BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFS001C03

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761607.1|  PREDICTED: heat shock 70 kDa protein 15-like       325   1e-108   Nicotiana sylvestris
ref|XP_011072334.1|  PREDICTED: heat shock 70 kDa protein 15-like       327   1e-102   Sesamum indicum [beniseed]
ref|XP_007024113.1|  Heat shock protein 91 isoform 2                    320   1e-102   
gb|KHG16619.1|  Heat shock 70 kDa 15 -like protein                      323   4e-101   Gossypium arboreum [tree cotton]
gb|KJB35057.1|  hypothetical protein B456_006G098500                    317   5e-101   Gossypium raimondii
ref|XP_007024112.1|  Heat shock protein 91 isoform 1                    322   1e-100   
gb|KJB70511.1|  hypothetical protein B456_011G076800                    318   3e-100   Gossypium raimondii
ref|XP_010539495.1|  PREDICTED: heat shock 70 kDa protein 15-like       321   3e-100   Tarenaya hassleriana [spider flower]
ref|XP_002528199.1|  Heat shock 70 kDa protein, putative                319   9e-100   Ricinus communis
gb|KJB70509.1|  hypothetical protein B456_011G076800                    319   1e-99    Gossypium raimondii
gb|KJB35056.1|  hypothetical protein B456_006G098500                    319   1e-99    Gossypium raimondii
gb|KHG16198.1|  Heat shock 70 kDa 15 -like protein                      318   2e-99    Gossypium arboreum [tree cotton]
ref|XP_009624163.1|  PREDICTED: heat shock 70 kDa protein 15-like       318   2e-99    Nicotiana tomentosiformis
gb|KDO51190.1|  hypothetical protein CISIN_1g003056mg                   315   3e-99    Citrus sinensis [apfelsine]
ref|XP_006389708.1|  hypothetical protein EUTSA_v100181451mg            311   3e-99    
ref|XP_010538015.1|  PREDICTED: heat shock 70 kDa protein 14            317   3e-99    Tarenaya hassleriana [spider flower]
gb|KDP37205.1|  hypothetical protein JCGZ_06261                         317   4e-99    Jatropha curcas
ref|XP_011080863.1|  PREDICTED: heat shock 70 kDa protein 14-like       317   6e-99    Sesamum indicum [beniseed]
gb|ACF83633.1|  unknown                                                 301   7e-99    Zea mays [maize]
ref|XP_004252333.1|  PREDICTED: heat shock 70 kDa protein 15-like       316   1e-98    Solanum lycopersicum
ref|XP_010521527.1|  PREDICTED: heat shock 70 kDa protein 15            316   1e-98    Tarenaya hassleriana [spider flower]
gb|KDO51188.1|  hypothetical protein CISIN_1g003056mg                   315   1e-98    Citrus sinensis [apfelsine]
gb|KDO51189.1|  hypothetical protein CISIN_1g003056mg                   316   2e-98    Citrus sinensis [apfelsine]
ref|XP_006427039.1|  hypothetical protein CICLE_v10024883mg             316   2e-98    Citrus clementina [clementine]
ref|XP_006465548.1|  PREDICTED: heat shock 70 kDa protein 14-like       315   2e-98    Citrus sinensis [apfelsine]
ref|XP_003546366.1|  PREDICTED: heat shock 70 kDa protein 14-like       315   2e-98    Glycine max [soybeans]
gb|EPS63387.1|  hypothetical protein M569_11394                         303   3e-98    Genlisea aurea
ref|XP_010249783.1|  PREDICTED: heat shock 70 kDa protein 15-like       313   2e-97    Nelumbo nucifera [Indian lotus]
ref|XP_002279789.2|  PREDICTED: heat shock 70 kDa protein 14-like       313   2e-97    Vitis vinifera
ref|XP_006346576.1|  PREDICTED: heat shock 70 kDa protein 15-like       312   3e-97    Solanum tuberosum [potatoes]
ref|XP_009801414.1|  PREDICTED: heat shock 70 kDa protein 15-like       312   3e-97    Nicotiana sylvestris
ref|XP_009610837.1|  PREDICTED: heat shock 70 kDa protein 14-like...    311   3e-97    Nicotiana tomentosiformis
emb|CDO98063.1|  unnamed protein product                                312   5e-97    Coffea canephora [robusta coffee]
ref|XP_006300740.1|  hypothetical protein CARUB_v10019803mg             311   8e-97    Capsella rubella
ref|XP_003543647.1|  PREDICTED: heat shock 70 kDa protein 14-like       311   8e-97    Glycine max [soybeans]
gb|KHN32604.1|  Heat shock 70 kDa protein 14                            311   8e-97    Glycine soja [wild soybean]
ref|XP_010915054.1|  PREDICTED: heat shock 70 kDa protein 14-like       311   8e-97    Elaeis guineensis
gb|EYU24689.1|  hypothetical protein MIMGU_mgv1a001324mg                304   9e-97    Erythranthe guttata [common monkey flower]
gb|EYU21549.1|  hypothetical protein MIMGU_mgv1a001311mg                311   1e-96    Erythranthe guttata [common monkey flower]
ref|XP_010033884.1|  PREDICTED: heat shock 70 kDa protein 14-like       311   1e-96    Eucalyptus grandis [rose gum]
ref|XP_010925328.1|  PREDICTED: heat shock 70 kDa protein 14-like       311   1e-96    Elaeis guineensis
ref|XP_004252334.1|  PREDICTED: heat shock 70 kDa protein 15-like       311   1e-96    Solanum lycopersicum
ref|XP_009587742.1|  PREDICTED: heat shock 70 kDa protein 15-like       311   1e-96    Nicotiana tomentosiformis
ref|XP_010254149.1|  PREDICTED: heat shock 70 kDa protein 15-like       311   1e-96    Nelumbo nucifera [Indian lotus]
ref|XP_007150665.1|  hypothetical protein PHAVU_005G171400g             311   1e-96    Phaseolus vulgaris [French bean]
ref|XP_008354138.1|  PREDICTED: heat shock 70 kDa protein 15-like       303   1e-96    
ref|XP_002304187.1|  heat shock protein 70                              311   1e-96    Populus trichocarpa [western balsam poplar]
ref|XP_009610834.1|  PREDICTED: heat shock 70 kDa protein 15-like...    311   2e-96    Nicotiana tomentosiformis
ref|XP_006392781.1|  hypothetical protein EUTSA_v10011242mg             310   2e-96    Eutrema salsugineum [saltwater cress]
emb|CDY43337.1|  BnaC04g25190D                                          311   2e-96    Brassica napus [oilseed rape]
emb|CDX76065.1|  BnaA04g03290D                                          309   2e-96    
ref|XP_010430044.1|  PREDICTED: heat shock 70 kDa protein 15            310   2e-96    
ref|XP_010417777.1|  PREDICTED: heat shock 70 kDa protein 15-like...    310   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010473009.1|  PREDICTED: heat shock 70 kDa protein 15-like       310   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010417776.1|  PREDICTED: heat shock 70 kDa protein 15-like...    310   3e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010473008.1|  PREDICTED: heat shock 70 kDa protein 15-like       310   3e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010691292.1|  PREDICTED: heat shock 70 kDa protein 15-like       310   3e-96    Beta vulgaris subsp. vulgaris [field beet]
gb|AAG52244.1|AC011717_12  putative heat-shock protein; 41956-44878     307   3e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430043.1|  PREDICTED: heat shock 70 kDa protein 15-like       309   3e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010033879.1|  PREDICTED: heat shock 70 kDa protein 14-like       310   4e-96    Eucalyptus grandis [rose gum]
ref|XP_010098045.1|  Heat shock 70 kDa protein 15                       310   4e-96    Morus notabilis
ref|XP_009147592.1|  PREDICTED: heat shock 70 kDa protein 14            308   5e-96    Brassica rapa
ref|XP_006346577.1|  PREDICTED: heat shock 70 kDa protein 15-like...    309   5e-96    Solanum tuberosum [potatoes]
ref|XP_011000832.1|  PREDICTED: heat shock 70 kDa protein 14-like...    308   6e-96    Populus euphratica
ref|NP_850984.4|  Heat shock protein 70                                 308   8e-96    
gb|AAL38353.1|  putative heat-shock protein                             308   8e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_178110.6|  Heat shock protein 70                                 308   8e-96    
ref|XP_009139126.1|  PREDICTED: heat shock 70 kDa protein 15            308   8e-96    Brassica rapa
ref|XP_006287070.1|  hypothetical protein CARUB_v10000229mg             308   9e-96    Capsella rubella
ref|XP_002887853.1|  hypothetical protein ARALYDRAFT_896005             308   1e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_009408938.1|  PREDICTED: heat shock 70 kDa protein 15-like       308   1e-95    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY24089.1|  BnaA06g00870D                                          308   1e-95    Brassica napus [oilseed rape]
ref|NP_001031305.1|  heat shock protein 91                              307   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217050.1|  hypothetical protein PRUPE_ppa001317mg             308   1e-95    Prunus persica
emb|CDY45119.1|  BnaC06g06400D                                          310   1e-95    Brassica napus [oilseed rape]
ref|XP_009388669.1|  PREDICTED: heat shock 70 kDa protein 14-like       308   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008228510.1|  PREDICTED: heat shock 70 kDa protein 15-like       308   2e-95    Prunus mume [ume]
ref|XP_008793460.1|  PREDICTED: heat shock 70 kDa protein 14-like       308   2e-95    Phoenix dactylifera
ref|NP_178111.1|  heat shock protein 91                                 307   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011000830.1|  PREDICTED: heat shock 70 kDa protein 15-like...    307   3e-95    Populus euphratica
gb|EYU24688.1|  hypothetical protein MIMGU_mgv1a001324mg                306   4e-95    Erythranthe guttata [common monkey flower]
gb|EPS59607.1|  hypothetical protein M569_15197                         298   7e-95    Genlisea aurea
emb|CAA94389.1|  heat-shock protein                                     305   8e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011013254.1|  PREDICTED: heat shock 70 kDa protein 15-like       305   1e-94    Populus euphratica
ref|XP_002439385.1|  hypothetical protein SORBIDRAFT_09g005580          305   1e-94    Sorghum bicolor [broomcorn]
emb|CCM07272.1|  Putative 97 kDa heat shock protein                     305   1e-94    Musa balbisiana [starchy banana]
ref|XP_009389931.1|  PREDICTED: heat shock 70 kDa protein 14-like       305   1e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008786326.1|  PREDICTED: heat shock 70 kDa protein 15-like       304   4e-94    Phoenix dactylifera
ref|XP_008654914.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    303   5e-94    
gb|AFW81561.1|  hypothetical protein ZEAMMB73_352123                    297   5e-94    
ref|NP_001147805.1|  heat shock 70 kDa protein 4                        303   5e-94    Zea mays [maize]
ref|XP_003597778.1|  97 kDa heat shock protein                          304   6e-94    Medicago truncatula
ref|XP_006842242.1|  hypothetical protein AMTR_s00078p00190750          303   1e-93    Amborella trichopoda
ref|XP_006643833.1|  PREDICTED: heat shock 70 kDa protein 14-like       303   1e-93    Oryza brachyantha
ref|XP_004506856.1|  PREDICTED: heat shock 70 kDa protein 15-like       303   2e-93    Cicer arietinum [garbanzo]
ref|XP_004960855.1|  PREDICTED: heat shock 70 kDa protein 15-like...    302   3e-93    Setaria italica
gb|KHN47807.1|  Heat shock 70 kDa protein 14                            301   3e-93    Glycine soja [wild soybean]
ref|XP_008647466.1|  PREDICTED: uncharacterized protein LOC100217...    301   4e-93    
ref|XP_003529646.1|  PREDICTED: heat shock 70 kDa protein 15-like...    302   4e-93    
ref|XP_003531683.1|  PREDICTED: heat shock 70 kDa protein 14-like...    301   5e-93    Glycine max [soybeans]
ref|XP_004960853.1|  PREDICTED: heat shock 70 kDa protein 14-like...    301   5e-93    Setaria italica
ref|XP_002299641.1|  heat shock protein 70                              301   6e-93    Populus trichocarpa [western balsam poplar]
ref|XP_006585595.1|  PREDICTED: heat shock 70 kDa protein 14-like...    301   7e-93    Glycine max [soybeans]
ref|XP_004506857.1|  PREDICTED: heat shock 70 kDa protein 15-like       301   7e-93    Cicer arietinum [garbanzo]
ref|XP_004960852.1|  PREDICTED: heat shock 70 kDa protein 14-like...    301   9e-93    
ref|XP_009358190.1|  PREDICTED: heat shock 70 kDa protein 15-like       300   1e-92    Pyrus x bretschneideri [bai li]
ref|XP_009358191.1|  PREDICTED: heat shock 70 kDa protein 15-like       300   1e-92    Pyrus x bretschneideri [bai li]
gb|EAY72790.1|  hypothetical protein OsI_00654                          300   1e-92    Oryza sativa Indica Group [Indian rice]
ref|XP_009399777.1|  PREDICTED: heat shock 70 kDa protein 14-like       300   1e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002440718.1|  hypothetical protein SORBIDRAFT_09g005570          300   1e-92    Sorghum bicolor [broomcorn]
ref|XP_008462146.1|  PREDICTED: heat shock 70 kDa protein 15-like       300   2e-92    Cucumis melo [Oriental melon]
ref|NP_001042210.1|  Os01g0180800                                       300   2e-92    
ref|XP_010925584.1|  PREDICTED: heat shock 70 kDa protein 14-like       299   3e-92    Elaeis guineensis
ref|XP_010231645.1|  PREDICTED: heat shock 70 kDa protein 14-like       299   3e-92    
gb|EMT31029.1|  Heat shock 70 kDa protein 4L                            299   3e-92    
ref|NP_001151579.1|  heat shock 70 kDa protein 4                        299   4e-92    Zea mays [maize]
ref|XP_008362708.1|  PREDICTED: heat shock 70 kDa protein 15-like       299   4e-92    
ref|XP_004141777.1|  PREDICTED: heat shock 70 kDa protein 15-like       298   4e-92    Cucumis sativus [cucumbers]
gb|ACG43420.1|  heat shock 70 kDa protein 4                             298   5e-92    Zea mays [maize]
gb|EMS61926.1|  Heat shock 70 kDa protein 4L                            298   6e-92    Triticum urartu
ref|XP_008371663.1|  PREDICTED: heat shock 70 kDa protein 15-like       298   6e-92    
ref|XP_008655087.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    298   9e-92    Zea mays [maize]
ref|XP_010231644.1|  PREDICTED: heat shock 70 kDa protein 15-like       297   1e-91    Brachypodium distachyon [annual false brome]
ref|XP_008649434.1|  PREDICTED: heat shock 70 kDa protein 14-like       297   2e-91    Zea mays [maize]
ref|XP_007135698.1|  hypothetical protein PHAVU_010G150800g             296   2e-91    Phaseolus vulgaris [French bean]
gb|EMT09857.1|  Heat shock 70 kDa protein 4L                            298   2e-91    
ref|XP_008775317.1|  PREDICTED: heat shock 70 kDa protein 14-like       297   2e-91    Phoenix dactylifera
ref|XP_004302913.1|  PREDICTED: heat shock 70 kDa protein 15-like       295   1e-90    Fragaria vesca subsp. vesca
gb|EMS52665.1|  Heat shock 70 kDa protein 4L                            299   2e-90    Triticum urartu
gb|KEH28782.1|  heat shock 70 kDa protein                               294   2e-90    Medicago truncatula
gb|AFW77408.1|  hypothetical protein ZEAMMB73_835876                    298   5e-90    
dbj|BAJ90753.1|  predicted protein                                      292   8e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008354139.1|  PREDICTED: heat shock 70 kDa protein 15-like       292   8e-90    
ref|XP_006654112.1|  PREDICTED: heat shock 70 kDa protein 15-like       281   3e-85    Oryza brachyantha
gb|EAY96776.1|  hypothetical protein OsI_18700                          279   1e-84    Oryza sativa Indica Group [Indian rice]
ref|NP_001054812.1|  Os05g0181000                                       279   1e-84    
ref|XP_001764380.1|  predicted protein                                  278   1e-84    
ref|XP_001755636.1|  predicted protein                                  277   2e-84    
ref|XP_001760080.1|  predicted protein                                  273   2e-82    
ref|XP_002986462.1|  hypothetical protein SELMODRAFT_124091             266   3e-80    
ref|XP_002978946.1|  hypothetical protein SELMODRAFT_109750             264   1e-79    
ref|XP_002317001.1|  hypothetical protein POPTR_0011s14240g             254   8e-76    Populus trichocarpa [western balsam poplar]
ref|XP_008363587.1|  PREDICTED: heat shock 70 kDa protein 16-like       242   2e-75    
ref|XP_011030786.1|  PREDICTED: heat shock 70 kDa protein 16-like...    253   2e-75    Populus euphratica
ref|XP_011030785.1|  PREDICTED: heat shock 70 kDa protein 16-like...    253   2e-75    Populus euphratica
ref|XP_008353314.1|  PREDICTED: heat shock 70 kDa protein 16-like       242   1e-74    
ref|XP_007213641.1|  hypothetical protein PRUPE_ppa001697mg             249   5e-74    Prunus persica
ref|XP_008226915.1|  PREDICTED: heat shock 70 kDa protein 16            249   7e-74    Prunus mume [ume]
gb|KCW67010.1|  hypothetical protein EUGRSUZ_F00767                     245   6e-73    Eucalyptus grandis [rose gum]
ref|XP_004500055.1|  PREDICTED: heat shock 70 kDa protein 16-like       246   9e-73    Cicer arietinum [garbanzo]
ref|XP_010060358.1|  PREDICTED: heat shock 70 kDa protein 16            246   1e-72    Eucalyptus grandis [rose gum]
ref|XP_008345050.1|  PREDICTED: heat shock 70 kDa protein 16-like       238   1e-72    
