_004505326.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Cicer 
arietinum]
Length=495

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 81/126 (64%), Gaps = 0/126 (0%)
 Frame = +1

Query  94   VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  273
              +IGVNYGT+ DNLPPP+ VA FLK +T I+ IK++D NPDILRAFA TGI VTVT  N
Sbjct  21   TNTIGVNYGTVADNLPPPSTVATFLKSQTTINHIKLYDANPDILRAFANTGISVTVTAAN  80

Query  274  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNA  453
            G+I  L     A  W+  NI P++P T  N IAVGNE++      +   L+ AM +L  A
Sbjct  81   GDIPSLSKLPSAKSWITTNILPYHPKTIFNRIAVGNEIIATSDKNLIAHLLPAMEALQKA  140

Query  454  LVKSGI  471
            L  S +
Sbjct  141  LTLSNL  146



>ref|XP_006350517.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=382

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  79   LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  255
            +F+ GV  +IGVNYGT+ D+LPPP +VA FL++ T I R+++FD NP+IL+AFA TGI V
Sbjct  23   IFLQGVEGTIGVNYGTVADDLPPPVQVASFLRDSTFIRRVRLFDANPEILKAFARTGISV  82

Query  256  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  435
            TV VPN  I  L    +A QWV  N+ P+ PAT I  I VGNEV+      +   LV AM
Sbjct  83   TVNVPNDLIPQLTMLSFAQQWVEINVLPYVPATNIVRILVGNEVISTANKLLIVSLVPAM  142

Query  436  RSLYNALVKSGI  471
             +L  ALV+  +
Sbjct  143  ETLQAALVEKSL  154



>ref|XP_006287713.1| hypothetical protein CARUB_v10000922mg [Capsella rubella]
 gb|EOA20611.1| hypothetical protein CARUB_v10000922mg [Capsella rubella]
Length=459

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL +NLPPP +VA FL   T+I+RI++FD +P IL+AFA TGI VTVTVPN +
Sbjct  9    SIGVNYGTLANNLPPPQQVAEFLLRSTLINRIRLFDADPLILKAFANTGITVTVTVPNDQ  68

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +   A +W++ +I+P +P+T I  I VGNEV+      +   LV AM+SL+ ALV
Sbjct  69   IPHLTNLTSAQKWISDHIQPHFPSTNIIRILVGNEVISTADHLLIRTLVPAMQSLHTALV  128

Query  460  KSGI  471
             + +
Sbjct  129  SASL  132



>ref|XP_010535497.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Tarenaya hassleriana]
Length=372

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  282
            +GVNYGT+ DNLPPP +VA FLK KT I+ +KIFD +P+ILRAFAGTGI VTVTV N +I
Sbjct  29   VGVNYGTVADNLPPPQQVAGFLKTKTNINHVKIFDADPNILRAFAGTGISVTVTVANSDI  88

Query  283  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
              L     AA+W++ ++ PF P+  +  IAVGNEVL      +   L+ AM SL +AL
Sbjct  89   PSLCKLSAAARWLSDHVLPFLPSVSLRYIAVGNEVLATSDKNLVAHLLPAMESLTSAL  146



>ref|XP_004309121.2| PREDICTED: glucan endo-1,3-beta-glucosidase [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 96/146 (66%), Gaps = 2/146 (1%)
 Frame = +1

Query  37   RPSPIFLFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  213
            R S I L FL S F  + GV+ SIGVNYGT+ ++LPPP++VA FL + T+I+R+++FD N
Sbjct  57   RGSTIVLLFLASIF-NVQGVQGSIGVNYGTVANDLPPPSQVAHFLLQSTIINRVRLFDTN  115

Query  214  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLH  393
            P IL+AFA +GI +T+TVPN +I       +A  W+  N+ P+ PAT I  I +GNEVL 
Sbjct  116  PQILQAFAHSGIPLTITVPNDQIPHFTKLRFAQNWLNTNVIPYTPATNIVRILLGNEVLS  175

Query  394  WGTPEMQNGLVAAMRSLYNALVKSGI  471
                     LV AM++L+ ALV + +
Sbjct  176  TTNKLFIGNLVPAMQTLHMALVDASL  201



>ref|XP_002321390.2| hypothetical protein POPTR_0015s01240g [Populus trichocarpa]
 gb|EEF05517.2| hypothetical protein POPTR_0015s01240g [Populus trichocarpa]
Length=355

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            +IGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA TGI VTVTV N +
Sbjct  7    TIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFAHTGIAVTVTVTNDQ  66

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L + G+A +W+ +N++P    T I  I VGNEV+      +   LV AM++L+ ALV
Sbjct  67   IPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNEVISTANKLLIASLVPAMQALHAALV  126

Query  460  KSGI  471
             + +
Sbjct  127  DASL  130



>emb|CDY19838.1| BnaA09g04910D [Brassica napus]
Length=467

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++F+ +P IL+AFA TG+ VTVT+ N +
Sbjct  35   SIGVNYGTLANNLPPPRQVAEFLLHSTVINRIRLFNADPQILQAFAHTGVAVTVTISNDQ  94

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +  +A +W++ +I+P +P+T I  I VGNEV+      +   LV AM+SL+ ALV
Sbjct  95   IPHLTNLSFAQRWISDHIQPHFPSTNIIRILVGNEVISTANHLLIRNLVPAMQSLHTALV  154

Query  460  KSGI  471
             + +
Sbjct  155  SASL  158



>ref|XP_009111627.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Brassica rapa]
Length=470

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++F+ +P IL+AFA TG+ VTVT+ N +
Sbjct  38   SIGVNYGTLANNLPPPRQVAEFLLHSTVINRIRLFNADPQILQAFAHTGVAVTVTISNDQ  97

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNALV  459
            I  L +  +A +W++ +I+P +P+T I  I VGNEV+      +   LV AM+SL+ ALV
Sbjct  98   IPHLTNLSFAQRWISDHIQPHFPSTNIIRILVGNEVISTANHLLIRNLVPAMQSLHTALV  157

Query  460  KSGI  471
             + +
Sbjct  158  SASL  161



>ref|XP_003588492.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES58743.1| glycoside hydrolase family 17 protein [Medicago truncatula]
Length=363

 Score =   122 bits (306),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 90/137 (66%), Gaps = 3/137 (2%)
 Frame = +1

Query  61   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  240
            FL+ +F  + G   IGVNYGT+ +NLPPP++VA+FL   T+I++++IFD N +IL+AF  
Sbjct  5    FLLQSFTEVQG---IGVNYGTIANNLPPPSQVAKFLLHSTIINKVRIFDANQEILQAFEN  61

Query  241  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNG  420
            T I +T+T+PN +I  + +   A QWV  N++PF P+  I  I VGNEVL          
Sbjct  62   TRIEITITIPNDQIPNITNLTLAQQWVKTNVQPFIPSINIIRILVGNEVLSTANKLFITN  121