ref|XP_003600064.1|  Heat shock 70 kDa protein 4L                       245   2e-72    Medicago truncatula
gb|AII99893.1|  heat shock protein                                      245   2e-72    Cicer arietinum [garbanzo]
ref|XP_010092150.1|  Heat shock 70 kDa protein 16                       244   2e-72    
ref|XP_009352450.1|  PREDICTED: heat shock 70 kDa protein 16-like       244   3e-72    Pyrus x bretschneideri [bai li]
ref|XP_009352433.1|  PREDICTED: heat shock 70 kDa protein 16-like       244   5e-72    Pyrus x bretschneideri [bai li]
gb|AET00484.2|  heat shock 70 kDa protein                               243   9e-72    Medicago truncatula
ref|XP_003617525.1|  97 kDa heat shock protein                          243   1e-71    
ref|XP_007020850.1|  Heat shock protein 70 family protein               242   2e-71    
ref|XP_008355346.1|  PREDICTED: heat shock 70 kDa protein 16-like       236   2e-71    
ref|XP_008366399.1|  PREDICTED: heat shock 70 kDa protein 16-like       242   2e-71    
gb|KDP39123.1|  hypothetical protein JCGZ_00880                         242   3e-71    Jatropha curcas
ref|XP_009760615.1|  PREDICTED: heat shock 70 kDa protein 16            241   6e-71    Nicotiana sylvestris
ref|XP_002522946.1|  Heat-shock protein 105 kDa, putative               240   6e-71    
ref|XP_006858197.1|  hypothetical protein AMTR_s00062p00170870          236   1e-70    
ref|XP_009372708.1|  PREDICTED: heat shock 70 kDa protein 16-like...    239   1e-70    Pyrus x bretschneideri [bai li]
ref|XP_010278704.1|  PREDICTED: heat shock 70 kDa protein 16            239   2e-70    Nelumbo nucifera [Indian lotus]
ref|XP_009372707.1|  PREDICTED: heat shock 70 kDa protein 16-like...    239   2e-70    Pyrus x bretschneideri [bai li]
ref|XP_007020851.1|  Heat shock protein 70 family protein               239   2e-70    
ref|XP_009614255.1|  PREDICTED: heat shock 70 kDa protein 16            239   3e-70    Nicotiana tomentosiformis
ref|XP_004151979.1|  PREDICTED: heat shock 70 kDa protein 16-like       239   3e-70    Cucumis sativus [cucumbers]
ref|XP_004167874.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    239   4e-70    
gb|EYU27798.1|  hypothetical protein MIMGU_mgv1a001740mg                237   7e-70    Erythranthe guttata [common monkey flower]
gb|EYU27799.1|  hypothetical protein MIMGU_mgv1a001740mg                238   8e-70    Erythranthe guttata [common monkey flower]
ref|XP_004232717.1|  PREDICTED: heat shock 70 kDa protein 16            236   2e-69    Solanum lycopersicum
ref|XP_010931798.1|  PREDICTED: heat shock 70 kDa protein 16            236   3e-69    Elaeis guineensis
gb|AII99889.1|  heat shock protein                                      236   3e-69    Cicer arietinum [garbanzo]
ref|XP_004491392.1|  PREDICTED: heat shock 70 kDa protein 16-like       236   4e-69    Cicer arietinum [garbanzo]
ref|XP_002278262.1|  PREDICTED: heat shock 70 kDa protein 16            236   4e-69    Vitis vinifera
ref|XP_008465078.1|  PREDICTED: heat shock 70 kDa protein 16            236   4e-69    Cucumis melo [Oriental melon]
ref|XP_008806739.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    234   3e-68    Phoenix dactylifera
ref|XP_008806738.1|  PREDICTED: heat shock 70 kDa protein 16 isof...    234   3e-68    Phoenix dactylifera
gb|KJB69295.1|  hypothetical protein B456_011G014900                    233   4e-68    Gossypium raimondii
ref|XP_004294376.1|  PREDICTED: heat shock 70 kDa protein 16            233   6e-68    Fragaria vesca subsp. vesca
ref|XP_011096072.1|  PREDICTED: heat shock 70 kDa protein 16            232   1e-67    Sesamum indicum [beniseed]
ref|XP_006348107.1|  PREDICTED: heat shock 70 kDa protein 16-like...    232   1e-67    Solanum tuberosum [potatoes]
gb|KHN45217.1|  Heat shock 70 kDa protein 16                            231   2e-67    Glycine soja [wild soybean]
ref|XP_003553093.1|  PREDICTED: heat shock 70 kDa protein 16-like       231   2e-67    Glycine max [soybeans]
gb|AFG63451.1|  hypothetical protein UMN_2640_01                        214   2e-67    Pinus taeda
gb|KJB22069.1|  hypothetical protein B456_004G027900                    230   3e-67    Gossypium raimondii
ref|XP_007146461.1|  hypothetical protein PHAVU_006G042400g             230   5e-67    Phaseolus vulgaris [French bean]
ref|XP_002305580.2|  hypothetical protein POPTR_0004s01640g             230   6e-67    
emb|CDP04389.1|  unnamed protein product                                230   6e-67    Coffea canephora [robusta coffee]
ref|XP_011037663.1|  PREDICTED: heat shock 70 kDa protein 16            230   6e-67    Populus euphratica
gb|KHG25442.1|  Heat shock 70 kDa 16 -like protein                      229   1e-66    Gossypium arboreum [tree cotton]
gb|KJB22068.1|  hypothetical protein B456_004G027900                    229   1e-66    Gossypium raimondii
ref|XP_008365284.1|  PREDICTED: heat shock 70 kDa protein 16            227   3e-66    
ref|XP_006475182.1|  PREDICTED: heat shock 70 kDa protein 16-like...    227   5e-66    
ref|XP_006452327.1|  hypothetical protein CICLE_v10007538mg             227   8e-66    Citrus clementina [clementine]
gb|KHM99573.1|  Heat shock 70 kDa protein 16                            226   2e-65    Glycine soja [wild soybean]
ref|XP_003532123.1|  PREDICTED: heat shock 70 kDa protein 16-like       226   2e-65    Glycine max [soybeans]
ref|XP_010665569.1|  PREDICTED: heat shock 70 kDa protein 16            226   2e-65    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006306833.1|  hypothetical protein CARUB_v10008380mg             224   4e-65    
ref|XP_006306834.1|  hypothetical protein CARUB_v10008380mg             224   6e-65    Capsella rubella
gb|KDO75458.1|  hypothetical protein CISIN_1g004211mg                   222   2e-64    Citrus sinensis [apfelsine]
ref|XP_006595737.1|  PREDICTED: heat shock 70 kDa protein 16-like...    223   2e-64    Glycine max [soybeans]
ref|XP_006595736.1|  PREDICTED: heat shock 70 kDa protein 16-like...    223   3e-64    Glycine max [soybeans]
ref|XP_006468028.1|  PREDICTED: heat shock 70 kDa protein 16-like       222   4e-64    Citrus sinensis [apfelsine]
ref|XP_010493114.1|  PREDICTED: heat shock 70 kDa protein 16-like       220   3e-63    Camelina sativa [gold-of-pleasure]
ref|XP_002889885.1|  hypothetical protein ARALYDRAFT_888478             220   3e-63    
ref|XP_010458573.1|  PREDICTED: heat shock 70 kDa protein 16-like       219   4e-63    Camelina sativa [gold-of-pleasure]
ref|XP_010476099.1|  PREDICTED: heat shock 70 kDa protein 16            219   5e-63    Camelina sativa [gold-of-pleasure]
ref|NP_172631.2|  heat shock protein 70 (Hsp 70) family protein         219   6e-63    Arabidopsis thaliana [mouse-ear cress]
emb|CBI36157.3|  unnamed protein product                                218   1e-62    Vitis vinifera
ref|XP_006417329.1|  hypothetical protein EUTSA_v10006883mg             216   5e-62    Eutrema salsugineum [saltwater cress]
emb|CDY49794.1|  BnaCnng18070D                                          216   5e-62    Brassica napus [oilseed rape]
emb|CDX97975.1|  BnaA06g07260D                                          215   2e-61    
ref|XP_009148495.1|  PREDICTED: heat shock 70 kDa protein 16            215   2e-61    Brassica rapa
ref|XP_009420545.1|  PREDICTED: heat shock 70 kDa protein 16            212   2e-60    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007142282.1|  hypothetical protein PHAVU_008G267400g             211   4e-60    Phaseolus vulgaris [French bean]
ref|XP_010533816.1|  PREDICTED: heat shock 70 kDa protein 16            211   8e-60    Tarenaya hassleriana [spider flower]
gb|EPS74057.1|  hypothetical protein M569_00693                         209   3e-59    Genlisea aurea
ref|XP_006449032.1|  hypothetical protein CICLE_v10014383mg             194   3e-54    
ref|XP_006449031.1|  hypothetical protein CICLE_v10014383mg             194   7e-54    
ref|XP_003082170.1|  heat shock protein 91-Arabidopsis thaliana (...    194   8e-54    
emb|CEF99759.1|  Heat shock protein 70 family                           193   1e-53    Ostreococcus tauri
ref|XP_001695858.1|  heat shock protein 70E                             192   2e-53    Chlamydomonas reinhardtii
ref|XP_002949519.1|  heat shock protein Hsp70E                          192   5e-53    Volvox carteri f. nagariensis
ref|XP_002505210.1|  heat shock protein 70                              191   9e-53    Micromonas commoda
ref|XP_002973871.1|  hypothetical protein SELMODRAFT_267697             186   4e-51    
ref|XP_002969191.1|  hypothetical protein SELMODRAFT_440676             186   5e-51    
ref|XP_003060408.1|  heat shock protein 70                              182   9e-50    Micromonas pusilla CCMP1545
ref|XP_005642775.1|  heat shock protein 70E                             181   4e-49    Coccomyxa subellipsoidea C-169
sp|Q06068.2|HSP97_STRPU  RecName: Full=97 kDa heat shock protein;...    178   6e-48    Strongylocentrotus purpuratus [purple urchin]
ref|NP_999695.1|  97 kDa heat shock protein                             178   7e-48    Strongylocentrotus purpuratus [purple urchin]
sp|Q94738.1|HSP97_STRFN  RecName: Full=97 kDa heat shock protein;...    178   7e-48    Mesocentrotus franciscanus
ref|XP_002585532.1|  hypothetical protein BRAFLDRAFT_111895             171   2e-47    Branchiostoma floridae
gb|KJE91467.1|  hsp97-like protein                                      174   1e-46    Capsaspora owczarzaki ATCC 30864
ref|XP_004349347.1|  hsp97-like protein                                 172   3e-46    Capsaspora owczarzaki ATCC 30864
ref|XP_001641799.1|  predicted protein                                  172   6e-46    Nematostella vectensis
ref|XP_011304595.1|  PREDICTED: 97 kDa heat shock protein isoform X2    172   7e-46    Fopius arisanus
ref|XP_011304586.1|  PREDICTED: 97 kDa heat shock protein isoform X1    172   1e-45    Fopius arisanus
ref|XP_002585896.1|  hypothetical protein BRAFLDRAFT_256670             170   1e-45    Branchiostoma floridae
ref|XP_003485911.1|  PREDICTED: heat shock 70 kDa protein 4L-like       171   2e-45    Bombus impatiens
ref|XP_006561225.1|  PREDICTED: 97 kDa heat shock protein isoform X2    170   3e-45    Apis mellifera [bee]
ref|XP_006615729.1|  PREDICTED: 97 kDa heat shock protein-like is...    170   3e-45    Apis dorsata [rock honeybee]
ref|XP_006615728.1|  PREDICTED: 97 kDa heat shock protein-like is...    170   4e-45    Apis dorsata [rock honeybee]
ref|XP_003691374.1|  PREDICTED: heat shock 70 kDa protein 4L-like       170   4e-45    Apis florea [dwarf honeybee]
ref|XP_623199.2|  PREDICTED: 97 kDa heat shock protein isoformX1        170   4e-45    Apis mellifera [bee]
ref|XP_003394081.1|  PREDICTED: heat shock 70 kDa protein 4L-like       170   6e-45    Bombus terrestris [large earth bumblebee]
ref|XP_003702344.1|  PREDICTED: 97 kDa heat shock protein-like          169   1e-44    Megachile rotundata
ref|XP_011162513.1|  PREDICTED: 97 kDa heat shock protein isoform X2    168   2e-44    Solenopsis invicta [imported red fire ant]
ref|XP_011256245.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    168   2e-44    Camponotus floridanus
ref|XP_011162512.1|  PREDICTED: 97 kDa heat shock protein isoform X1    168   2e-44    Solenopsis invicta [imported red fire ant]
ref|XP_011256244.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    168   3e-44    Camponotus floridanus
ref|XP_011052837.1|  PREDICTED: 97 kDa heat shock protein isoform X2    167   4e-44    Acromyrmex echinatior
ref|XP_011052836.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    167   5e-44    Acromyrmex echinatior
ref|XP_011154271.1|  PREDICTED: heat shock 70 kDa protein 4L            166   1e-43    Harpegnathos saltator
ref|XP_008557094.1|  PREDICTED: 97 kDa heat shock protein isoform X2    166   1e-43    
ref|XP_008557093.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    166   2e-43    Microplitis demolitor
gb|KFM56735.1|  heat shock protein                                      164   3e-43    Stegodyphus mimosarum
gb|EHJ64651.1|  hypothetical protein KGM_00738                          164   5e-43    
ref|XP_005819695.1|  hypothetical protein GUITHDRAFT_166641             163   2e-42    Guillardia theta CCMP2712
ref|XP_008191929.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    161   5e-42    Tribolium castaneum [rust-red flour beetle]
ref|XP_008191928.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    161   6e-42    Tribolium castaneum [rust-red flour beetle]
ref|XP_011399703.1|  97 kDa heat shock protein                          159   6e-42    Auxenochlorella protothecoides
ref|XP_011339673.1|  PREDICTED: 97 kDa heat shock protein isoform X2    161   7e-42    
ref|XP_004927888.1|  PREDICTED: 97 kDa heat shock protein-like          160   8e-42    Bombyx mori [silk moth]
ref|XP_006003281.1|  PREDICTED: heat shock 70 kDa protein 4             160   8e-42    
ref|XP_011339672.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    161   9e-42    Ooceraea biroi
ref|XP_005846866.1|  hypothetical protein CHLNCDRAFT_35731              160   9e-42    Chlorella variabilis
ref|XP_011497941.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    160   9e-42    Ceratosolen solmsi marchali
gb|AEB26316.1|  heat shock protein 105                                  159   9e-42    Helicoverpa armigera [American bollworm]
ref|XP_011497950.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    160   1e-41    Ceratosolen solmsi marchali
gb|ELT92200.1|  hypothetical protein CAPTEDRAFT_221226                  160   1e-41    Capitella teleta
ref|XP_002431004.1|  Heat-shock protein 105 kDa, putative               160   2e-41    Pediculus humanus corporis [human body lice]
ref|XP_003687776.1|  hypothetical protein TPHA_0K02090                  154   4e-40    Tetrapisispora phaffii CBS 4417
dbj|BAA97566.1|  hsp70                                                  154   5e-40    Blastocystis hominis
ref|XP_005837933.1|  hypothetical protein GUITHDRAFT_103535             155   6e-40    
emb|CCL98188.1|  predicted protein                                      155   8e-40    
gb|KFH64507.1|  heat shock 70kDa protein 4                              154   1e-39    
gb|ERL85506.1|  hypothetical protein D910_02925                         155   1e-39    
gb|ENN79035.1|  hypothetical protein YQE_04502                          155   1e-39    
emb|CDH59379.1|  heat shock protein                                     154   1e-39    
emb|CDW59396.1|  heat shock 70 kDa protein 4                            153   1e-39    
gb|KDD72574.1|  heat shock protein Hsp70                                144   2e-39    
emb|CDS05536.1|  hypothetical protein LRAMOSA08064                      154   2e-39    
ref|XP_005177158.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    154   2e-39    
gb|KDR19282.1|  Heat shock 70 kDa protein 4L                            154   2e-39    
ref|XP_005177155.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    154   2e-39    
ref|XP_008202915.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    154   3e-39    
ref|XP_008202916.1|  PREDICTED: heat shock 70 kDa protein 4L isof...    153   3e-39    
emb|CDY32364.1|  BnaC01g36830D                                          147   4e-39    
ref|XP_011190144.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    153   4e-39    
emb|CDS10615.1|  hypothetical protein LRAMOSA11101                      153   4e-39    
ref|XP_011190138.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    153   5e-39    
dbj|BAC35620.1|  unnamed protein product                                145   6e-39    
ref|XP_005242837.1|  PREDICTED: heat shock 70 kDa protein 4             152   7e-39    
gb|AAA35095.1|  70kDal heat shock protein                               147   8e-39    
ref|XP_005703010.1|  molecular chaperone DnaK                           152   9e-39    
ref|XP_011199483.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    152   1e-38    
gb|AAH60431.1|  LOC398863 protein                                       147   1e-38    
gb|KIK59701.1|  hypothetical protein GYMLUDRAFT_201113                  150   1e-38    
ref|XP_011199479.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    152   1e-38    
dbj|GAN04884.1|  heat shock protein                                     151   1e-38    
emb|CEG71289.1|  Putative Heat shock 70kDa protein 4                    151   2e-38    
dbj|BAK07442.1|  predicted protein                                      150   3e-38    
ref|XP_806460.1|  heat shock 70 kDa protein                             143   3e-38    
emb|CEP19347.1|  hypothetical protein                                   150   3e-38    
ref|XP_005537819.1|  heat shock protein Hsp70, cytosolic                149   3e-38    
gb|AAH41515.1|  Hspa4 protein                                           145   3e-38    
ref|XP_005944289.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    150   4e-38    
ref|XP_004519098.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    150   4e-38    
gb|EXL46975.1|  heat shock 70kDa protein 4                              149   4e-38    
gb|KIR24989.1|  hsp72-like protein                                      141   4e-38    
gb|AAB34280.1|  70 kda heat shock protein                               143   4e-38    
emb|CDO64077.1|  heat shock protein 70, putative                        149   4e-38    
ref|XP_005523757.1|  PREDICTED: heat shock 70 kDa protein 4             150   4e-38    
ref|XP_002168044.1|  PREDICTED: heat shock protein 105 kDa-like         150   4e-38    
ref|XP_006785040.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    150   4e-38    
ref|XP_005944288.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    150   4e-38    
gb|EWZ00894.1|  heat shock 70kDa protein 4                              149   4e-38    
gb|EXK91660.1|  heat shock 70kDa protein 4                              149   5e-38    
gb|ENH63096.1|  Heat shock protein Hsp88                                149   5e-38    
ref|XP_004519096.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    150   5e-38    
ref|XP_005727828.1|  PREDICTED: heat shock 70 kDa protein 4-like        150   5e-38    
ref|XP_004550423.1|  PREDICTED: heat shock 70 kDa protein 4-like        150   5e-38    
ref|XP_005053752.1|  PREDICTED: heat shock 70 kDa protein 4             150   5e-38    
ref|NP_009396.2|  Hsp70 family ATPase SSA1                              148   5e-38    
gb|AAC04952.1|  Ssa1p: Heat shock protein of HSP70 family               148   6e-38    
ref|XP_001951792.1|  PREDICTED: heat shock 70 kDa protein 4             150   6e-38    
emb|CEI91389.1|  Putative Heat shock 70kDa protein 4                    149   6e-38    
ref|XP_004338433.1|  HSP91 (Heat shock protein 91), putative            150   6e-38    
ref|XP_007389090.1|  heat shock protein 70                              148   6e-38    
gb|EGA59895.1|  Ssa1p                                                   148   7e-38    
gb|EPB87687.1|  heat shock 70kDa protein 4                              149   7e-38    
gb|EGA63465.1|  Ssa1p                                                   148   7e-38    
gb|EDN59758.1|  stress-seventy subfamily A protein                      148   7e-38    
ref|XP_002021371.1|  GL25289                                            147   7e-38    
gb|EGU79387.1|  hypothetical protein FOXB_10111                         149   7e-38    
gb|KHJ49442.1|  hypothetical protein D918_00568                         150   8e-38    
gb|AJO93117.1|  Ssa1p                                                   148   8e-38    
gb|EXK91659.1|  heat shock 70kDa protein 4                              149   8e-38    
gb|EWZ00893.1|  heat shock 70kDa protein 4                              149   8e-38    
gb|AJO98092.1|  Ssa1p                                                   148   8e-38    
gb|AJO97872.1|  Ssa1p                                                   148   8e-38    
gb|AJO96370.1|  Ssa1p                                                   148   8e-38    
gb|AJO93829.1|  Ssa1p                                                   148   8e-38    
emb|CAY77648.1|  Ssa1p                                                  148   8e-38    
emb|CCT73085.1|  probable heat shock protein Hsp88                      149   8e-38    
gb|EWG47059.1|  hsp88-like protein                                      149   8e-38    
gb|EXL46974.1|  heat shock 70kDa protein 4                              149   8e-38    
gb|EPT05848.1|  hypothetical protein FOMPIDRAFT_1021055                 147   8e-38    
ref|XP_002193589.1|  PREDICTED: heat shock 70 kDa protein 4             149   8e-38    
gb|AJO96221.1|  Ssa1p                                                   148   8e-38    
gb|AJO92970.1|  Ssa1p                                                   148   8e-38    
gb|AGM32458.1|  cytoplasmic heat shock protein 70                       143   8e-38    
gb|AHY74361.1|  Ssa1p                                                   148   9e-38    
gb|EKF27699.1|  heat shock 70 kDa protein, putative                     143   9e-38    
ref|XP_003446983.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    149   9e-38    
gb|EDL33602.1|  heat shock protein 4, isoform CRA_b                     145   1e-37    
gb|EDM04372.1|  heat shock protein 4, isoform CRA_a                     144   1e-37    
gb|AJO92307.1|  Ssa1p                                                   147   1e-37    
ref|XP_009462627.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    149   1e-37    
gb|AJO96439.1|  Ssa1p                                                   147   1e-37    
gb|AJO92385.1|  Ssa1p                                                   147   1e-37    
ref|XP_001366416.1|  PREDICTED: heat shock 70 kDa protein 4             149   1e-37    
gb|AJO92605.1|  Ssa1p                                                   147   1e-37    
gb|AJO92527.1|  Ssa1p                                                   147   1e-37    
gb|KHN76490.1|  Uncharacterized protein C30C11.4                        147   1e-37    
gb|AJO97289.1|  Ssa1p                                                   147   1e-37    
gb|KFQ96406.1|  Heat shock 70 kDa protein 4                             149   1e-37    
ref|NP_498868.1|  Protein C30C11.4                                      149   1e-37    
gb|AGO01983.1|  heat shock 70kDa protein 4b                             149   1e-37    
ref|XP_009462626.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    149   1e-37    
ref|XP_010577101.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    149   1e-37    
emb|CBK24647.2|  unnamed protein product                                147   1e-37    
emb|CBK24438.2|  unnamed protein product                                147   1e-37    
ref|XP_006220075.1|  PREDICTED: heat shock 70 kDa protein A-like        140   1e-37    
ref|XP_811549.1|  heat shock 70 kDa protein                             142   1e-37    
ref|XP_009900615.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    149   1e-37    
ref|XP_011317805.1|  heat shock protein Hsp88                           148   1e-37    
gb|AJO92897.1|  Ssa1p                                                   147   1e-37    
gb|KFD57756.1|  hypothetical protein M513_01426                         149   1e-37    
gb|KFQ04337.1|  Heat shock 70 kDa protein 4                             149   1e-37    
ref|XP_005512494.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    149   1e-37    
gb|KFV68743.1|  Heat shock 70 kDa protein 4                             149   1e-37    
ref|XP_009900614.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    149   1e-37    
ref|XP_009089808.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    149   1e-37    
ref|XP_009959027.1|  PREDICTED: heat shock 70 kDa protein 4             149   2e-37    
ref|XP_005493118.1|  PREDICTED: heat shock 70 kDa protein 4             149   2e-37    
ref|XP_002175605.1|  heat shock protein Pss1                            148   2e-37    
gb|KFB38249.1|  AGAP010331-PA-like protein                              148   2e-37    
ref|XP_009089807.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    149   2e-37    
ref|XP_007003338.1|  hypothetical protein TREMEDRAFT_43142              147   2e-37    
ref|XP_002119191.1|  PREDICTED: heat shock 70 kDa protein 4L            149   2e-37    
gb|AJO92679.1|  Ssa1p                                                   147   2e-37    
ref|XP_009547862.1|  hypothetical protein HETIRDRAFT_385937             148   2e-37    
gb|ACZ95778.1|  heat shock protein 70                                   146   2e-37    
gb|KIM45604.1|  hypothetical protein M413DRAFT_442264                   148   2e-37    
ref|XP_009089806.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    148   2e-37    
ref|XP_005147344.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock 7...    148   2e-37    
ref|XP_011102369.1|  ssa1p                                              147   2e-37    
ref|XP_011104412.1|  ssa2p                                              147   2e-37    
gb|KFO70037.1|  Heat shock 70 kDa protein 4                             148   2e-37    
ref|XP_009260564.1|  hypothetical protein FPSE_09172                    148   2e-37    
gb|EMT66433.1|  Heat shock protein Hsp88                                149   2e-37    
ref|XP_009560733.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    148   2e-37    
emb|CDO70718.1|  hypothetical protein BN946_scf184798.g33               146   2e-37    
gb|ADG37835.1|  AT1G11660-like protein                                  139   2e-37    
emb|CAA81135.1|  heat shock protein                                     146   3e-37    
gb|ADG37836.1|  AT1G11660-like protein                                  139   3e-37    
ref|XP_003738350.1|  PREDICTED: heat shock 70 kDa protein 4-like        148   3e-37    
gb|ADG37833.1|  AT1G11660-like protein                                  139   3e-37    
emb|CEF74161.1|  unnamed protein product                                148   3e-37    
gb|KGB79179.1|  glucose-regulated protein                               141   3e-37    
ref|XP_009560725.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    148   3e-37    
ref|XP_003104191.1|  hypothetical protein CRE_00953                     147   3e-37    
ref|XP_005991355.1|  PREDICTED: heat shock 70 kDa protein 4L            148   3e-37    
gb|AAC72001.1|  heat shock protein 70                                   146   3e-37    
gb|EHN03816.1|  Ssa1p                                                   146   3e-37    
gb|AAC26629.1|  heat shock protein 70                                   146   3e-37    
gb|AEX60710.1|  Hsp70-x                                                 147   3e-37    
gb|ETW18876.1|  hsp70-like protein                                      147   3e-37    
ref|XP_008882675.1|  heat shock protein HSP70                           146   3e-37    
ref|XP_002365977.1|  heat shock protein 70, putative                    146   3e-37    
ref|XP_006128593.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    148   3e-37    
gb|ADG37834.1|  AT1G11660-like protein                                  139   4e-37    
ref|XP_008469279.1|  PREDICTED: heat shock protein 105 kDa-like         145   4e-37    
emb|CDJ62090.1|  Heat shock protein, related                            146   4e-37    
emb|CAA47886.1|  HS24/P52                                               145   4e-37    
ref|XP_004384781.1|  PREDICTED: heat shock 70 kDa protein 4             147   4e-37    
gb|EHN08715.1|  Ssa1p                                                   146   4e-37    
ref|XP_008598905.1|  heat shock protein 70-2                            146   4e-37    
ref|XP_001353537.2|  GA19716                                            147   4e-37    
ref|XP_003405063.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    147   4e-37    
ref|XP_010727629.1|  PREDICTED: heat shock 70 kDa protein 4-like        147   4e-37    
gb|KDR08212.1|  Heat shock 70 kDa protein cognate 2                     146   4e-37    
ref|XP_010588220.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    147   4e-37    
ref|XP_004180736.1|  hypothetical protein TBLA_0E01600                  146   4e-37    
ref|XP_003883640.1|  Heat shock protein 70, related                     146   4e-37    
ref|XP_004686775.1|  PREDICTED: heat shock 70 kDa protein 4             147   4e-37    
ref|XP_010753054.1|  PREDICTED: heat shock 70 kDa protein 4             147   4e-37    
gb|ETW31578.1|  hsp70-like protein                                      146   5e-37    
ref|XP_005805507.1|  PREDICTED: heat shock 70 kDa protein 4-like        147   5e-37    
ref|XP_007270891.1|  chaperone protein BipA                             146   5e-37    
gb|AAZ05448.1|  Hsp70                                                   138   5e-37    
ref|XP_003040092.1|  predicted protein                                  147   5e-37    
ref|XP_002061724.1|  GK17034                                            147   5e-37    
ref|XP_007461414.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    147   5e-37    
gb|AFJ20626.1|  heat shock protein 70                                   145   5e-37    
gb|KDQ18475.1|  hypothetical protein BOTBODRAFT_154372                  145   5e-37    
gb|EJU05725.1|  heat shock protein 70                                   145   5e-37    
ref|NP_013076.1|  Hsp70 family chaperone SSA2                           145   5e-37    
ref|XP_006631871.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    147   5e-37    
gb|EHN01353.1|  Ssa2p                                                   145   5e-37    
ref|XP_006631870.1|  PREDICTED: heat shock 70 kDa protein 4-like ...    147   5e-37    
ref|XP_007461413.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    147   5e-37    
gb|KIK06501.1|  hypothetical protein K443DRAFT_674159                   145   5e-37    
gb|AHY78385.1|  Ssa2p                                                   145   5e-37    
gb|EDM04373.1|  heat shock protein 4, isoform CRA_b                     144   5e-37    
emb|CCD18698.1|  heat shock protein 70, putative, (fragment)            139   5e-37    
ref|XP_004456539.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    147   6e-37    
emb|CAY81214.1|  Ssa2p                                                  145   6e-37    
ref|XP_006065134.1|  PREDICTED: heat shock 70 kDa protein 4-like        147   6e-37    
gb|EHK40353.1|  hypothetical protein TRIATDRAFT_128447                  145   6e-37    
ref|XP_004420257.1|  PREDICTED: heat shock 70 kDa protein 4             147   6e-37    
ref|XP_004456538.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    147   6e-37    
ref|XP_008036836.1|  heat shock protein                                 145   6e-37    
emb|CDH09973.1|  Heat shock protein SSA2                                145   6e-37    
ref|XP_001956442.1|  GF24591                                            147   6e-37    
ref|XP_003959054.1|  hypothetical protein KAFR_0I01380                  145   6e-37    
gb|EGA85730.1|  Ssa2p                                                   145   6e-37    
ref|XP_010929169.1|  PREDICTED: heat shock 70 kDa protein-like          145   6e-37    
gb|EDN59524.1|  stress-seventy subfamily A protein                      145   6e-37    
dbj|BAF02623.1|  heat shock protein 70                                  145   6e-37    
emb|CEI88073.1|  Putative Hsp71-like protein                            141   6e-37    
gb|EGA57719.1|  Ssa2p                                                   145   6e-37    
ref|XP_805703.1|  heat shock 70 kDa protein                             143   6e-37    
gb|EDV09289.1|  heat shock protein SSA2                                 145   6e-37    
dbj|GAA24864.1|  K7_Ssa2p                                               145   7e-37    
gb|ABD85255.1|  heat shock protein 70                                   137   7e-37    
ref|XP_003029248.1|  hypothetical protein SCHCODRAFT_69395              147   7e-37    
gb|KCW67009.1|  hypothetical protein EUGRSUZ_F00767                     146   7e-37    
ref|NP_648687.1|  Hsc70Cb, isoform A                                    147   7e-37    
ref|NP_001189103.1|  Hsc70Cb, isoform G                                 147   7e-37    
gb|AAA02807.1|  heat shock protein 70                                   146   7e-37    
emb|CDF44000.1|  hypothetical protein BofuT4P114000012001               145   7e-37    
ref|XP_002030454.1|  GM25449                                            147   7e-37    
gb|EKF38332.1|  heat shock 70 kDa protein, putative                     142   7e-37    
gb|AAZ05449.1|  Hsp70                                                   137   7e-37    
ref|XP_008271748.1|  PREDICTED: heat shock protein 105 kDa isofor...    147   8e-37    
ref|XP_006734733.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    147   8e-37    
ref|XP_006734734.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    147   8e-37    
ref|XP_004408329.1|  PREDICTED: heat shock 70 kDa protein 4             147   8e-37    
ref|XP_006923201.1|  PREDICTED: heat shock 70 kDa protein 4             147   8e-37    
ref|XP_004896768.1|  PREDICTED: heat shock 70 kDa protein 4             147   8e-37    
ref|XP_005890481.1|  PREDICTED: heat shock 70 kDa protein 4 isofo...    147   9e-37    
ref|NP_001083317.1|  heat shock 70kDa protein 4                         147   9e-37    