Query  421  LVAAMRSLYNALVKSGI  471
            LV AM++L+ AL+ + +
Sbjct  122  LVPAMQTLHTALITTSL  138



>ref|NP_001130652.1| uncharacterized protein LOC100191753 precursor [Zea mays]
 gb|ACF78958.1| unknown [Zea mays]
 gb|ACN34183.1| unknown [Zea mays]
 gb|AFW86789.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=407

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 100/154 (65%), Gaps = 9/154 (6%)
 Frame = +1

Query  31   SLRPSPIFLFFLVSAFL-----FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  195
            SL P+ + +  L+  FL     F+    ++G+NYG + +NLPPP +V + L     I ++
Sbjct  7    SLGPTALLICALLCTFLSSEVGFVRQATALGINYGQVANNLPPPAQVVQLLSSLR-IGKV  65

Query  196  KIFDVNPDILRAFAGTGILVTVTVPNGEIIP--LKDAGYAAQWVAANIKPFYPATKINII  369
            +I+DVNP +L AFAGTGI + VTVP+ +++P     A  A QWV+A+++P++PAT++  I
Sbjct  66   RIYDVNPQVLTAFAGTGIELVVTVPD-DLVPGMASSASQALQWVSASLRPYFPATRVTGI  124

Query  370  AVGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            AVGNEV      +++  LV AMR+L+ AL + G+
Sbjct  125  AVGNEVFTGDDEQLKASLVPAMRNLHAALAQLGM  158



>ref|XP_011075984.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Sesamum indicum]
Length=396

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  79   LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  255
             F+ GV+ SIGVNYGT  DNLPPP++VARFL + TVI R+++FD + + LRAFAGTGI +
Sbjct  31   FFLFGVKGSIGVNYGTEADNLPPPSKVARFLLDSTVIRRVRVFDADREKLRAFAGTGIAI  90

Query  256  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  435
            T+T+PN +I  L +  +A +WV   + P   AT I  I VGNEVL      + + LV AM
Sbjct  91   TITIPNDQIPHLTNLTFAQEWVKDILLPHTRATNIVRILVGNEVLSTANKLLISNLVPAM  150

Query  436  RSLYNALVKSGI  471
             +L++AL    +
Sbjct  151  LTLHDALTSESL  162



>ref|XP_010063141.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Eucalyptus 
grandis]
 gb|KCW70332.1| hypothetical protein EUGRSUZ_F03575 [Eucalyptus grandis]
Length=465

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 92/130 (71%), Gaps = 3/130 (2%)
 Frame = +1

Query  88   HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTV  267
            HGV ++GVNYGT+G+NL PP +VA+ L + T+IDR+KI+D NPDIL AF+ TGI + V V
Sbjct  22   HGVSAVGVNYGTIGNNLLPPKKVAQLL-QSTLIDRVKIYDSNPDILDAFSNTGIDLVVAV  80

Query  268  PNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ-NGLVAAMRS  441
             N  +  L KD   AA+W+A+ + PF PAT +  +AVGNE L  G  +++ N +V AM++
Sbjct  81   ENPLVANLSKDPSAAAEWLASRVAPFLPATSVVSVAVGNEYLTSGDDKLEPNDVVQAMQN  140

Query  442  LYNALVKSGI  471
            L+ ALV  G+
Sbjct  141  LHAALVARGL  150



>ref|XP_008377317.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=459

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 96/152 (63%), Gaps = 3/152 (2%)
 Frame = +1

Query  22   MEMSLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            M  SL   PI L FL  +AFL       IGVNYG + DNLPPP+E A+ L + T I R++
Sbjct  1    MASSLSHFPILLLFLSFTAFLSADSQSFIGVNYGQVADNLPPPSETAKLL-QSTAIKRVR  59

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  375
            ++  +P I++A AG+GI + +   NG+I  L  D   AAQWV +N+ PFYPA+KI++I V
Sbjct  60   LYGADPAIIKALAGSGIAIAIGASNGDIPALASDPNAAAQWVNSNVLPFYPASKIDLINV  119

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            GNEVL      + + L+ AMR++ +AL  + +
Sbjct  120  GNEVLLSNDQGLISQLLPAMRNVLSALSAASL  151



>gb|EPS68882.1| hypothetical protein M569_05882 [Genlisea aurea]
Length=377

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 90/140 (64%), Gaps = 4/140 (3%)
 Frame = +1

Query  52   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  231
            FLFF     LF  G   +G+NYG +G+NLP P EV + L+    I + +I+D NP IL+A
Sbjct  4    FLFFSGYGGLFAEG---LGINYGQVGNNLPAPEEVLQLLR-SLKISKARIYDTNPQILKA  59

Query  232  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEM  411
            FA +G+ +TVTVPN  +  L D   A QWV  N+  ++PAT+I  IAVGNEV   G  E+
Sbjct  60   FADSGVEITVTVPNELLYALVDPVQALQWVKTNVGAYFPATRIAGIAVGNEVFSGGGTEL  119

Query  412  QNGLVAAMRSLYNALVKSGI  471
             + LV AM S++ ALV+SG+
Sbjct  120  LSHLVPAMMSIHGALVESGL  139



>ref|XP_009586622.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana tomentosiformis]
Length=385

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = +1

Query  79   LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  255
            + I GV  +IG++YGT+ D+LPPP +VARFL E T I R+++FD NP+IL+AFA TGI V
Sbjct  23   ILIQGVEGTIGIDYGTVADDLPPPVQVARFLLESTFIRRVRLFDANPEILKAFAHTGIAV  82

Query  256  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAM  435
            TV  PN  I  L    +A QWV  N+ P  PAT I  I VGNEV+      +   LV A 
Sbjct  83   TVNFPNDLIPHLTKLSFARQWVEINVLPHIPATNIVRILVGNEVISTANKLLIGNLVPAT  142

Query  436  RSLYNALVKSGI  471
             +L+ ALV+  +
Sbjct  143  ETLHAALVERSL  154



>ref|XP_008783886.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 
[Phoenix dactylifera]
Length=384

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 93/145 (64%), Gaps = 5/145 (3%)
 Frame = +1

Query  46   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  219
            PIFL F    S F F+    ++G+NYG + +NLPPP +V   L   + I + +I+D NP 
Sbjct  13   PIFLLFNLFYSEFGFLQLGSTLGINYGQVANNLPPPEQVVTLLNSLS-ITKTRIYDTNPQ  71

Query  220  ILRAFAGTGILVTVTVPNGEIIP-LKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
            +L AFA +GI + VTVPN E++P + D   A QWV  NIKP++PAT+I+ IAVGNEV   
Sbjct  72   VLTAFANSGIDLVVTVPN-EVVPQVTDPQQALQWVMTNIKPYFPATRISGIAVGNEVFTS  130