>ref|XP_009761607.1| PREDICTED: heat shock 70 kDa protein 15-like, partial [Nicotiana 
sylvestris]
Length=263

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 177/205 (86%), Gaps = 8/205 (4%)
 Frame = +2

Query  14   EERVLEYTCALLLARSFRHFLL--CLLPVFRSVGL*LLLATKMSVVGFDVGNESCVVAVA  187
            + R LE+    +L   F+ F++  CL    R V L   +  KMSVVGFD GNES VVAVA
Sbjct  47   QSRTLEHRFQKILFYVFKEFVITDCLT---RGVAL---MPAKMSVVGFDFGNESGVVAVA  100

Query  188  RQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNPKNTISQVKRLIGRQFSDP  367
            RQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNPKNTISQ+KRLIGRQFSDP
Sbjct  101  RQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNPKNTISQIKRLIGRQFSDP  160

Query  368  ELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGMVLSNLKSIAETNLNAAVV  547
            ELQRDLK+ PFSVTEGPDG+PLIHARYLGEMRTFTPTQVLGMV S+LK+IAE NLNAAVV
Sbjct  161  ELQRDLKALPFSVTEGPDGYPLIHARYLGEMRTFTPTQVLGMVFSDLKTIAEKNLNAAVV  220

Query  548  DCCIGIPVYFTDLQRRAVIDAATIA  622
            DCCIGIP+YFTDLQRRAV+DAATIA
Sbjct  221  DCCIGIPIYFTDLQRRAVMDAATIA  245



>ref|XP_011072334.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
 ref|XP_011072335.1| PREDICTED: heat shock 70 kDa protein 15-like [Sesamum indicum]
Length=845

 Score =   327 bits (837),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAATSMMNP
Sbjct  1    MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAATSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDPELQRDLKS PF VTEGPDG+PLIHARYLGE RTFTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKSLPFLVTEGPDGYPLIHARYLGETRTFTPTQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  163



>ref|XP_007024113.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
 gb|EOY26735.1| Heat shock protein 91 isoform 2 [Theobroma cacao]
Length=575

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PFSVTEGPDG+PLIHARYLGEM+TFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFSVTEGPDGYPLIHARYLGEMKTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLS+LKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSDLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>gb|KHG16619.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=855

 Score =   323 bits (827),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>gb|KJB35057.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=628

 Score =   317 bits (812),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V SNLKSIAE NL AAVVDCCIGIPVYFT+LQRRAV+DAATIA
Sbjct  121  VFSNLKSIAEQNLKAAVVDCCIGIPVYFTELQRRAVLDAATIA  163



>ref|XP_007024112.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
 gb|EOY26734.1| Heat shock protein 91 isoform 1 [Theobroma cacao]
Length=860

 Score =   322 bits (824),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PFSVTEGPDG+PLIHARYLGEM+TFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFSVTEGPDGYPLIHARYLGEMKTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLS+LKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSDLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>gb|KJB70511.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=749

 Score =   318 bits (815),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRSFTPTQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VL NLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLLNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010539495.1| PREDICTED: heat shock 70 kDa protein 15-like [Tarenaya hassleriana]
Length=866

 Score =   321 bits (822),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 162/167 (97%), Gaps = 0/167 (0%)
 Frame = +2

Query  122  LATKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATS  301
            +  KMSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++
Sbjct  17   IKAKMSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAAST  76

Query  302  MMNPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQ  481
            MMNPK+++SQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQ
Sbjct  77   MMNPKSSVSQIKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGEMRTFTPTQ  136

Query  482  VLGMVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V+GMVLSNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  137  VMGMVLSNLKSIAENNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  183



>ref|XP_002528199.1| Heat shock 70 kDa protein, putative [Ricinus communis]
 gb|EEF34206.1| Heat shock 70 kDa protein, putative [Ricinus communis]
Length=849

 Score =   319 bits (817),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GRQFSDPELQ+DLKS PF+VTEGPDGFPLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLVGRQFSDPELQKDLKSLPFAVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLS+LK IAE NLNAAVVDCCIGIP YFTDLQRRAV+DAATIA
Sbjct  121  VLSDLKGIAEKNLNAAVVDCCIGIPAYFTDLQRRAVMDAATIA  163



>gb|KJB70509.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
 gb|KJB70510.1| hypothetical protein B456_011G076800 [Gossypium raimondii]
Length=855

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFNVTEGPDGYPLIHARYLGEMRSFTPTQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VL NLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLLNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>gb|KJB35056.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
 gb|KJB35058.1| hypothetical protein B456_006G098500 [Gossypium raimondii]
Length=856

 Score =   319 bits (817),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V SNLKSIAE NL AAVVDCCIGIPVYFT+LQRRAV+DAATIA
Sbjct  121  VFSNLKSIAEQNLKAAVVDCCIGIPVYFTELQRRAVLDAATIA  163



>gb|KHG16198.1| Heat shock 70 kDa 15 -like protein [Gossypium arboreum]
Length=856

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PF+VTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFNVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V SNLKSIAE NL AAVVDCCIGIPVYFT+LQRRAV+DAATIA
Sbjct  121  VFSNLKSIAEQNLKAAVVDCCIGIPVYFTELQRRAVLDAATIA  163



>ref|XP_009624163.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=854

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK+IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAATIA
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIPIYFTDLQRRAVMDAATIA  163



>gb|KDO51190.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=726

 Score =   315 bits (807),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK+IAE+NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  163



>ref|XP_006389708.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
 gb|ESQ26994.1| hypothetical protein EUTSA_v100181451mg, partial [Eutrema salsugineum]
Length=569

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA++CFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIICFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+P+IHARYLGEMR FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPMIHARYLGEMRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE N+NAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNMNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010538015.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
 ref|XP_010538016.1| PREDICTED: heat shock 70 kDa protein 14 [Tarenaya hassleriana]
Length=829

 Score =   317 bits (813),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+++SQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGEMRTFTPTQV+GM
Sbjct  61   KSSVSQIKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGEMRTFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKSIAENNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>gb|KDP37205.1| hypothetical protein JCGZ_06261 [Jatropha curcas]
Length=847

 Score =   317 bits (813),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+V+EGPDGFPLIHARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQKDLKSLPFAVSEGPDGFPLIHARYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLNAAVVDCCIGIP YFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEKNLNAAVVDCCIGIPAYFTDLQRRAVLDAATIA  163



>ref|XP_011080863.1| PREDICTED: heat shock 70 kDa protein 14-like [Sesamum indicum]
Length=856

 Score =   317 bits (812),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPALVCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPALVCFGDKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDPELQRDLKS PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKSLPFLVTEGPDGYPLIHARYLGENRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIA  163



>gb|ACF83633.1| unknown [Zea mays]
Length=293

 Score =   301 bits (770),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_004252333.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=846

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDPELQRDLK+ PF VTEGPDG+PLIHARYLGEMRTFTPTQV+GM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDLKALPFLVTEGPDGYPLIHARYLGEMRTFTPTQVVGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK+IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIA  163



>ref|XP_010521527.1| PREDICTED: heat shock 70 kDa protein 15 [Tarenaya hassleriana]
Length=832

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS P++VTEGPDG+PLIHAR+LGEMRTFTPTQV+GM
Sbjct  61   KNSISQMKRLIGRQFSDPELQRDIKSLPYTVTEGPDGYPLIHARFLGEMRTFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAETNLNAAVVDCCIGIPVYFT+LQRRAV+DAATIA
Sbjct  121  VLSNLKSIAETNLNAAVVDCCIGIPVYFTELQRRAVLDAATIA  163



>gb|KDO51188.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=833

 Score =   315 bits (808),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK+IAE+NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  163



>gb|KDO51189.1| hypothetical protein CISIN_1g003056mg [Citrus sinensis]
Length=852

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK+IAE+NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  163



>ref|XP_006427039.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
 gb|ESR40279.1| hypothetical protein CICLE_v10024883mg [Citrus clementina]
Length=852

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK+IAE+NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  163



>ref|XP_006465548.1| PREDICTED: heat shock 70 kDa protein 14-like [Citrus sinensis]
Length=852

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETP++VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK+IAE+NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  LLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  163



>ref|XP_003546366.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
 gb|KHM98765.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=863

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLK+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDLKTFPFVVTEGPDGYPLIHARYLGEARTFTPTQVFGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIPLYFTDLQRRAVLDAATIA  163



>gb|EPS63387.1| hypothetical protein M569_11394, partial [Genlisea aurea]
Length=391

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPALVCFG+KQRFLGTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPALVCFGDKQRFLGTAGAASSLMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+SQ+KRLIGR+FSDPELQ DLK  PFSV+EGPDGFPLIHARYL E + FTPTQVLGM
Sbjct  61   KNTVSQIKRLIGRKFSDPELQSDLKVLPFSVSEGPDGFPLIHARYLRENKAFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V SNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  VFSNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  163



>ref|XP_010249783.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010249784.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=850

 Score =   313 bits (802),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQ+DLK+ PF+VTEGPDG+PLIHARYLGE R FTPTQ+LGM
Sbjct  61   KNSISQIKRLIGRQFSDPELQQDLKALPFTVTEGPDGYPLIHARYLGESRVFTPTQLLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLS+LKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSDLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_002279789.2| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654673.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
 ref|XP_010654674.1| PREDICTED: heat shock 70 kDa protein 14-like [Vitis vinifera]
Length=848

 Score =   313 bits (802),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPDG+PLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNSISQMKRLIGRQFSDPELQQDLKSLPFTVTEGPDGYPLIHARYLGEVRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + SNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MFSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_006346576.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum tuberosum]
Length=847

 Score =   312 bits (800),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDPELQ+DLK+ PF VTEGPDG+PLIHA YLGEMRTFTPTQV+GM
Sbjct  61   KNTISQIKRLIGRQFSDPELQKDLKALPFLVTEGPDGYPLIHAHYLGEMRTFTPTQVVGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK+IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIA  163



>ref|XP_009801414.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana sylvestris]
Length=846

 Score =   312 bits (800),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGR+F DPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMR+FTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFLDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRSFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIA  163



>ref|XP_009610837.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Nicotiana 
tomentosiformis]
Length=780

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGR+FSDPELQRD+K+ PFSVTEGPDG+PLIHA YLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFSDPELQRDIKALPFSVTEGPDGYPLIHALYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK+IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAA IA
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIPIYFTDLQRRAVMDAAMIA  163



>emb|CDO98063.1| unnamed protein product [Coffea canephora]
Length=858

 Score =   312 bits (799),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGR FSDPELQRDLK+ PF+VTEGPDGFPLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNTISQMKRLIGRPFSDPELQRDLKALPFTVTEGPDGFPLIHARYLGELRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LKSIA+ NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFSDLKSIAQKNLNAAVVDCCIGIPVYFTDLQRRAVVDAATIA  163



>ref|XP_006300740.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
 gb|EOA33638.1| hypothetical protein CARUB_v10019803mg [Capsella rubella]
Length=828

 Score =   311 bits (796),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGEMR FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEMRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTD+QRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDIQRRAVLDAATIA  163



>ref|XP_003543647.1| PREDICTED: heat shock 70 kDa protein 14-like [Glycine max]
Length=863

 Score =   311 bits (798),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQF+DPELQ+D+K+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFADPELQQDIKTFPFVVTEGPDGYPLIHARYLGESRTFTPTQVFGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIPLYFTDLQRRAVLDAATIA  163



>gb|KHN32604.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=862

 Score =   311 bits (798),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQF+DPELQ+D+K+FPF VTEGPDG+PLIHARYLGE RTFTPTQV GM
Sbjct  61   KNSISQIKRLIGRQFADPELQQDIKTFPFVVTEGPDGYPLIHARYLGESRTFTPTQVFGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIPLYFTDLQRRAVLDAATIA  163