Query  397  GTPEMQNGLVAAMRSLYNALVKSGI  471
                + + LV AM SL+ ALV+ G+
Sbjct  131  DDTALASNLVPAMHSLHAALVQLGL  155



>gb|AES90042.2| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=531

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 80/130 (62%), Gaps = 0/130 (0%)
 Frame = +1

Query  82   FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  261
            F     +IGVNYGT+ +NLPPPT VA FLK +T I  IKIFD N  ILRAFA T I VTV
Sbjct  37   FSSATYNIGVNYGTIANNLPPPTTVATFLKTQTTITHIKIFDTNSSILRAFANTNISVTV  96

Query  262  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRS  441
            TV N +I  L     A +W+  NI PF+P T  N IAVGNE+L      +   ++ AM +
Sbjct  97   TVSNADIPSLTKLPSAQKWITTNILPFHPKTIFNRIAVGNEILATSDKTLIAHILPAMNA  156

Query  442  LYNALVKSGI  471
            L+ AL  S +
Sbjct  157  LHQALTLSNL  166



>ref|XP_009374190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=459

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 97/152 (64%), Gaps = 3/152 (2%)
 Frame = +1

Query  22   MEMSLRPSPIFLFFLV-SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            M  SL   PI L FL+ +AFL       IGVNYG + DNLPPP++ A+ L + T I RI+
Sbjct  1    MASSLSHLPILLVFLLFTAFLSADSQSFIGVNYGQVADNLPPPSDTAKLL-QSTAIKRIR  59

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  375
            +F  +P I++A AG+GI + +   NG++  L  D   AAQWV +N+ PFYPA+KI++I V
Sbjct  60   LFGSDPAIIKALAGSGIAIAIGAANGDLPALASDPNAAAQWVNSNVLPFYPASKIDLINV  119

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            GNEVL      + + L+ AMR++ +AL  + +
Sbjct  120  GNEVLLSNDQGLISQLLPAMRNVQSALSAASL  151



>gb|EMS59735.1| Glucan endo-1,3-beta-glucosidase 11 [Triticum urartu]
Length=419

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 94/153 (61%), Gaps = 7/153 (5%)
 Frame = +1

Query  31   SLRPSPIFLFFLVSAFLF-----IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  195
            S RP+ + L  L+   LF     +    +IG+NYG +G+NLP P +V   L    V  ++
Sbjct  7    STRPASLQLSALLCVLLFSEVWVLQCSAAIGINYGQVGNNLPTPAQVVSLLSSLRV-GKV  65

Query  196  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLK-DAGYAAQWVAANIKPFYPATKINIIA  372
            +I+DV P +L AFAGTGI + VTVPN  + P+   AG A QW  ANIKP++PAT++  IA
Sbjct  66   RIYDVTPQVLAAFAGTGIELIVTVPNDLVQPMAASAGQAMQWATANIKPYFPATRVTGIA  125

Query  373  VGNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            VGNEV       ++  LV AMR+L+ AL + G+
Sbjct  126  VGNEVFTDDDQALKASLVPAMRNLHAALAQLGM  158



>ref|XP_008783885.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 
[Phoenix dactylifera]
Length=397

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 93/145 (64%), Gaps = 5/145 (3%)
 Frame = +1

Query  46   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  219
            PIFL F    S F F+    ++G+NYG + +NLPPP +V   L   + I + +I+D NP 
Sbjct  13   PIFLLFNLFYSEFGFLQLGSTLGINYGQVANNLPPPEQVVTLLNSLS-ITKTRIYDTNPQ  71

Query  220  ILRAFAGTGILVTVTVPNGEIIP-LKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
            +L AFA +GI + VTVPN E++P + D   A QWV  NIKP++PAT+I+ IAVGNEV   
Sbjct  72   VLTAFANSGIDLVVTVPN-EVVPQVTDPQQALQWVMTNIKPYFPATRISGIAVGNEVFTS  130

Query  397  GTPEMQNGLVAAMRSLYNALVKSGI  471
                + + LV AM SL+ ALV+ G+
Sbjct  131  DDTALASNLVPAMHSLHAALVQLGL  155



>ref|NP_181494.1| glycosyl hydrolase-17 [Arabidopsis thaliana]
 gb|AAB97119.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM14919.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEC09701.1| glycosyl hydrolase-17 [Arabidopsis thaliana]
Length=549

 Score =   120 bits (302),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 66/141 (47%), Positives = 85/141 (60%), Gaps = 2/141 (1%)
 Frame = +1

Query  52   FLFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            FL  +      +  V S IG+NYGTLG NL PP +V  F+K KT  D +KI+D NPDILR
Sbjct  12   FLLIVAGVIFQLSAVTSAIGINYGTLG-NLQPPQQVVDFIKTKTTFDSVKIYDANPDILR  70

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AFAG+ I +T+ VPNG I  + +   A QWVAAN+ PF    K   + VGNE+L      
Sbjct  71   AFAGSEINITIMVPNGNIPAMVNVANARQWVAANVLPFQQQIKFKYVCVGNEILASNDNN  130

Query  409  MQNGLVAAMRSLYNALVKSGI  471
            + + LV AM+SL  AL  S +
Sbjct  131  LISNLVPAMQSLNEALKASNL  151



>ref|XP_003607845.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=512

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 80/130 (62%), Gaps = 0/130 (0%)
 Frame = +1

Query  82   FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  261
            F     +IGVNYGT+ +NLPPPT VA FLK +T I  IKIFD N  ILRAFA T I VTV
Sbjct  18   FSSATYNIGVNYGTIANNLPPPTTVATFLKTQTTITHIKIFDTNSSILRAFANTNISVTV  77

Query  262  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRS  441
            TV N +I  L     A +W+  NI PF+P T  N IAVGNE+L      +   ++ AM +
Sbjct  78   TVSNADIPSLTKLPSAQKWITTNILPFHPKTIFNRIAVGNEILATSDKTLIAHILPAMNA  137

Query  442  LYNALVKSGI  471
            L+ AL  S +
Sbjct  138  LHQALTLSNL  147



>gb|ABK24695.1| unknown [Picea sitchensis]
Length=485

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = +1

Query  64   LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  243
            LV          +IGVNYG +GDNLPPP+EVA+FL + T ID++K+FD +P +L+AFA T
Sbjct  14   LVLVLCIFFTAEAIGVNYGRMGDNLPPPSEVAKFL-QTTNIDKVKLFDADPSVLQAFADT  72

Query  244  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGL  423
             I V V V N EI  L     A  WV  N+ P+ PAT I  I+VGNE+L  G   + + L
Sbjct  73   NITVVVAVANDEIPALNKLPAAQDWVKKNVAPYVPATNIIAISVGNEILSTGNKVLISQL  132

Query  424  VAAMRSLYNALVKSGI  471
            + AM++L+ ALV + +
Sbjct  133  IPAMQNLHTALVGASL  148



>ref|XP_009374179.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Pyrus x bretschneideri]
Length=459

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 97/152 (64%), Gaps = 3/152 (2%)
 Frame = +1

Query  22   MEMSLRPSPIFLFFLV-SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            M  SL   PI L FL+ +AFL       IGVNYG + DNLPPP++ A+ L + T I R++
Sbjct  1    MASSLSHFPILLVFLLFTAFLSADSQSFIGVNYGQVADNLPPPSDTAKLL-QSTAIKRVR  59

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  375
            ++  +P I++A AG+GI + +   NG++  L  D   AAQWV +N+ PFYPA+KI++I V
Sbjct  60   LYGADPAIIKALAGSGIAIAIGAANGDLPALASDPNAAAQWVNSNVLPFYPASKIDLINV  119

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            GNEVL      + + L+ AMR++ +AL  + +
Sbjct  120  GNEVLLSNDQGLISQLLPAMRNVQSALSAASL  151



>ref|XP_006307574.1| hypothetical protein CARUB_v10009196mg [Capsella rubella]
 gb|EOA40472.1| hypothetical protein CARUB_v10009196mg [Capsella rubella]
Length=431

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +1

Query  22   MEMSL--RPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  195
            ME+++  R SPI    L   F+F   + SIGVNYG +GDNLPPP+EV   +K      ++
Sbjct  1    MELNIFHRSSPILFLLLSVTFIFPTAITSIGVNYGQIGDNLPPPSEVIPLIKSIGAT-KV  59

Query  196  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  375
            K++D NP IL+AFA TGI   V + N  +  +KD   A  W+  N+ PF PAT I  I +
Sbjct  60   KLYDANPQILKAFANTGIEFIVGLGNEYLSKMKDPSKALTWIKQNVTPFLPATNITCITI  119

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            GNE+L      +   L+ AM+ +++AL  +G+
Sbjct  120  GNEILALNDSSLTVNLLPAMQGVHSALTTAGL  151



>ref|XP_010671896.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Beta vulgaris subsp. 
vulgaris]
Length=359

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 1/130 (1%)
 Frame = +1

Query  85   IHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  261
            + G+ S IGVNYG   DNLPPP EVA+FL + T+I+ I++FD NPD L+AFA TGI +TV
Sbjct  5    VKGIESNIGVNYGMQADNLPPPNEVAKFLLDSTIINHIRLFDANPDTLQAFAHTGIAITV  64

Query  262  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRS  441
            T+PN  I    +  +A +W+  NI     +T I  I VGNEVL      +   LV  M++
Sbjct  65   TIPNDLIPQFTNFTFAQEWIKTNISSHVHSTNIKRILVGNEVLATTNKLLITNLVPTMQT  124

Query  442  LYNALVKSGI  471
            LY+ALV+  +
Sbjct  125  LYSALVEESL  134



>ref|XP_006827757.1| hypothetical protein AMTR_s00009p00263650 [Amborella trichopoda]
 gb|ERM95173.1| hypothetical protein AMTR_s00009p00263650 [Amborella trichopoda]
Length=468

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = +1

Query  43   SPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  222
            S + L F V+  +    + +IGVNYGT+ +NLPPPT+VA+FLKE T+I+ +K+F ++  I
Sbjct  14   SSLLLLFSVNCIMDTEAI-NIGVNYGTVANNLPPPTQVAKFLKENTLINHVKLFGIDHAI  72

Query  223  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGT  402
            ++AFA TGI +TV +PN +I  L+    A QW+  NI P+   TKI  I VGNEVLH   
Sbjct  73   IQAFANTGIALTVAIPNDQIPSLRRLAIARQWIQINILPYVYTTKIIRILVGNEVLHTND  132

Query  403  PEMQNGLVAAMRSLYNALVKSGI  471
              +   L+ AM++L+  L+ + +
Sbjct  133  ILLAANLIPAMQNLHAVLIGASL  155



>ref|XP_010925705.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 
[Elaeis guineensis]
Length=398

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 90/144 (63%), Gaps = 3/144 (2%)
 Frame = +1

Query  46   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  219
            PIFL F  L S F FI    ++G+NYG + +NLP P +V   L     I +I+I+D NP 
Sbjct  13   PIFLLFNLLSSEFGFIQLGSTLGINYGQVANNLPSPEQVLTLLTSLR-ISKIRIYDTNPQ  71

Query  220  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  399
            +L AFA +GI + VTVPN  +  + D   A QWV  NIKP++PATKI+ IAVGNEV    
Sbjct  72   VLTAFANSGIDLMVTVPNEVVAQVTDPRQALQWVMTNIKPYFPATKISGIAVGNEVFTSD  131

Query  400  TPEMQNGLVAAMRSLYNALVKSGI  471
               + + LV AM S++ ALV+ G+
Sbjct  132  DMALMSNLVPAMVSIHAALVQLGL  155



>ref|XP_010925707.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 
[Elaeis guineensis]
Length=385

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 90/144 (63%), Gaps = 3/144 (2%)
 Frame = +1

Query  46   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  219
            PIFL F  L S F FI    ++G+NYG + +NLP P +V   L     I +I+I+D NP 
Sbjct  13   PIFLLFNLLSSEFGFIQLGSTLGINYGQVANNLPSPEQVLTLLTSLR-ISKIRIYDTNPQ  71

Query  220  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWG  399
            +L AFA +GI + VTVPN  +  + D   A QWV  NIKP++PATKI+ IAVGNEV    
Sbjct  72   VLTAFANSGIDLMVTVPNEVVAQVTDPRQALQWVMTNIKPYFPATKISGIAVGNEVFTSD  131

Query  400  TPEMQNGLVAAMRSLYNALVKSGI  471
               + + LV AM S++ ALV+ G+
Sbjct  132  DMALMSNLVPAMVSIHAALVQLGL  155



>ref|XP_009406752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 91/147 (62%), Gaps = 5/147 (3%)
 Frame = +1

Query  28   MSLRPSPIFLFFLVSAFLFIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            M+LR S   +    S FL +   +S   IGVNYG + DNLPPP E AR LK  T I +++
Sbjct  1    MALRNSLSIVIAAWSLFLAVPFAKSQSFIGVNYGQVADNLPPPEETARLLK-STTISKVR  59

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  375
            ++  +P ILRA AGT I V +   NG+I  L  D   A  WV+AN+ PF PAT I+++AV
Sbjct  60   LYGADPAILRALAGTDISVVIGAANGDIASLASDPSAATNWVSANVLPFVPATSISVVAV  119

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            GNE L  G   + + L+ AM+++YNAL
Sbjct  120  GNEALTSGDATLASQLLPAMQNMYNAL  146