>ref|XP_010915054.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=853

 Score =   311 bits (797),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFVGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQ+KRL+GR+FSDPELQRDL+S PF VTEGPDGFPLIHARYLGE RTFTPTQVL M
Sbjct  61   KNSVSQIKRLLGRKFSDPELQRDLQSLPFLVTEGPDGFPLIHARYLGEQRTFTPTQVLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLS+LKSIAE NL AAVVDCCIGIP YFTDLQRRAV+DAATIA
Sbjct  121  VLSDLKSIAEKNLGAAVVDCCIGIPAYFTDLQRRAVLDAATIA  163



>gb|EYU24689.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=573

 Score =   304 bits (779),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDES R TPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESNRLTPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDPELQ D+KS PFSVTEGPDG+PLIHA YLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQHDIKSLPFSVTEGPDGYPLIHAHYLGESRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  163



>gb|EYU21549.1| hypothetical protein MIMGU_mgv1a001311mg [Erythranthe guttata]
Length=842

 Score =   311 bits (796),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDPELQRD+KS PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKSLPFLVTEGPDGYPLIHARYLGETRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK IAE NLN AVVDCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  VFSDLKIIAEKNLNTAVVDCCIGIPVYFTDLQRRAVIDAATIA  163



>ref|XP_010033884.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53736.1| hypothetical protein EUGRSUZ_J02991 [Eucalyptus grandis]
Length=874

 Score =   311 bits (798),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDSGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGR+FSDPELQRDL+S PF VTEGP+G+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRKFSDPELQRDLQSLPFQVTEGPEGYPLIHARYLGESRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + SNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MFSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010925328.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=851

 Score =   311 bits (797),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQRDL+S PF VTEG DGFPLIHARYLGE RTFTPTQVL M
Sbjct  61   KNSISQIKRLVGRKFSDPELQRDLQSLPFLVTEGADGFPLIHARYLGEQRTFTPTQVLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAE NL+AAVVDCCIGIPVYFTDLQRRAV+DAA IA
Sbjct  121  VLSNLKSIAEKNLSAAVVDCCIGIPVYFTDLQRRAVLDAAAIA  163



>ref|XP_004252334.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
 ref|XP_010314276.1| PREDICTED: heat shock 70 kDa protein 15-like [Solanum lycopersicum]
Length=852

 Score =   311 bits (797),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDPELQRD+K+ PF VTEGPDG+PLIHARYLGE+RTFTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKTLPFLVTEGPDGYPLIHARYLGEVRTFTPTQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK+IAE NLNA VVDCCIGIP+YFTDLQRRAV+DAATIA
Sbjct  121  VFSDLKTIAEKNLNAVVVDCCIGIPIYFTDLQRRAVMDAATIA  163



>ref|XP_009587742.1| PREDICTED: heat shock 70 kDa protein 15-like [Nicotiana tomentosiformis]
Length=844

 Score =   311 bits (796),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGR+F DPELQRDLK+ PFSVTEGPDG+PLIHARYLGEMR+FTPTQ+LGM
Sbjct  61   KNTISQIKRLIGRKFVDPELQRDLKALPFSVTEGPDGYPLIHARYLGEMRSFTPTQLLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIA  163



>ref|XP_010254149.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254150.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
 ref|XP_010254151.1| PREDICTED: heat shock 70 kDa protein 15-like [Nelumbo nucifera]
Length=851

 Score =   311 bits (796),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FGEKQRF+GTAGAA++ MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVSFGEKQRFIGTAGAASTTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FTPTQVLGM
Sbjct  61   KNSISQLKRLIGRQFSDPELQRDLKSLPFTVTEGPDGYPLIHARYLGESRVFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAE NLNAAVVDCCIGIP YFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIPAYFTDLQRRAVLDAATIA  163



>ref|XP_007150665.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
 gb|ESW22659.1| hypothetical protein PHAVU_005G171400g [Phaseolus vulgaris]
Length=865

 Score =   311 bits (797),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRFLGTAGAAT+MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFLGTAGAATTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+K LIGRQFSDPELQRDLK++PF VTEGPDG+PLIHARYLG+++TFTPTQV GM
Sbjct  61   KNSISQIKSLIGRQFSDPELQRDLKTYPFLVTEGPDGYPLIHARYLGDVKTFTPTQVFGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKEIAEKNLNAAVVDCCIGIPLYFTDLQRRAVLDAATIA  163



>ref|XP_008354138.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=558

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIA  163



>ref|XP_002304187.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE79166.1| heat shock protein 70 [Populus trichocarpa]
Length=858

 Score =   311 bits (796),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK IA+ NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFSDLKIIAQKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_009610834.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610835.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009610836.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Nicotiana 
tomentosiformis]
Length=856

 Score =   311 bits (796),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGR+FSDPELQRD+K+ PFSVTEGPDG+PLIHA YLGEMRTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRKFSDPELQRDIKALPFSVTEGPDGYPLIHALYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK+IAE NLNAAVVDCCIGIP+YFTDLQRRAV+DAA IA
Sbjct  121  VFSDLKTIAEKNLNAAVVDCCIGIPIYFTDLQRRAVMDAAMIA  163



>ref|XP_006392781.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
 gb|ESQ30067.1| hypothetical protein EUTSA_v10011242mg [Eutrema salsugineum]
Length=829

 Score =   310 bits (794),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGERRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>emb|CDY43337.1| BnaC04g25190D [Brassica napus]
Length=889

 Score =   311 bits (797),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/166 (86%), Positives = 157/166 (95%), Gaps = 0/166 (0%)
 Frame = +2

Query  125  ATKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSM  304
            A +MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++M
Sbjct  73   ALRMSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTM  132

Query  305  MNPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQV  484
            MNPKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV
Sbjct  133  MNPKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQV  192

Query  485  LGMVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +GM+LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  193  MGMMLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  238



>emb|CDX76065.1| BnaA04g03290D [Brassica napus]
Length=814

 Score =   309 bits (792),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010430044.1| PREDICTED: heat shock 70 kDa protein 15 [Camelina sativa]
Length=830

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010417777.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Camelina 
sativa]
Length=829

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010473009.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   310 bits (793),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010417776.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Camelina 
sativa]
Length=829

 Score =   310 bits (793),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010473008.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=830

 Score =   310 bits (793),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010691292.1| PREDICTED: heat shock 70 kDa protein 15-like [Beta vulgaris subsp. 
vulgaris]
Length=850

 Score =   310 bits (793),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQ+SDPELQRDLKS PF+V EGPDGFPLIHARYLGE R FTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQYSDPELQRDLKSLPFTVAEGPDGFPLIHARYLGETRAFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + SNLKSIA  NLNAAVVDCCIGIPVYFTDLQRRAV DAA IA
Sbjct  121  LFSNLKSIAAQNLNAAVVDCCIGIPVYFTDLQRRAVQDAAVIA  163



>gb|AAG52244.1|AC011717_12 putative heat-shock protein; 41956-44878 [Arabidopsis thaliana]
Length=736

 Score =   307 bits (787),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010430043.1| PREDICTED: heat shock 70 kDa protein 15-like [Camelina sativa]
Length=829

 Score =   309 bits (792),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFS+TEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSITEGPDGYPLIHANYLGEVRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010033879.1| PREDICTED: heat shock 70 kDa protein 14-like [Eucalyptus grandis]
 gb|KCW53729.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
 gb|KCW53730.1| hypothetical protein EUGRSUZ_J02987 [Eucalyptus grandis]
Length=851

 Score =   310 bits (793),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+V VARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVGVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+G++F+DPELQRDL+S PF VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNSISQMKRLVGQKFADPELQRDLQSLPFHVTEGPDGYPLIHARYLGEARTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + SNLKSIAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MFSNLKSIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010098045.1| Heat shock 70 kDa protein 15 [Morus notabilis]
 gb|EXB74482.1| Heat shock 70 kDa protein 15 [Morus notabilis]
Length=860

 Score =   310 bits (793),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLG 
Sbjct  61   KNSISQIKRLIGRQFSDPELQKDLKSLPFTVTEGPDGYPLIHARYLGEARTFTPTQVLGT  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V ++LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFADLKVIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_009147592.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
 ref|XP_009147593.1| PREDICTED: heat shock 70 kDa protein 14 [Brassica rapa]
Length=818

 Score =   308 bits (790),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GN++C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNDNCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_006346577.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006346578.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Solanum 
tuberosum]
Length=849

 Score =   309 bits (792),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE  VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNERGVVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDPELQRD+K+ PF VTEGPDG+PLIHARYLGE+RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQRDIKTLPFLVTEGPDGYPLIHARYLGEVRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK+IAE NLNA VVDCCIGIP+YFTDLQRRAV+DAATIA
Sbjct  121  VFSDLKTIAEKNLNAVVVDCCIGIPIYFTDLQRRAVMDAATIA  163



>ref|XP_011000832.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Populus 
euphratica]
Length=789

 Score =   308 bits (788),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRLFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V ++LK I + NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|NP_850984.4| Heat shock protein 70 [Arabidopsis thaliana]
 sp|F4HQD4.1|HSP7P_ARATH RecName: Full=Heat shock 70 kDa protein 15; AltName: Full=Heat 
shock protein 70-15; Short=AtHsp70-15 [Arabidopsis thaliana]
 gb|AEE36325.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   308 bits (790),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>gb|AAL38353.1| putative heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   308 bits (790),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|NP_178110.6| Heat shock protein 70 [Arabidopsis thaliana]
 gb|AEE36326.1| Heat shock protein 70 [Arabidopsis thaliana]
Length=831

 Score =   308 bits (789),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE+R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_009139126.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
 ref|XP_009139127.1| PREDICTED: heat shock 70 kDa protein 15 [Brassica rapa]
Length=814

 Score =   308 bits (788),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GRQFSDP+LQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLVGRQFSDPDLQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_006287070.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
 gb|EOA19968.1| hypothetical protein CARUB_v10000229mg [Capsella rubella]
Length=828

 Score =   308 bits (789),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVT+GPDG+PLIHA YLG+MR FTPTQ++GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTQGPDGYPLIHANYLGDMRAFTPTQLMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_002887853.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64112.1| hypothetical protein ARALYDRAFT_896005 [Arabidopsis lyrata subsp. 
lyrata]
Length=830

 Score =   308 bits (789),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVT+GPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTQGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_009408938.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408939.1| PREDICTED: heat shock 70 kDa protein 15-like [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   308 bits (789),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSVMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+SQ+KRL+GR+FSDPELQRD++S PF VTEG DGFPLIHA YLGE+R FTPTQ+L M
Sbjct  61   KNTVSQIKRLVGRKFSDPELQRDIQSLPFKVTEGRDGFPLIHANYLGELRAFTPTQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK+IAETNL+AAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKTIAETNLHAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>emb|CDY24089.1| BnaA06g00870D [Brassica napus]
Length=858

 Score =   308 bits (790),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = +2

Query  131  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  310
            +MSVVGFD GN++C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMN
Sbjct  40   RMSVVGFDFGNDNCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMN  99

Query  311  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  490
            PKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+G
Sbjct  100  PKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMG  159

Query  491  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            M+LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  160  MMLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  203



>ref|NP_001031305.1| heat shock protein 91 [Arabidopsis thaliana]
 dbj|BAE98929.1| putative heat shock protein [Arabidopsis thaliana]
 gb|AEE36328.1| heat shock protein 91 [Arabidopsis thaliana]
Length=789

 Score =   307 bits (786),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_007217050.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
 gb|EMJ18249.1| hypothetical protein PRUPE_ppa001317mg [Prunus persica]
Length=855

 Score =   308 bits (789),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFG+KQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGDKQRFIGTAGAASSLMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDP +QRD+KS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPVVQRDIKSLPFAVTEGPDGYPLIHARYLGESRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIA  163



>emb|CDY45119.1| BnaC06g06400D [Brassica napus]
Length=956

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/164 (86%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = +2

Query  131  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  310
            +MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFGEKQRF+GTAGAA++MMN
Sbjct  140  RMSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGEKQRFIGTAGAASTMMN  199

Query  311  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  490
            PKN+ISQ+KRL+GRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+G
Sbjct  200  PKNSISQIKRLVGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHASYLGEKRAFTPTQVMG  259

Query  491  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            M+LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  260  MMLSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  303



>ref|XP_009388669.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=847

 Score =   308 bits (788),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+SQ+KRLIGR+FSDPELQRD++S PF VTEGPDGFPLIH  YLGE RTFTPTQ+L M
Sbjct  61   KNTVSQIKRLIGRKFSDPELQRDIQSLPFKVTEGPDGFPLIHVNYLGEQRTFTPTQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLS+LK IAE N++AAVVDCCIGIPVYFTD+QRRAV+DAATIA
Sbjct  121  VLSDLKGIAEKNMHAAVVDCCIGIPVYFTDIQRRAVLDAATIA  163



>ref|XP_008228510.1| PREDICTED: heat shock 70 kDa protein 15-like [Prunus mume]
Length=855

 Score =   308 bits (789),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPALVCFG+KQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPALVCFGDKQRFIGTAGAASSLMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDP +QRD+KS PF+VTEGPDG+PLIHARYLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPVVQRDIKSLPFAVTEGPDGYPLIHARYLGESRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAATIA  163



>ref|XP_008793460.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=854

 Score =   308 bits (788),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLN+ESKRETPA+VCFGEKQRF+GTAGAA+S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGEKQRFVGTAGAASSLMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQ+KRL+GR+FSDPELQRDL+S PF VTEGPDGFPLIHARYLGE R FTPTQVL M
Sbjct  61   KNSVSQIKRLLGRKFSDPELQRDLQSLPFLVTEGPDGFPLIHARYLGEQRAFTPTQVLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAE NL AAVVDCCIGIP YFTDLQRRAV+DAAT+A
Sbjct  121  VLSNLKSIAEKNLGAAVVDCCIGIPAYFTDLQRRAVLDAATVA  163



>ref|NP_178111.1| heat shock protein 91 [Arabidopsis thaliana]
 sp|Q9S7C0.1|HSP7O_ARATH RecName: Full=Heat shock 70 kDa protein 14; AltName: Full=Heat 
shock protein 70-14; Short=AtHsp70-14; AltName: Full=Heat 
shock protein 91 [Arabidopsis thaliana]
 gb|AAD55461.1|AC009322_1 Heat-shock protein [Arabidopsis thaliana]
 gb|AAG52240.1|AC011717_8 putative heat-shock protein; 37113-40399 [Arabidopsis thaliana]
 gb|AAL84971.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AAO11541.1| At1g79930/F19K16_11 [Arabidopsis thaliana]
 gb|AEE36327.1| heat shock protein 91 [Arabidopsis thaliana]
Length=831

 Score =   307 bits (787),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KS PFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_011000830.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011000831.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Populus 
euphratica]
Length=859

 Score =   307 bits (787),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGR FSDPELQRDLKSFP++VTEGPDGFPLIHA+YLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRLFSDPELQRDLKSFPYTVTEGPDGFPLIHAQYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V ++LK I + NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>gb|EYU24688.1| hypothetical protein MIMGU_mgv1a001324mg [Erythranthe guttata]
Length=840

 Score =   306 bits (785),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDES R TPA+VCFG+KQRFLGTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGVVAVARQRGIDVVLNDESNRLTPAIVCFGDKQRFLGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIGRQFSDPELQ D+KS PFSVTEGPDG+PLIHA YLGE RTFTPTQVLGM
Sbjct  61   KNTISQIKRLIGRQFSDPELQHDIKSLPFSVTEGPDGYPLIHAHYLGESRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  VFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  163



>gb|EPS59607.1| hypothetical protein M569_15197, partial [Genlisea aurea]
Length=534