>ref|XP_006424832.1| hypothetical protein CICLE_v10028241mg [Citrus clementina]
 ref|XP_006488329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Citrus 
sinensis]
 gb|ESR38072.1| hypothetical protein CICLE_v10028241mg [Citrus clementina]
Length=504

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYG + +NLPPP +VA FLK +T IDR+K+FD NP+ LRAFA T I VTVTV NG+
Sbjct  31   SIGVNYGAIANNLPPPQQVANFLKTQTTIDRVKLFDANPEFLRAFAHTNIPVTVTVGNGD  90

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            I  L     A  WVA NI P +P T    I +GNE+L      +   L+ AMR+L +AL
Sbjct  91   IPALAKLPAAQSWVANNILPHHPQTIFRYIVLGNEILATSDKVLIASLLPAMRTLKSAL  149



>ref|XP_006488330.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Citrus 
sinensis]
Length=502

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYG + +NLPPP +VA FLK +T IDR+K+FD NP+ LRAFA T I VTVTV NG+
Sbjct  31   SIGVNYGAIANNLPPPQQVANFLKTQTTIDRVKLFDANPEFLRAFAHTNIPVTVTVGNGD  90

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            I  L     A  WVA NI P +P T    I +GNE+L      +   L+ AMR+L +AL
Sbjct  91   IPALAKLPAAQSWVANNILPHHPQTIFRYIVLGNEILATSDKVLIASLLPAMRTLKSAL  149



>gb|KDO72847.1| hypothetical protein CISIN_1g0375832mg, partial [Citrus sinensis]
Length=458

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            SIGVNYG + +NLPPP +VA FLK +T IDR+K+FD NP+ LRAFA T I VTVTV NG+
Sbjct  31   SIGVNYGAIANNLPPPQQVANFLKTQTTIDRVKLFDANPEFLRAFAHTNIPVTVTVGNGD  90

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            I  L     A  WVA NI P +P T    I +GNE+L      +   L+ AMR+L +AL
Sbjct  91   IPALAKLPAAQSWVANNILPHHPQTIFRYIVLGNEILATSDKVLIASLLPAMRTLKSAL  149



>ref|XP_002881667.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57926.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   118 bits (296),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 65/146 (45%), Positives = 87/146 (60%), Gaps = 9/146 (6%)
 Frame = +1

Query  58   FFLVSAFLFIHGV--------RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  213
            FF +   L + GV         +IG+NYGTLG NL PP +V  F+K+ T    +KI+D N
Sbjct  7    FFTLPFLLIVAGVIFQLSAVTSAIGINYGTLG-NLQPPQQVVDFIKKNTTFASVKIYDAN  65

Query  214  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLH  393
            PDILR+FAG+ I VT+ VPNG I  + +   A QWVAAN+ PF+   K   + VGNE+L 
Sbjct  66   PDILRSFAGSEINVTIMVPNGNIPAMVNVANARQWVAANVLPFHQQIKFKYLCVGNEILS  125

Query  394  WGTPEMQNGLVAAMRSLYNALVKSGI  471
                 + + LV AM+SL  AL  S +
Sbjct  126  SNDNNLISNLVPAMQSLNEALKASNL  151



>ref|XP_010227646.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Brachypodium 
distachyon]
Length=407

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 84/125 (67%), Gaps = 2/125 (2%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            +IG+NYG +G+NLP PT+V   L    V  +++I+DVNP +L AF+GTGI + VTVPN  
Sbjct  35   AIGINYGQVGNNLPTPTQVVSLLSSLRV-GKVRIYDVNPQVLSAFSGTGIELIVTVPNDL  93

Query  280  IIPLK-DAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            + P+    G A QWV ANIKP++PAT+   +AVGNEV       ++  LV AMR+L+ AL
Sbjct  94   VQPMAASTGQALQWVTANIKPYFPATRFTGVAVGNEVFTDDDEALKASLVPAMRNLHAAL  153

Query  457  VKSGI  471
             + G+
Sbjct  154  AQLGM  158



>ref|XP_010412950.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=561

 Score =   118 bits (295),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 64/152 (42%), Positives = 91/152 (60%), Gaps = 3/152 (2%)
 Frame = +1

Query  22   MEMSLRPSPIFLFFLVSAFLF--IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  195
            M  + R S +    +V+  +F  +    +IG+NYGTLG  L PP +V  F++ KT  D +
Sbjct  1    MAKTTRCSSLPFLLIVAPVIFQLLAVTSAIGINYGTLG-KLQPPQQVVDFIRTKTNFDSV  59

Query  196  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  375
            KI+D NP+ILR  AG+ I VT+ VPNG I  + +   A QWVAAN+ PF+   K   + V
Sbjct  60   KIYDANPNILRPLAGSKINVTIMVPNGLIPAMVNVANARQWVAANVLPFHQQIKFKYLCV  119

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            GNE+L      + + LV AM+SL+ AL  SG+
Sbjct  120  GNEILASNDNNLISNLVPAMQSLHKALKASGL  151



>ref|XP_009421254.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   116 bits (291),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 91/145 (63%), Gaps = 3/145 (2%)
 Frame = +1

Query  43   SPIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  216
            +P+F+ F  L S F F+    ++G+NYG + ++LP P +V   L    + +  +I+D NP
Sbjct  2    TPVFVLFVLLCSEFGFLRLGFALGINYGQVANDLPTPDQVLSILTSLKITN-TRIYDTNP  60

Query  217  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
             +L AFA TGI + VTVPN  +  L D   A QWVA N+KP++PATKI  IAVGNEV   
Sbjct  61   KVLAAFANTGIELIVTVPNESVGLLTDPRQALQWVATNVKPYFPATKITGIAVGNEVFTS  120

Query  397  GTPEMQNGLVAAMRSLYNALVKSGI  471
              P + + LV AM S++ ALV+ G+
Sbjct  121  DDPTLMSNLVPAMVSIHAALVQLGL  145



>ref|XP_007201010.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
 gb|EMJ02209.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
Length=464

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 91/148 (61%), Gaps = 2/148 (1%)
 Frame = +1

Query  31   SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  210
            SL   PIFLF L +AF        IGVNYG + DNLPPP   A+ L + T I R++++  
Sbjct  3    SLSHLPIFLFLLFTAFYSAASQSFIGVNYGQVADNLPPPAATAKLL-QSTSIKRVRLYGA  61

Query  211  NPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGNEV  387
            +P I++A AGTGI + +   NG+I  L  D   AAQWV +N+  FYPA+ I++I VGNEV
Sbjct  62   DPAIIKALAGTGIAIAIGASNGDIPALASDPNAAAQWVNSNVLAFYPASNIDLINVGNEV  121

Query  388  LHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            L      + + L+ AMR++ +AL  + +
Sbjct  122  LFSNDQGLISQLLPAMRNVQSALSAASL  149



>ref|XP_010940752.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=462

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 85/137 (62%), Gaps = 1/137 (1%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            +++ F VS    + G   IGVNYG L  NLPPP +VA+FL   TVIDR+K+FD +P  L+
Sbjct  17   LWILFTVSISEAVGG-SGIGVNYGRLASNLPPPAQVAQFLARNTVIDRVKLFDTDPSTLQ  75

Query  229  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPE  408
            AF  TG+ + VT+    I  L +  +A  W+ ANI P+  AT +  I VGNEVL      
Sbjct  76   AFDSTGVAIDVTISTDLISNLTNLSFAKYWIQANILPYIAATNVTRILVGNEVLSTAGKS  135

Query  409  MQNGLVAAMRSLYNALV  459
            + +GLV AM++L+ ALV
Sbjct  136  LISGLVPAMQNLHTALV  152



>ref|XP_010505644.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=639

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 61/142 (43%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  46   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  225
            P  L F    F  +    +IG+NYGTLG  L PP +V  F++  T  D +KI+D NP+IL
Sbjct  11   PFLLIFAPVIFQLLAVTSAIGINYGTLG-KLQPPQQVVDFIRTNTNFDSVKIYDANPNIL  69

Query  226  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTP  405
            R  AG+ I VT+ VPNG I  + +   A QWVAAN+ PF+   K   + VGNE+      
Sbjct  70   RPLAGSNINVTIMVPNGNIPAMVNVANARQWVAANVLPFHKQIKFKYLCVGNEIFASNDN  129

Query  406  EMQNGLVAAMRSLYNALVKSGI  471
             + + LV AM+SL  AL  SG+
Sbjct  130  NLISNLVPAMQSLNKALKASGL  151



>emb|CAB80165.1| putative protein (fragment) [Arabidopsis thaliana]
Length=356

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 89/144 (62%), Gaps = 2/144 (1%)
 Frame = +1

Query  28   MSLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  207
            M+L  S  FL   +S F   H    IGVNYG + DNLPPP+E  + L + T I +++++ 
Sbjct  1    MALSISIYFLLIFLSHFPSSHAEPFIGVNYGQVADNLPPPSETVKLL-QSTSIQKVRLYG  59

Query  208  VNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGNE  384
             +P I++A AGTG+ + +   NG++  L  D   A QW+ +N+ PFYPA+KI +I VGNE
Sbjct  60   ADPAIIKALAGTGVGIVIGAANGDVPSLASDPNAATQWINSNVLPFYPASKIMLITVGNE  119

Query  385  VLHWGTPEMQNGLVAAMRSLYNAL  456
            +L    P + N L+ AM+++  AL
Sbjct  120  ILMSNDPNLVNQLLPAMQNVQKAL  143



>gb|EYU43261.1| hypothetical protein MIMGU_mgv1a008785mg [Erythranthe guttata]
Length=362

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 86/139 (62%), Gaps = 1/139 (1%)
 Frame = +1

Query  55   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  234
            LF  +S F F   V ++G+NYG +G+NLPPP  V   L     + + +I+D NP IL AF
Sbjct  17   LFLTLSGFHFPKQVEALGINYGQVGNNLPPPERVLDLL-HSLRLTKARIYDTNPQILTAF  75

Query  235  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
            A + I + VTV N  +  L D   A QWVA +IKP++PAT I  IAVGNEV   G   + 
Sbjct  76   ANSNIELIVTVENQMLPTLTDPNQAFQWVATHIKPYFPATNITGIAVGNEVFTGGDTSLV  135

Query  415  NGLVAAMRSLYNALVKSGI  471
            + LV A+ S++NALV+ G+
Sbjct  136  SYLVPALVSIHNALVRFGL  154



>emb|CBI30910.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 90/146 (62%), Gaps = 6/146 (4%)
 Frame = +1

Query  49   IFLFFLVSAFLF-----IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  213
            +F  F++SA  F     + GV S G+NYG +G+NLP P +V   L     I + KI+D N
Sbjct  11   MFHAFILSALFFSDCGFLRGVASFGINYGQIGNNLPQPEKVLDLLSSLK-ITKTKIYDTN  69

Query  214  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLH  393
            P IL AFA +GI + VTV N ++  L D   A QWV++ IKP++PATKI  IAVGNE+  
Sbjct  70   PQILTAFANSGIELIVTVENDKLSDLTDPQQALQWVSSRIKPYFPATKITGIAVGNEIFT  129

Query  394  WGTPEMQNGLVAAMRSLYNALVKSGI  471
                 + + LV AM S++ ALV+ G+
Sbjct  130  GDDMTLMSYLVPAMISIHGALVQLGL  155



>ref|XP_010512954.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=774

 Score =   118 bits (295),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +1

Query  22   MEMSLRPSPIFLFFLVSAFLF--IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  195
            M  + R S +    +V+  +F  +    +IG+NYGTLG  L PP +V  F++ KT  D +
Sbjct  1    MAKTTRCSTLPFLLIVAPVIFQLLAVTSAIGINYGTLG-KLQPPQKVVDFIRTKTNFDSV  59

Query  196  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  375
            KI+D NP+ILRA AG+ I VT+ VPNG I  + +   A QWVAAN+ PF+   K   + V
Sbjct  60   KIYDANPNILRALAGSEINVTIMVPNGNIPAMVNVANARQWVAANVLPFHKQIKFKYLCV  119

Query  376  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            GNE+       + + LV AM+SL  AL  SG+
Sbjct  120  GNEIFASNDNNLISNLVPAMQSLNKALKASGL  151



>ref|XP_006292633.1| hypothetical protein CARUB_v10018875mg [Capsella rubella]
 gb|EOA25531.1| hypothetical protein CARUB_v10018875mg [Capsella rubella]
Length=348

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = +1

Query  103  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG-TGILVTVTVPNGE  279
            IGVNYGT+ +NLPPP +V  F+K KT I+ +KIFD NPDIL AF+G TGI +TVT+PN +
Sbjct  28   IGVNYGTVANNLPPPHQVVNFIKTKTNINHVKIFDANPDILAAFSGITGISLTVTIPNSD  87

Query  280  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            I+ L     A  W++ ++ PF PAT I  IAVGNE++      +   L+  M SL  AL
Sbjct  88   IVSLSKLPNARSWLSNHLLPFLPATSIRYIAVGNEIIATSDKTLIAHLLPTMESLTLAL  146



>ref|XP_002270153.2| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Vitis vinifera]
Length=403

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 90/146 (62%), Gaps = 6/146 (4%)
 Frame = +1

Query  49   IFLFFLVSAFLF-----IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  213
            +F  F++SA  F     + GV S G+NYG +G+NLP P +V   L     I + KI+D N
Sbjct  11   MFHAFILSALFFSDCGFLRGVASFGINYGQIGNNLPQPEKVLDLLSSLK-ITKTKIYDTN  69