 Score =   298 bits (763),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES VVAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLGTA AA+S+MNP
Sbjct  6    MSVVGFDFGNESGVVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFLGTAAAASSLMNP  65

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+SQVKRLIGR+FSDPELQ DLK+ PFSV+EGPDG+PLIHARYLGE  TFTPTQVLGM
Sbjct  66   KNTVSQVKRLIGRKFSDPELQSDLKALPFSVSEGPDGYPLIHARYLGETTTFTPTQVLGM  125

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V SNLKSIAE NLNA V DCCIGIP+YF DLQRRAVIDAA IA
Sbjct  126  VFSNLKSIAEKNLNAVVADCCIGIPIYFADLQRRAVIDAARIA  168



>emb|CAA94389.1| heat-shock protein [Arabidopsis thaliana]
Length=831

 Score =   305 bits (782),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+GFD GNE+C+VAVARQRGIDVVLNDES RETPA+VCFG+ +RF+GTAGAA++MMNP
Sbjct  1    MSVIGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDNERFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQRD+KSFPFSVTEGPDG+PLIHA YLGE R FTPTQV+GM
Sbjct  61   KNSISQIKRLIGRQFSDPELQRDIKSFPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_011013254.1| PREDICTED: heat shock 70 kDa protein 15-like [Populus euphratica]
Length=852

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+C+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENCLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGR FSDPELQRDLKS PF+VTEGPDGFPLI ARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLKSLPFTVTEGPDGFPLIQARYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V ++LK I + NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_002439385.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
 gb|EES17815.1| hypothetical protein SORBIDRAFT_09g005580 [Sorghum bicolor]
Length=842

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+HARYLGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHARYLGEERTFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLN AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>emb|CCM07272.1| Putative 97 kDa heat shock protein [Musa balbisiana]
Length=845

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+SQ+KRLIGR+FSDPELQRD++S PF VTEGPDGFPLIH  YLGE RTFTPTQ+L M
Sbjct  61   KNTVSQIKRLIGRKFSDPELQRDIQSLPFKVTEGPDGFPLIHVNYLGEQRTFTPTQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLS+LK IAE N++A VVDCCIGIPVYFTD+QRRAV+DAATIA
Sbjct  121  VLSDLKRIAEKNMHATVVDCCIGIPVYFTDIQRRAVLDAATIA  163



>ref|XP_009389931.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=849

 Score =   305 bits (782),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQ+KRL+GR+FSDPE+Q+D++SFPF VTEGPDGF LIHA YLGE R FTPTQ+L M
Sbjct  61   KNSVSQIKRLLGRKFSDPEVQKDIQSFPFRVTEGPDGFALIHANYLGEQRAFTPTQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAE NLNAAVVDCCIGIPVYF DLQRRAV+DAATIA
Sbjct  121  VLSNLKSIAEKNLNAAVVDCCIGIPVYFNDLQRRAVMDAATIA  163



>ref|XP_008786326.1| PREDICTED: heat shock 70 kDa protein 15-like [Phoenix dactylifera]
Length=854

 Score =   304 bits (779),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQ+KRL+GR+FSDPELQRDL+S  F V+EGPDGFPLIHARYLGE R FTPTQVL M
Sbjct  61   KNSVSQIKRLVGRKFSDPELQRDLQSLSFLVSEGPDGFPLIHARYLGEQRAFTPTQVLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAE NL AAVVDCCIGIPVYFTDLQRRAV+DAA IA
Sbjct  121  VLSNLKSIAEKNLGAAVVDCCIGIPVYFTDLQRRAVLDAAAIA  163



>ref|XP_008654914.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=833

 Score =   303 bits (777),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>gb|AFW81561.1| hypothetical protein ZEAMMB73_352123 [Zea mays]
Length=564

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NL  AVVDCCIGIPVYF+DLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIPVYFSDLQRRAVLDAATIA  163



>ref|NP_001147805.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACG28747.1| heat shock 70 kDa protein 4 [Zea mays]
Length=833

 Score =   303 bits (777),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_003597778.1| 97 kDa heat shock protein [Medicago truncatula]
 ref|XP_003597784.1| 97 kDa heat shock protein [Medicago truncatula]
 gb|AES68029.1| heat shock 70 kDa protein [Medicago truncatula]
Length=858

 Score =   304 bits (778),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIG++F+DPELQRDLKS PF+VTEGPDG+PLIHARYLGE R FT TQV GM
Sbjct  61   KNSISQIKRLIGKKFADPELQRDLKSLPFNVTEGPDGYPLIHARYLGESREFTATQVFGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IA+ NLNAAVVDCCIGIPVYFTDLQRR+V+DAATIA
Sbjct  121  MLSNLKEIAQKNLNAAVVDCCIGIPVYFTDLQRRSVLDAATIA  163



>ref|XP_006842242.1| hypothetical protein AMTR_s00078p00190750 [Amborella trichopoda]
 gb|ERN03917.1| hypothetical protein AMTR_s00078p00190750 [Amborella trichopoda]
Length=855

 Score =   303 bits (776),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S+MN 
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASSLMNI  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQ+KRLIGR+FSDPELQRDL++F F VTEGPDGFPLIH RYLGE + FTPTQVLGM
Sbjct  61   KNSVSQIKRLIGRRFSDPELQRDLQAFAFLVTEGPDGFPLIHVRYLGESKLFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  ILSNLKGIAEKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_006643833.1| PREDICTED: heat shock 70 kDa protein 14-like [Oryza brachyantha]
Length=843

 Score =   303 bits (775),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGR+FSDPELQ DL +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSISQIKRLIGRKFSDPELQSDLAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK+IAE+NLNAAV DCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKAIAESNLNAAVADCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_004506856.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=851

 Score =   303 bits (775),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIG+QFSDPE+Q DLKS PFSVTEGPDG+PLIHARYLGE++TFTPTQV  M
Sbjct  61   KNSISQIKRLIGKQFSDPEVQGDLKSLPFSVTEGPDGYPLIHARYLGEVKTFTPTQVFAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IA+ NLNA V DCCIGIPVYFTD+QRRAV+DAATIA
Sbjct  121  MLSNLKEIAQKNLNAGVNDCCIGIPVYFTDVQRRAVLDAATIA  163



>ref|XP_004960855.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Setaria 
italica]
Length=845

 Score =   302 bits (773),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQRDL SFPF V+EGPDGFPL+HARYLGE + FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQRDLASFPFRVSEGPDGFPLVHARYLGEEQAFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLNAAVVDCCIGIPVYF DLQRRAV+DAATIA
Sbjct  121  VLSNLKVIAEGNLNAAVVDCCIGIPVYFNDLQRRAVLDAATIA  163



>gb|KHN47807.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=816

 Score =   301 bits (771),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_008647466.1| PREDICTED: uncharacterized protein LOC100217188 isoform X1 [Zea 
mays]
 gb|AFW77385.1| heat shock protein 4 [Zea mays]
Length=841

 Score =   301 bits (772),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR++SDPE+QRDL SFPF VTEGPDGFPL+H RYLGE RTFT TQ+L M
Sbjct  61   KNSISQIKRLLGRKYSDPEVQRDLASFPFRVTEGPDGFPLVHVRYLGEERTFTSTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_003529646.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X1 [Glycine 
max]
 ref|XP_006582999.1| PREDICTED: heat shock 70 kDa protein 15-like isoform X2 [Glycine 
max]
 gb|KHN39337.1| Heat shock 70 kDa protein 14 [Glycine soja]
Length=857

 Score =   302 bits (773),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESCVVAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCVVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGR+F+DPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQIKRLIGRKFADPELQRDLKSLPFLVTEGSDGYPLIHARYMGEAKTFTPTQVFGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_003531683.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Glycine 
max]
Length=852

 Score =   301 bits (771),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_004960853.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Setaria 
italica]
Length=850

 Score =   301 bits (771),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLNAAVVDCCIGIPVYF+DLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFSDLQRRAVLDAATIA  163



>ref|XP_002299641.1| heat shock protein 70 [Populus trichocarpa]
 gb|EEE84446.1| heat shock protein 70 [Populus trichocarpa]
Length=852

 Score =   301 bits (771),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+ +VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNENSLVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGR FSDPELQRDL+S PF+VTEGPDGFPLI ARYLGEMRTFTPTQVLGM
Sbjct  61   KNSISQIKRLIGRPFSDPELQRDLRSLPFTVTEGPDGFPLIQARYLGEMRTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V ++LK I + NLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VFADLKIIGQKNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_006585595.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X2 [Glycine 
max]
Length=850

 Score =   301 bits (770),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIHARY+GE +TFTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGSDGYPLIHARYMGESKTFTPTQVFGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  MLSNLKEIAEKNLTTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_004506857.1| PREDICTED: heat shock 70 kDa protein 15-like [Cicer arietinum]
Length=849

 Score =   301 bits (770),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIG+QFSDP++Q DLKS PFSVTEGPDG+PLIHARYLGE++TFTPTQV  M
Sbjct  61   KNSISQIKRLIGKQFSDPDVQGDLKSLPFSVTEGPDGYPLIHARYLGEVKTFTPTQVFAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLN  V DCCIGIPVYFTD+QRRAV+DAATIA
Sbjct  121  MLSNLKEIAEKNLNTGVNDCCIGIPVYFTDVQRRAVLDAATIA  163



>ref|XP_004960852.1| PREDICTED: heat shock 70 kDa protein 14-like isoform X1 [Setaria 
italica]
Length=878

 Score =   301 bits (771),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLNAAVVDCCIGIPVYF+DLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLNAAVVDCCIGIPVYFSDLQRRAVLDAATIA  163



>ref|XP_009358190.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   300 bits (769),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIA  163



>ref|XP_009358191.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
 ref|XP_009358192.1| PREDICTED: heat shock 70 kDa protein 15-like [Pyrus x bretschneideri]
Length=855

 Score =   300 bits (769),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFGEKQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPALVCFGEKQRFIGTAGAASALMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIA  163



>gb|EAY72790.1| hypothetical protein OsI_00654 [Oryza sativa Indica Group]
Length=813

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQ+KRL+GR++SDPELQRD+ +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSVSQIKRLLGRKYSDPELQRDIAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE+NLN AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAESNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_009399777.1| PREDICTED: heat shock 70 kDa protein 14-like [Musa acuminata 
subsp. malaccensis]
Length=851

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGA +S MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGATSSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQ+KRL+GR+FSDPE+QRD++  PF VTEGPDGFPLIHA YLGE +TF+PTQ+L M
Sbjct  61   KNSVSQIKRLVGRKFSDPEVQRDIQLVPFKVTEGPDGFPLIHANYLGEQKTFSPTQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAE NLNAAV+DCCIG+PVYF DLQRRAVIDAATIA
Sbjct  121  VLSNLKSIAENNLNAAVMDCCIGVPVYFNDLQRRAVIDAATIA  163



>ref|XP_002440718.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
 gb|EES19148.1| hypothetical protein SORBIDRAFT_09g005570 [Sorghum bicolor]
Length=851

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLN AVVDCCIGIPVYF+DLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLNTAVVDCCIGIPVYFSDLQRRAVLDAATIA  163



>ref|XP_008462146.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
 ref|XP_008462147.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis melo]
Length=844

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FG+KQRF+GTAGAA+ MMN 
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVSFGDKQRFIGTAGAASIMMNI  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQVKRLIGR+FSDP LQ+DL+S PFSVTEGPDGFPL+H RYLGE++TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPGLQKDLQSLPFSVTEGPDGFPLVHVRYLGELKTFTPTQLLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + SNLK IAETNLNAAVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  LFSNLKGIAETNLNAAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|NP_001042210.1| Os01g0180800 [Oryza sativa Japonica Group]
 dbj|BAB32902.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAB33024.1| putative heat shock protein [Oryza sativa Japonica Group]
 dbj|BAF04124.1| Os01g0180800 [Oryza sativa Japonica Group]
 gb|EAZ10794.1| hypothetical protein OsJ_00630 [Oryza sativa Japonica Group]
 gb|ADR66977.1| 70 kDa heat shock protein [Oryza sativa Japonica Group]
Length=845

 Score =   300 bits (767),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 155/163 (95%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQ+KRL+GR++SDPELQRD+ +FPF V+EGPDGFPL+HARYLGE R FTPTQ++ M
Sbjct  61   KNSVSQIKRLLGRKYSDPELQRDIAAFPFRVSEGPDGFPLVHARYLGEERVFTPTQLMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE+NLN AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAESNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_010925584.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
 ref|XP_010932975.1| PREDICTED: heat shock 70 kDa protein 14-like [Elaeis guineensis]
Length=852

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQVKRLIGR+FSDPELQRDL+S PF VTEGPDG+PLIHA YLGE +TF PTQVLGM
Sbjct  61   KNSVSQVKRLIGRKFSDPELQRDLQSLPFLVTEGPDGYPLIHASYLGEKKTFMPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK +AE NLN AVVDCCIGIP YFTDLQRRAV+DAA IA
Sbjct  121  ILSNLKGMAEKNLNNAVVDCCIGIPAYFTDLQRRAVMDAAAIA  163



>ref|XP_010231645.1| PREDICTED: heat shock 70 kDa protein 14-like [Brachypodium distachyon]
Length=843

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+F+DPELQ DL+SFPF V+EGPDGFPL+HARYLGE R+FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFTDPELQHDLQSFPFHVSEGPDGFPLVHARYLGEERSFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLN+AV+DCCIGIPVYFT+LQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLNSAVIDCCIGIPVYFTNLQRRAVLDAATIA  163



>gb|EMT31029.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=842

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+F+DPELQ D+K+FPF V+EGPDGFPL+H RYLGE R+FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQDDIKAFPFRVSEGPDGFPLVHVRYLGEERSFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK+IAE NLN+AV+DCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  121  VLSNLKAIAEGNLNSAVIDCCIGIPVYFTDLQRRAVIDAATIA  163



>ref|NP_001151579.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACN33614.1| unknown [Zea mays]
Length=848

 Score =   299 bits (765),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFHVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NL  AVVDCCIGIPVYF+DLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIPVYFSDLQRRAVLDAATIA  163



>ref|XP_008362708.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   299 bits (765),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQRGIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIA  163



>ref|XP_004141777.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis sativus]
 ref|XP_004168280.1| PREDICTED: heat shock 70 kDa protein 15-like [Cucumis sativus]
 gb|KGN45354.1| hypothetical protein Csa_7G446710 [Cucumis sativus]
Length=843

 Score =   298 bits (764),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+V FG+KQRF+GTAGAA+ MMN 
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVSFGDKQRFIGTAGAASIMMNI  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQVKRLIGR+FSDP LQ+DL+S PFSV+EGPDGFPL+H RYLGE++TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPGLQKDLQSLPFSVSEGPDGFPLVHVRYLGELKTFTPTQLLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + SNLK IAETNLNAAVVDCCIGIPVYFTDLQRRAV+DAAT+A
Sbjct  121  LFSNLKGIAETNLNAAVVDCCIGIPVYFTDLQRRAVLDAATVA  163



>gb|ACG43420.1| heat shock 70 kDa protein 4 [Zea mays]
 gb|ACL52695.1| unknown [Zea mays]
 gb|AFW81562.1| heat shock protein 4 [Zea mays]
Length=848

 Score =   298 bits (764),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NL  AVVDCCIGIPVYF+DLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIPVYFSDLQRRAVLDAATIA  163



>gb|EMS61926.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=841

 Score =   298 bits (763),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+HARYLGE   FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQRDLQSFPFRVSEGPDGFPLVHARYLGEEHAFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK+IAE NL +AVVDCCIGIPVYFTDLQRR+V+DAATIA
Sbjct  121  VLSNLKAIAEDNLKSAVVDCCIGIPVYFTDLQRRSVLDAATIA  163