Query  214  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLH  393
            P IL AFA +GI + VTV N ++  L D   A QWV++ IKP++PATKI  IAVGNE+  
Sbjct  70   PQILTAFANSGIELIVTVENDKLSDLTDPQQALQWVSSRIKPYFPATKITGIAVGNEIFT  129

Query  394  WGTPEMQNGLVAAMRSLYNALVKSGI  471
                 + + LV AM S++ ALV+ G+
Sbjct  130  GDDMTLMSYLVPAMISIHGALVQLGL  155



>ref|XP_008783477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Phoenix dactylifera]
Length=464

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 87/136 (64%), Gaps = 7/136 (5%)
 Frame = +1

Query  55   LFFLVSAFL--FIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  219
            LF  +SA L  F    RS   IGVNYG + DNLPPP   A+ LK  T I +++++  +P 
Sbjct  7    LFLTISALLLAFFSFARSQTFIGVNYGEVADNLPPPEATAKLLK-STTISKVRLYGADPA  65

Query  220  ILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHW  396
            ILRA AGT I V +   NG+I  L  D   A++WVAAN+ PF PAT I++IAVGNEVL+ 
Sbjct  66   ILRALAGTNISVIIGAANGDIPSLASDPAAASRWVAANVLPFIPATTISVIAVGNEVLNS  125

Query  397  GTPEMQNGLVAAMRSL  444
            G P +   L+ AM++L
Sbjct  126  GDPGLTAQLIPAMQNL  141



>ref|NP_190241.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
 emb|CAB62327.1| glucosidase-like protein [Arabidopsis thaliana]
 gb|AEE78173.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
Length=356

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 1/134 (1%)
 Frame = +1

Query  58   FFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  237
            F +++  L       +GVNYGT+ +NLPPP +V  F+K KT+I+ +KIFD N DIL AF+
Sbjct  12   FLILTLILPFSAAYQVGVNYGTVANNLPPPHQVVNFIKTKTIINHVKIFDTNHDILAAFS  71

Query  238  G-TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQ  414
            G TGI +TVTVPN +II L     A  W++ N+ PF   T I  IAVGNEV+      + 
Sbjct  72   GITGISLTVTVPNSDIISLSKLSNARSWLSDNLLPFLLTTSIRYIAVGNEVVATSDKTLI  131

Query  415  NGLVAAMRSLYNAL  456
              L+ AM +L  AL
Sbjct  132  THLLPAMETLTLAL  145



>ref|XP_006855691.1| hypothetical protein AMTR_s00044p00136160 [Amborella trichopoda]
 gb|ERN17158.1| hypothetical protein AMTR_s00044p00136160 [Amborella trichopoda]
Length=251

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 91/147 (62%), Gaps = 9/147 (6%)
 Frame = +1

Query  40   PSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  219
            PS    FFL+  FL +     IG+NYGT+G NLP P   A  L+  T+ID++KI+D NP 
Sbjct  4    PSLAASFFLL--FLTLQRASGIGMNYGTMGTNLPSPKHAAAVLQH-TLIDKVKIYDTNPT  60

Query  220  ILRAFAGTGILVTVTVPNGEIIPLKDAG--YAAQWVAANIKPFYPATKINIIAVGNEVLH  393
            IL+AFA TGI V VTV N  I  L   G   AA W ++ + PF PAT I +I+VGNEVL 
Sbjct  61   ILQAFANTGISVAVTVENALIQNLSTGGPPAAADWFSSQVAPFLPATPITLISVGNEVL-  119

Query  394  WGTPEMQN-GLVAAMRSLYNALVKSGI  471
                + QN  LV AMR++ +A+  SG+
Sbjct  120  --ASDSQNYDLVPAMRNIQSAVEMSGL  144



>ref|XP_006657020.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Oryza brachyantha]
Length=407

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +1

Query  100  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  279
            ++G+NYG +G+NLP P +V   L     I +++I+DVNP +L AFAGTGI + VTVPN  
Sbjct  34   ALGINYGQVGNNLPSPAQVVSLLASLR-IGKVRIYDVNPQVLAAFAGTGIELIVTVPNDL  92

Query  280  IIPLKDA-GYAAQWVAANIKPFYPATKINIIAVGNEVLHWGTPEMQNGLVAAMRSLYNAL  456
            + PL  + G A QWV ++++P++PAT+++ IAVGNEVL      ++  LV AMR+L+ AL
Sbjct  93   VQPLAASPGQALQWVTSSVRPYFPATRVSGIAVGNEVLTDDDETLKASLVPAMRNLHAAL  152

Query  457  VKSGI  471
             + G+
Sbjct  153  AQLGM  157



>ref|XP_009380510.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X3 
[Musa acuminata subsp. malaccensis]
Length=432

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 90/143 (63%), Gaps = 3/143 (2%)
 Frame = +1

Query  49   IFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  222
            +FL F  L S F F+    S+G+NYG + +NLP P +V R L     I + +I+D NP +
Sbjct  62   MFLLFNLLSSEFGFLRLGSSLGINYGQVANNLPSPEQV-RLLLTSLRITKTRIYDTNPRV  120

Query  223  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGT  402
            L AFA TGI + VTVPN  +  + D   A QWV  N++P++PATKI  I+VGNEV     
Sbjct  121  LTAFANTGIDLIVTVPNEAVGVMMDPRQALQWVMTNVQPYFPATKITGISVGNEVYTSDD  180

Query  403  PEMQNGLVAAMRSLYNALVKSGI  471
            P + + LV A+ S+++ALV+ G+
Sbjct  181  PTLMSNLVPALLSIHSALVQLGL  203



>ref|XP_009380508.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=460

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 90/143 (63%), Gaps = 3/143 (2%)
 Frame = +1

Query  49   IFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  222
            +FL F  L S F F+    S+G+NYG + +NLP P +V R L     I + +I+D NP +
Sbjct  62   MFLLFNLLSSEFGFLRLGSSLGINYGQVANNLPSPEQV-RLLLTSLRITKTRIYDTNPRV  120

Query  223  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGT  402
            L AFA TGI + VTVPN  +  + D   A QWV  N++P++PATKI  I+VGNEV     
Sbjct  121  LTAFANTGIDLIVTVPNEAVGVMMDPRQALQWVMTNVQPYFPATKITGISVGNEVYTSDD  180

Query  403  PEMQNGLVAAMRSLYNALVKSGI  471
            P + + LV A+ S+++ALV+ G+
Sbjct  181  PTLMSNLVPALLSIHSALVQLGL  203



>ref|XP_010478704.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Camelina 
sativa]
Length=419

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 88/151 (58%), Gaps = 2/151 (1%)
 Frame = +1

Query  22   MEM-SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            ME+ S R S  FLF L   F+    + SIGVNYG +GDNLP P+EV   +K      ++K
Sbjct  1    MELKSFRRSSSFLFLLSVMFIIPTAIASIGVNYGQIGDNLPSPSEVIPLIKSIGAT-KVK  59

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  378
            ++D NP IL+AFA TGI   V + N  +  +KD   A  W+  N+ PF PAT I  I +G
Sbjct  60   LYDANPQILKAFANTGIEFIVGLGNEYLSKMKDPSKALTWIKQNVTPFLPATNITCITIG  119

Query  379  NEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            NE+L      +   L+ AM+ +++AL  +G+
Sbjct  120  NEILALNDSSLTLSLLPAMQGVHSALTTAGL  150



>ref|XP_009380509.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=445

 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 90/143 (63%), Gaps = 3/143 (2%)
 Frame = +1

Query  49   IFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  222
            +FL F  L S F F+    S+G+NYG + +NLP P +V R L     I + +I+D NP +
Sbjct  62   MFLLFNLLSSEFGFLRLGSSLGINYGQVANNLPSPEQV-RLLLTSLRITKTRIYDTNPRV  120

Query  223  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGT  402
            L AFA TGI + VTVPN  +  + D   A QWV  N++P++PATKI  I+VGNEV     
Sbjct  121  LTAFANTGIDLIVTVPNEAVGVMMDPRQALQWVMTNVQPYFPATKITGISVGNEVYTSDD  180

Query  403  PEMQNGLVAAMRSLYNALVKSGI  471
            P + + LV A+ S+++ALV+ G+
Sbjct  181  PTLMSNLVPALLSIHSALVQLGL  203



>ref|NP_195174.6| glucan endo-1,3-beta-glucosidase 7 [Arabidopsis thaliana]
 sp|Q9M069.2|E137_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 7; AltName: Full=(1->3)-beta-glucan 
endohydrolase 7; Short=(1->3)-beta-glucanase 
7; AltName: Full=Beta-1,3-endoglucanase 7; Short=Beta-1,3-glucanase 
7; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE86384.1| glucan endo-1,3-beta-glucosidase 7 [Arabidopsis thaliana]
Length=504

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 89/144 (62%), Gaps = 2/144 (1%)
 Frame = +1

Query  28   MSLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  207
            M+L  S  FL   +S F   H    IGVNYG + DNLPPP+E  + L + T I +++++ 
Sbjct  1    MALSISIYFLLIFLSHFPSSHAEPFIGVNYGQVADNLPPPSETVKLL-QSTSIQKVRLYG  59

Query  208  VNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGNE  384
             +P I++A AGTG+ + +   NG++  L  D   A QW+ +N+ PFYPA+KI +I VGNE
Sbjct  60   ADPAIIKALAGTGVGIVIGAANGDVPSLASDPNAATQWINSNVLPFYPASKIMLITVGNE  119

Query  385  VLHWGTPEMQNGLVAAMRSLYNAL  456
            +L    P + N L+ AM+++  AL
Sbjct  120  ILMSNDPNLVNQLLPAMQNVQKAL  143



>ref|XP_002437077.1| hypothetical protein SORBIDRAFT_10g020900 [Sorghum bicolor]
 gb|EER88444.1| hypothetical protein SORBIDRAFT_10g020900 [Sorghum bicolor]
Length=408

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 93/143 (65%), Gaps = 4/143 (3%)
 Frame = +1

Query  49   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  228
            + +F L S    +    ++G+NYG +G+NLP P +V + L     I +++I+DVNP +L 
Sbjct  22   LCIFLLSSEVSLVRQATALGINYGQVGNNLPAPPQVVQLLSSLR-IGKVRIYDVNPQVLT  80

Query  229  AFAGTGILVTVTVPNGEIIP--LKDAGYAAQWVAANIKPFYPATKINIIAVGNEVLHWGT  402
            AFAGTGI + VTVP+ +++P     A  A QW++A+++P++PA ++  IAVGNEV     
Sbjct  81   AFAGTGIELIVTVPD-DLVPGMAGSASQALQWLSASVRPYFPAARVTGIAVGNEVFTGDD  139

Query  403  PEMQNGLVAAMRSLYNALVKSGI  471
             +++  LV AMR+L+ AL + G+
Sbjct  140  EQLKASLVPAMRNLHAALAQLGM  162



>ref|XP_010499813.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Camelina 
sativa]
Length=430

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 88/151 (58%), Gaps = 2/151 (1%)
 Frame = +1

Query  22   MEM-SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            ME+ S R S  F+F L   F+    + SIGVNYG +GDNLP P+EV   +K      ++K
Sbjct  1    MELKSFRRSSSFIFLLSVTFIIPTAIASIGVNYGQIGDNLPSPSEVIPLIKSIGAT-KVK  59

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  378
            ++D NP IL+AFA TGI   V + N  +  +KD   A  W+  N+ PF PAT I  I +G
Sbjct  60   LYDANPQILKAFANTGIEFIVGLGNEYLSKMKDPSKALTWIKQNVTPFLPATNITCITIG  119

Query  379  NEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            NE+L      +   L+ AM+ +++AL  +G+
Sbjct  120  NEILALNDSSLTLSLLPAMQGVHSALTTAGL  150



>ref|XP_010461089.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Camelina sativa]
Length=428

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 88/151 (58%), Gaps = 2/151 (1%)
 Frame = +1

Query  22   MEM-SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            ME+ S R S  F+F L   F+    + SIGVNYG +GDNLP P+EV   +K      ++K
Sbjct  1    MELKSFRRSSSFIFLLSVTFIIPTAIASIGVNYGQIGDNLPSPSEVIPLIKSIGAT-KVK  59

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  378
            ++D NP IL+AFA TGI   V + N  +  +KD   A  W+  N+ PF PAT I  I +G
Sbjct  60   LYDANPQILKAFANTGIEFIVGLGNEYLSKMKDPSKALTWIKQNVTPFLPATNITCITIG  119

Query  379  NEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            NE+L      +   L+ AM+ +++AL  +G+
Sbjct  120  NEILALNDSSLTLSLLPAMQGVHSALTTAGL  150



>ref|XP_009114852.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Brassica rapa]
Length=414

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 87/151 (58%), Gaps = 2/151 (1%)
 Frame = +1

Query  22   MEM-SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  198
            ME+ S  PS    F      L    V SIGVNYG +GDNLP P EV   +K      ++K
Sbjct  1    MELKSFHPSSALFFLFSVVILSPTTVTSIGVNYGQIGDNLPSPEEVVPLVKSIGAT-KVK  59

Query  199  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  378
            ++D NP+IL+AF+GTG+   V + N  +  +KD   A  W+  N+ PF PAT I  I +G
Sbjct  60   LYDANPEILKAFSGTGVEFIVGLGNEYLSKMKDPSKALTWIKQNVTPFLPATNITCITIG  119

Query  379  NEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  471
            NE+L      + + L+ AM+ +++ALV +G+
Sbjct  120  NEILALNDSSLTDSLLPAMQGVHSALVTAGL  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554587825180