>ref|XP_008371663.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=855

 Score =   298 bits (764),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQRGIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIA  163



>ref|XP_008655087.1| PREDICTED: heat shock 70 kDa protein 4 isoform X1 [Zea mays]
Length=875

 Score =   298 bits (764),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+FSDPELQ DL SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFSDPELQSDLASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NL  AVVDCCIGIPVYF+DLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLKTAVVDCCIGIPVYFSDLQRRAVLDAATIA  163



>ref|XP_010231644.1| PREDICTED: heat shock 70 kDa protein 15-like [Brachypodium distachyon]
Length=836

 Score =   297 bits (761),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+F+DPE+Q D++SFPF V+EGPDGFPL+HARYLGE RTFTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFTDPEVQHDIQSFPFRVSEGPDGFPLVHARYLGEERTFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK IAE NLN AV DCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKGIAEGNLNTAVSDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_008649434.1| PREDICTED: heat shock 70 kDa protein 14-like [Zea mays]
 gb|AFW77407.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=843

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +N+ISQ+KRL+GR+FSDPE+Q D+ SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L M
Sbjct  61   RNSISQIKRLLGRKFSDPEVQSDIASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLKSIAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  121  VLSNLKSIAEGNLKTAVVDCCIGIPVYFTDLQRRAVLDAATIA  163



>ref|XP_007135698.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 ref|XP_007135699.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07692.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
 gb|ESW07693.1| hypothetical protein PHAVU_010G150800g [Phaseolus vulgaris]
Length=841

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 148/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRFLG+AGAA+SMMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFLGSAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ KRLIGR+FSDPELQRDLKS PF VTEG DG+PLIH +YLGE R FTPTQV GM
Sbjct  61   KNSISQFKRLIGRKFSDPELQRDLKSLPFLVTEGNDGYPLIHVQYLGEARKFTPTQVFGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            +LSNLK IAE NL  AVVDCCIGIP YFTDLQRRAV+DAATI
Sbjct  121  MLSNLKEIAEKNLGTAVVDCCIGIPTYFTDLQRRAVLDAATI  162



>gb|EMT09857.1| Heat shock 70 kDa protein 4L [Aegilops tauschii]
Length=901

 Score =   298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+HARYLGE   FTPTQ+L M
Sbjct  61   KNSISQIKRLLGRKFADPELQRDLQSFPFRVSEGPDGFPLVHARYLGEEHAFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK+IAE NL +AVVDCCIGIPVYFTDLQRR+V+DAATIA
Sbjct  121  VLSNLKAIAEDNLKSAVVDCCIGIPVYFTDLQRRSVLDAATIA  163



>ref|XP_008775317.1| PREDICTED: heat shock 70 kDa protein 14-like [Phoenix dactylifera]
Length=852

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAVVCFGEKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN++SQVKRLIGR+FSDPELQ D++S PFSVTEGPDG+PLIHA YLGE  TFTPTQ+LGM
Sbjct  61   KNSVSQVKRLIGRKFSDPELQGDVQSLPFSVTEGPDGYPLIHASYLGEKGTFTPTQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLK IAE NLN AV DCCIGIP YFTDLQRRAV+DAA IA
Sbjct  121  ILSNLKGIAEKNLNNAVADCCIGIPAYFTDLQRRAVMDAAAIA  163



>ref|XP_004302913.1| PREDICTED: heat shock 70 kDa protein 15-like [Fragaria vesca 
subsp. vesca]
Length=848

 Score =   295 bits (755),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES +VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA+SMMNP
Sbjct  1    MSVVGFDFGNESGIVAVARQRGIDVVLNDESKRETPAVVCFGDKQRFIGTAGAASSMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIG++FSDP LQRD+KS PF+V EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKKFSDPVLQRDIKSLPFAVLEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V S+LK IA+ NLNAAVVDCCIGIPVYFTDLQRRAV DAA IA
Sbjct  121  VFSDLKIIAQKNLNAAVVDCCIGIPVYFTDLQRRAVEDAAKIA  163



>gb|EMS52665.1| Heat shock 70 kDa protein 4L [Triticum urartu]
Length=1269

 Score =   299 bits (766),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 156/165 (95%), Gaps = 0/165 (0%)
 Frame = +2

Query  128  TKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMM  307
            ++MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S M
Sbjct  159  SEMSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTM  218

Query  308  NPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVL  487
            NPKN+ISQ+KRL+GR+F+DPELQ D+K+FPF V+EGPDGFPL+H RYLGE R+FTPTQ+L
Sbjct  219  NPKNSISQIKRLLGRKFADPELQNDIKAFPFRVSEGPDGFPLVHVRYLGEERSFTPTQLL  278

Query  488  GMVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
             MVLSNLK+IAE NLN+AV+DCCIGIPVYFTDLQRRAVIDAATIA
Sbjct  279  AMVLSNLKAIAEGNLNSAVIDCCIGIPVYFTDLQRRAVIDAATIA  323



>gb|KEH28782.1| heat shock 70 kDa protein [Medicago truncatula]
Length=851

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIG+ +SDP+LQRDLKS PFSV EGPDG+PLI ARYLGE++ FTPTQV  M
Sbjct  61   KNSISQIKRLIGKLYSDPDLQRDLKSLPFSVAEGPDGYPLIQARYLGEVKMFTPTQVFAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L N+K IAE NLNAAV DCCIGIP YFTDLQRRAV+DAATIA
Sbjct  121  MLGNMKEIAEKNLNAAVNDCCIGIPCYFTDLQRRAVLDAATIA  163



>gb|AFW77408.1| hypothetical protein ZEAMMB73_835876 [Zea mays]
Length=1186

 Score =   298 bits (762),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = +2

Query  131  KMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  310
            KMSVVGFD+GNESC+VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MN
Sbjct  343  KMSVVGFDLGNESCIVAVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAASSTMN  402

Query  311  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  490
            P+N+ISQ+KRL+GR+FSDPE+Q D+ SFPF VTEGPDGFPL+H R+LGE RTFTPTQ+L 
Sbjct  403  PRNSISQIKRLLGRKFSDPEVQSDIASFPFRVTEGPDGFPLVHVRFLGEERTFTPTQLLA  462

Query  491  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            MVLSNLKSIAE NL  AVVDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  463  MVLSNLKSIAEGNLKTAVVDCCIGIPVYFTDLQRRAVLDAATIA  506



>dbj|BAJ90753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=835

 Score =   292 bits (748),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+V VARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA S MNP
Sbjct  1    MSVVGFDLGNESCIVGVARQRGIDVVLNEESKRETPAIVCFGDKQRFIGTAGAANSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
             N+ISQ+KRL+GR+F+DPELQRDL+SFPF V+EGPDGFPL+ ARYLGE   FTPTQ+L M
Sbjct  61   NNSISQIKRLLGRKFADPELQRDLQSFPFLVSEGPDGFPLVQARYLGEEHAFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK+IAE NL +AVVDCCIGIPVYFTDLQRR+V+DAATIA
Sbjct  121  VLSNLKAIAEDNLKSAVVDCCIGIPVYFTDLQRRSVLDAATIA  163



>ref|XP_008354139.1| PREDICTED: heat shock 70 kDa protein 15-like [Malus domestica]
Length=834

 Score =   292 bits (748),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNES +VAVARQ  IDVVLNDESKRETPALVCFG KQRF+GTAGAA+++MNP
Sbjct  1    MSVVGFDFGNESXIVAVARQXXIDVVLNDESKRETPALVCFGXKQRFIGTAGAASALMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KRLIG+QFSDP LQRD+KS PF+V+EGPDG+PLIHARYLGE +TFTPTQVLGM
Sbjct  61   KNTISQIKRLIGKQFSDPVLQRDIKSLPFAVSEGPDGYPLIHARYLGEAKTFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE NLNAAVVDCCIGIPVYFTDLQRRAV+DAA IA
Sbjct  121  LFSDLKIIAEKNLNAAVVDCCIGIPVYFTDLQRRAVMDAAKIA  163



>ref|XP_006654112.1| PREDICTED: heat shock 70 kDa protein 15-like [Oryza brachyantha]
Length=856

 Score =   281 bits (718),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESC+VAVAR RGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDLGNESCIVAVARLRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +N+ISQ+KRL+GR F+DPELQRDL SFPF V+EG  G+PL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSISQIKRLLGRSFADPELQRDLGSFPFRVSEGLGGYPLVHARYLGEDRAFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            VLSNLK IAE NLN AVVDCCIGIP YFTDLQRRAV +AATI
Sbjct  121  VLSNLKGIAEGNLNCAVVDCCIGIPAYFTDLQRRAVAEAATI  162



>gb|EAY96776.1| hypothetical protein OsI_18700 [Oryza sativa Indica Group]
Length=853

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNES +VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +N++SQ+KRL+GR F+DPELQRDL SFPF V+EGPDGFPL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSVSQIKRLLGRAFADPELQRDLASFPFRVSEGPDGFPLVHARYLGEDRAFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRR  595
            VLSNLK IAE NLNAAV DCCIGIP YFTDLQRR
Sbjct  121  VLSNLKGIAEGNLNAAVFDCCIGIPAYFTDLQRR  154



>ref|NP_001054812.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|AAW57812.1| putative heat shock protein Hsp70 [Oryza sativa Japonica Group]
 dbj|BAF16726.1| Os05g0181000 [Oryza sativa Japonica Group]
 gb|EEE62549.1| hypothetical protein OsJ_17347 [Oryza sativa Japonica Group]
Length=853

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNES +VAVARQRGIDVVLN+ESKRETPA+VCFG+KQRF+GTAGAA+S MNP
Sbjct  1    MSVVGFDVGNESGIVAVARQRGIDVVLNEESKRETPAVVCFGDKQRFIGTAGAASSTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +N++SQ+KRL+GR F+DPELQRDL SFPF V+EGPDGFPL+HARYLGE R FTPTQ+L M
Sbjct  61   RNSVSQIKRLLGRAFADPELQRDLASFPFRVSEGPDGFPLVHARYLGEDRAFTPTQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRR  595
            VLSNLK IAE NLNAAV DCCIGIP YFTDLQRR
Sbjct  121  VLSNLKGIAEGNLNAAVFDCCIGIPAYFTDLQRR  154



>ref|XP_001764380.1| predicted protein [Physcomitrella patens]
 gb|EDQ70934.1| predicted protein [Physcomitrella patens]
Length=820

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+C+V VARQRGIDVVLNDESKRETP +V FGEKQRF+G AGAA+++MNP
Sbjct  1    MSVVGFDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFGEKQRFVGVAGAASALMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ+KR+IGR FSDPELQ DL+ FPFSVTEGPDGFP I+ +YLGE R FTPTQVLGM
Sbjct  61   KNTISQIKRMIGRPFSDPELQNDLRLFPFSVTEGPDGFPSINVQYLGEPRQFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLKSIAE NL  +VVDC IG+PVYFT+LQRRA +DAA IA
Sbjct  121  LLSNLKSIAEKNLGTSVVDCVIGVPVYFTELQRRAYLDAAQIA  163



>ref|XP_001755636.1| predicted protein [Physcomitrella patens]
 gb|EDQ79696.1| predicted protein [Physcomitrella patens]
Length=770

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V F EKQRFLG AGAA++MMNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFAEKQRFLGVAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +NTISQ+KR+IGR FSDPE+Q DL+ FPFSVTEGPDGFPLI+ +YLGE R FTPTQVLGM
Sbjct  61   RNTISQIKRMIGRPFSDPEMQEDLRLFPFSVTEGPDGFPLINVQYLGEPRQFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLKSIAE NL  +VVDC IG+PVYFT+LQRRA +DAA +A
Sbjct  121  LLSNLKSIAEKNLGTSVVDCVIGVPVYFTELQRRAYLDAAQVA  163



>ref|XP_001760080.1| predicted protein [Physcomitrella patens]
 gb|EDQ75205.1| predicted protein [Physcomitrella patens]
Length=816

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V FGEKQRF+G AGAA+++MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGVVSFGEKQRFVGVAGAASALMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +NTISQ+KR+IGR FSDPELQ+DL  FPF+VTEGPDG PLI+ +YLGE R FTPTQVLGM
Sbjct  61   RNTISQIKRMIGRSFSDPELQKDLHLFPFTVTEGPDGSPLINVQYLGEPRQFTPTQVLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LSNLKSIAE NL  +VVDC IG+PVYFT+LQRRA +DAA +A
Sbjct  121  LLSNLKSIAEKNLGTSVVDCVIGVPVYFTELQRRAYLDAAQVA  163



>ref|XP_002986462.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
 gb|EFJ12319.1| hypothetical protein SELMODRAFT_124091 [Selaginella moellendorffii]
Length=774

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETPA+V F EKQRFLGTA AA++ MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPAMVSFSEKQRFLGTAAAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +NT+SQ+KRLIGR+F+DPE+Q+DL+  PF+VTE  DG  LIH RYLGE++ FTPTQ+LGM
Sbjct  61   RNTVSQIKRLIGRRFADPEVQKDLQLLPFNVTEAADGTCLIHVRYLGEVKAFTPTQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK+IAETNL   VVDC IGIPVYF+DLQRRA +DAA+IA
Sbjct  121  VLSNLKTIAETNLGTHVVDCVIGIPVYFSDLQRRAYLDAASIA  163



>ref|XP_002978946.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
 gb|EFJ19903.1| hypothetical protein SELMODRAFT_109750 [Selaginella moellendorffii]
Length=779

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVG DVGNE+C+V VARQRGIDVVLNDESKRETP +V F EKQRFLGTA AA++ MNP
Sbjct  1    MSVVGLDVGNENCIVGVARQRGIDVVLNDESKRETPGMVSFSEKQRFLGTAAAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +NT+SQ+KRLIGR+F+DPE+Q+DL+  PF+VTE  DG  LIH RYLGE++ FTPTQ+LGM
Sbjct  61   RNTVSQIKRLIGRRFADPEVQKDLQLLPFNVTEAADGTCLIHVRYLGEVKAFTPTQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VLSNLK+IAETNL   VVDC IGIPVYF+DLQRRA +DAA+IA
Sbjct  121  VLSNLKTIAETNLGTHVVDCVIGIPVYFSDLQRRAYLDAASIA  163



>ref|XP_002317001.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
 gb|EEE97613.1| hypothetical protein POPTR_0011s14240g [Populus trichocarpa]
Length=770

 Score =   254 bits (649),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TI QVKRLIGR F DPE+Q +L   PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEVQNELTLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + SNLK I E NL   V DC IG+P YFTDLQRRA +DAATIA
Sbjct  121  LFSNLKDITEKNLEIPVTDCVIGVPSYFTDLQRRAYLDAATIA  163



>ref|XP_008363587.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=342

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F++P++QRDL+  P   +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLQILPLDTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+A
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDLQRRAYLDAATVA  163



>ref|XP_011030786.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Populus 
euphratica]
Length=770

 Score =   253 bits (646),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MN 
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNL  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TI QVKRLIGR F DPE Q +LK  PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEFQNELKLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + SNLK++ E NL   V DC IGIP YFTDLQRRA +DAATIA
Sbjct  121  LFSNLKNVTEKNLEIPVTDCVIGIPSYFTDLQRRAYLDAATIA  163



>ref|XP_011030785.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Populus 
euphratica]
Length=771

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA+S+MN 
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASSVMNL  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TI QVKRLIGR F DPE Q +LK  PF  +EG DG  LIH +YLGE RTFTP Q+L M
Sbjct  61   KSTIFQVKRLIGRNFKDPEFQNELKLLPFETSEGKDGGILIHLKYLGEARTFTPVQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + SNLK++ E NL   V DC IGIP YFTDLQRRA +DAATIA
Sbjct  121  LFSNLKNVTEKNLEIPVTDCVIGIPSYFTDLQRRAYLDAATIA  163



>ref|XP_008353314.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=395

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F++P++QRDL+  P   +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLQILPLDTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+A
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDLQRRAYLDAATVA  163



>ref|XP_007213641.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
 gb|EMJ14840.1| hypothetical protein PRUPE_ppa001697mg [Prunus persica]
Length=777

 Score =   249 bits (636),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+FS+P++QRDL+  PF  +E PDG  LIH +YLGE  TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFSEPDVQRDLRMLPFQTSEAPDGGILIHLKYLGETHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+A
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDLQRRAYLDAATVA  163



>ref|XP_008226915.1| PREDICTED: heat shock 70 kDa protein 16 [Prunus mume]
Length=777

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+FS+P++QRDL+  PF  +E PDG  LIH +YLGE  TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFSEPDVQRDLRMLPFQTSEAPDGGILIHLKYLGETHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+A
Sbjct  121  LFAHLKDLIEKNQEIPISDCVIGIPSYFTDLQRRAYLDAATVA  163



>gb|KCW67010.1| hypothetical protein EUGRSUZ_F00767 [Eucalyptus grandis]
Length=711

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESNRETPAIVCFGEKQRFLGSAGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F+DP++QR+LK  P    EGPDG  LI  +Y GE  TF+PTQV+ M
Sbjct  61   KSTVSQVKRLIGRKFADPDVQRELKMLPVETCEGPDGGILIRIQYAGEKHTFSPTQVMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK IAE NL   V DC IGIP YFTDLQRRA ++AATIA
Sbjct  121  LFAHLKDIAEKNLEIPVSDCVIGIPSYFTDLQRRAYLNAATIA  163



>ref|XP_004500055.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=770

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG++GAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSSGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR+F DP+++RDLK  P   +EGPDG  LIH +YL    TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFQDPDMERDLKMLPLETSEGPDGGILIHLKYLEGTHTFTPVQIMSM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK++ E +L  ++ DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKTMTEKDLETSISDCVIGIPSYFTDLQRRAYLDAAKIA  163



>ref|XP_010060358.1| PREDICTED: heat shock 70 kDa protein 16 [Eucalyptus grandis]
Length=774

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESNRETPAIVCFGEKQRFLGSAGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F+DP++QR+LK  P    EGPDG  LI  +Y GE  TF+PTQV+ M
Sbjct  61   KSTVSQVKRLIGRKFADPDVQRELKMLPVETCEGPDGGILIRIQYAGEKHTFSPTQVMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK IAE NL   V DC IGIP YFTDLQRRA ++AATIA
Sbjct  121  LFAHLKDIAEKNLEIPVSDCVIGIPSYFTDLQRRAYLNAATIA  163



>ref|XP_008345050.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=440

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPALVCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVNQWGVDVLLNDESKRETPALVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRL+GR+F++P++QRDL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLMGRKFTEPDVQRDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC IGIP YFTD QRRA +DAA +A
Sbjct  121  LFAHLKDLIEKNQEMPIXDCVIGIPSYFTDXQRRAYLDAAXVA  163



>ref|XP_003600064.1| Heat shock 70 kDa protein 4L [Medicago truncatula]
 gb|AES70315.1| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKR IGR+F DP++++DLK  P   +EGPDG  LIH +YL  + TFTP Q++ M
Sbjct  61   KSTISQVKRFIGRKFLDPDMEKDLKMLPLETSEGPDGGVLIHLKYLDGIHTFTPVQIMSM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK++ E +L A + DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKTMTEKDLEAPISDCVIGIPSYFTDLQRRAYLDAAIIA  163



>gb|AII99893.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AVA+ RGIDV+LNDESKRETPA+VCFGEKQRFLG++GAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKHRGIDVLLNDESKRETPAVVCFGEKQRFLGSSGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR+F DP+++RDLK  P   +EGPDG  LIH +YL    TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFQDPDMERDLKMLPLETSEGPDGGILIHLKYLEGTHTFTPVQIMSM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK++ E +L  ++ DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKTMTEKDLETSISDCVIGIPSYFTDLQRRAYLDAAKIA  163



>ref|XP_010092150.1| Heat shock 70 kDa protein 16 [Morus notabilis]
 gb|EXB50301.1| Heat shock 70 kDa protein 16 [Morus notabilis]
Length=749

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV +QRGIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA+++MNP
Sbjct  1    MSVVGFDIGNENCVIAVVKQRGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAVMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIG +FS+P++Q +LK FPF  +E PDG  LIH +YLGE  TFT  Q++ M
Sbjct  61   KSTVSQVKRLIGTKFSEPDIQNELKLFPFETSEAPDGGILIHLKYLGETHTFTLVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++L+ +AE NL   V DC IGIP YF+DLQRRA +DAA+IA
Sbjct  121  LFAHLRELAEKNLEILVSDCVIGIPSYFSDLQRRAYLDAASIA  163



>ref|XP_009352450.1| PREDICTED: heat shock 70 kDa protein 16-like, partial [Pyrus 
x bretschneideri]
Length=736

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQHDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+A
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDLQRRAYLDAATVA  163



>ref|XP_009352433.1| PREDICTED: heat shock 70 kDa protein 16-like [Pyrus x bretschneideri]
Length=762

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQHDLQILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC IGIP YFTDLQRRA +DAAT+A
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDLQRRAYLDAATVA  163



>gb|AET00484.2| heat shock 70 kDa protein [Medicago truncatula]
Length=774

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AVA+Q G+DV+LN+ES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQGGVDVLLNNESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+ +SQVKRLIGR+F DP++Q DLK FPF   EG DG  LIH  YL E   FTP Q+LGM
Sbjct  61   KSIVSQVKRLIGRRFDDPDVQNDLKMFPFETFEGSDGGILIHLEYLNETHKFTPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            + ++LK+IAE +L +AV DC IG+P YFTDLQRRA +DAATI
Sbjct  121  LFAHLKTIAENDLGSAVSDCVIGVPSYFTDLQRRAYLDAATI  162



>ref|XP_003617525.1| 97 kDa heat shock protein [Medicago truncatula]
Length=789

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AVA+Q G+DV+LN+ES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQGGVDVLLNNESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+ +SQVKRLIGR+F DP++Q DLK FPF   EG DG  LIH  YL E   FTP Q+LGM
Sbjct  61   KSIVSQVKRLIGRRFDDPDVQNDLKMFPFETFEGSDGGILIHLEYLNETHKFTPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            + ++LK+IAE +L +AV DC IG+P YFTDLQRRA +DAATI
Sbjct  121  LFAHLKTIAENDLGSAVSDCVIGVPSYFTDLQRRAYLDAATI  162



>ref|XP_007020850.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12375.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=765

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+A  +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            + T+SQVKRLIGR+F +P++Q++L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   QTTVSQVKRLIGRKFREPDVQKELRLLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK I ETNL  +V+DC IGIP YFTDLQRR  +DAA IA
Sbjct  121  LFAHLKYITETNLGVSVLDCVIGIPSYFTDLQRRVYLDAAAIA  163



>ref|XP_008355346.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=498

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPALVCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVNQWGVDVLLNDESKRETPALVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRL+GR+F++P++QRDL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLMGRKFTEPDVQRDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC IGIP YFTD QRRA +DAA +A
Sbjct  121  LFAHLKDLIEKNQEMPISDCVIGIPSYFTDXQRRAYLDAAXVA  163



>ref|XP_008366399.1| PREDICTED: heat shock 70 kDa protein 16-like [Malus domestica]
Length=777

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F++P++QRDL+  PF  +EGPDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQRDLRILPFETSEGPDGGILIHLKYLGXTHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC I IP YF DLQRR  +DAAT+A
Sbjct  121  LFAHLKDLIEKNQEMPISDCVISIPSYFADLQRRXYLDAATVA  163



>gb|KDP39123.1| hypothetical protein JCGZ_00880 [Jatropha curcas]
Length=771

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+A  +QRGIDV+LNDESKRETPA++CFGE+QR LG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGIDVLLNDESKRETPAVICFGERQRLLGSAGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR F DP++Q DLK  PF  + G DG  LIH RYLGE+ TFTP Q++ M
Sbjct  61   KSTISQVKRLIGRNFKDPDVQNDLKLLPFETSGGQDGGILIHLRYLGEIHTFTPVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK I E +L   V DC IGIP YFTDLQRR+ ++AATIA
Sbjct  121  LFSHLKEITEKDLEMPVSDCVIGIPSYFTDLQRRSYLNAATIA  163



>ref|XP_009760615.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
 ref|XP_009760616.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana sylvestris]
Length=753

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIAFAKQRGIDVILNDESKRETPAVVSFGEKQRFIGSAGAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR++ +P +Q+DLK  PF+ +EGPDG  LIH +Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLLPFTTSEGPDGGILIHLQYMNEKQSFTPVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK IAE NL   V DC IGIP YFTDLQRRA + AA IA
Sbjct  121  LFAHLKQIAEKNLEMDVSDCVIGIPSYFTDLQRRAYLYAAEIA  163



>ref|XP_002522946.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
 gb|EEF39376.1| Heat-shock protein 105 kDa, putative [Ricinus communis]
Length=740

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CVVA  +Q GIDV+LNDESKRETPA+VCFGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVVATVKQGGIDVLLNDESKRETPAVVCFGEKQRFLGSAGAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TI QVKRLIGR F+DP+++ +LK  PF ++ G DG  LIH +YLGEM TFTP Q++ M
Sbjct  61   KSTICQVKRLIGRNFADPDIRNELKLLPFEISGGKDGGILIHLKYLGEMYTFTPVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK I E NL   V DC IGIP YF+DLQRRA ++AATIA
Sbjct  121  LFSHLKEITEKNLEMPVTDCVIGIPSYFSDLQRRAYLNAATIA  163



>ref|XP_006858197.1| hypothetical protein AMTR_s00062p00170870 [Amborella trichopoda]
 gb|ERN19664.1| hypothetical protein AMTR_s00062p00170870 [Amborella trichopoda]
Length=568

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+G+E+CVVAVA+QRGI+VVLNDESKRETPA+V FGEKQRFLG++G A++ MNP
Sbjct  1    MSVVGFDIGDENCVVAVAKQRGIEVVLNDESKRETPAIVSFGEKQRFLGSSGLASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQ+KRLIGR+F+ P  QRDL   PF+ +E PDG  LIH  Y+GE R FTP QVL M
Sbjct  61   KSTVSQIKRLIGRKFNCPYAQRDLHFLPFATSEAPDGGILIHIPYMGETRVFTPVQVLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK IA  NL   V DC IGIP YFTDLQRRA ++AA IA
Sbjct  121  LLSHLKQIAAKNLELGVTDCVIGIPSYFTDLQRRAYLEAAAIA  163



>ref|XP_009372708.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Pyrus 
x bretschneideri]
Length=718

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQSDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC I IP YFTDLQR A +DAAT+A
Sbjct  121  LFAHLKDLIEKNQEMPISDCVISIPSYFTDLQRHAYLDAATVA  163



>ref|XP_010278704.1| PREDICTED: heat shock 70 kDa protein 16 [Nelumbo nucifera]
Length=777

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNESCV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G +GAA+++MNP
Sbjct  1    MSVVGFDIGNESCVIAAAKQRGIDVLLNDESKRETPAVVSFGEKQRFIGASGAASALMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIG  F  P++Q++L++FPF  +EG DG  LIH +YLGE    TP Q+L M
Sbjct  61   KSTISQVKRLIGLNFRQPDVQKELRNFPFETSEGSDGNILIHLQYLGETLKLTPVQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE NL   V DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFSHLKQIAEKNLETPVSDCVIGIPSYFTDLQRRAYLDAAAIA  163



>ref|XP_009372707.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Pyrus 
x bretschneideri]
Length=761

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AV +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F++P++Q DL+  PF  +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLIGRKFTEPDVQSDLRILPFETSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC I IP YFTDLQR A +DAAT+A
Sbjct  121  LFAHLKDLIEKNQEMPISDCVISIPSYFTDLQRHAYLDAATVA  163



>ref|XP_007020851.1| Heat shock protein 70 family protein [Theobroma cacao]
 gb|EOY12376.1| Heat shock protein 70 family protein [Theobroma cacao]
Length=764

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV++  +QRG+DV+LNDESKRETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVISAVKQRGVDVLLNDESKRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K  +SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LI  +YLGE   FTP Q++ M
Sbjct  61   KTMVSQVKRLIGRKFKDPDVQNELRLLPFETSEGQDGGILIQLKYLGETHRFTPLQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK IAE NL  +V+DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKYIAEANLGVSVLDCVIGIPSYFTDLQRRAYLDAAAIA  163



>ref|XP_009614255.1| PREDICTED: heat shock 70 kDa protein 16 [Nicotiana tomentosiformis]
Length=753

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+A A+QRGIDV+LNDESKRETPA+V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIAFAKQRGIDVILNDESKRETPAVVSFGEKQRFIGSAGAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR++ +P +Q DLK  PF+ +EGPDG  LIH +Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQMDLKLLPFATSEGPDGGILIHLQYMNEKQSFTPVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK IAE NL   V DC IGIP YFTDLQRRA + AA IA
Sbjct  121  LFAHLKQIAEKNLEMDVSDCVIGIPSYFTDLQRRAYLYAAEIA  163



>ref|XP_004151979.1| PREDICTED: heat shock 70 kDa protein 16-like [Cucumis sativus]
 gb|KGN57923.1| hypothetical protein Csa_3G391900 [Cucumis sativus]
Length=762

 Score =   239 bits (609),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RETPA++ FGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETPAVIYFGEKQRFLGSAGAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            ++TISQVKRLIGR FS+P++Q +LK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFSEPDVQIELKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L++LK +AE NL A   DC IGIP YFTDLQRR    AA IA
Sbjct  121  LLAHLKDVAEKNLGAPFSDCVIGIPSYFTDLQRRLYWSAAVIA  163



>ref|XP_004167874.1| PREDICTED: LOW QUALITY PROTEIN: heat shock 70 kDa protein 16-like 
[Cucumis sativus]
Length=762

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RETPA++ FGEKQRFLG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETPAVIYFGEKQRFLGSAGAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            ++TISQVKRLIGR FS+P++Q +LK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFSEPDVQIELKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L++LK +AE NL A   DC IGIP YFTDLQRR    AA IA
Sbjct  121  LLAHLKDVAEKNLGAPFSDCVIGIPSYFTDLQRRLYWSAAVIA  163



>gb|EYU27798.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=722

 Score =   237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRFLG+AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQRGIDVLLNDESNRENPAVVSFGEKQRFLGSAGAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR FS+P +Q DL+  PF  +EGPDG  LIH RYL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRNFSEPTVQNDLRLLPFETSEGPDGGILIHLRYLEERQTFTPIQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L++LK IAE NL   + +C IGIP YFT LQRRA + AA IA
Sbjct  121  LLAHLKQIAEKNLETQISNCVIGIPSYFTALQRRAYLHAAEIA  163



>gb|EYU27799.1| hypothetical protein MIMGU_mgv1a001740mg [Erythranthe guttata]
Length=766

 Score =   238 bits (607),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRFLG+AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKQRGIDVLLNDESNRENPAVVSFGEKQRFLGSAGAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR FS+P +Q DL+  PF  +EGPDG  LIH RYL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRNFSEPTVQNDLRLLPFETSEGPDGGILIHLRYLEERQTFTPIQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L++LK IAE NL   + +C IGIP YFT LQRRA + AA IA
Sbjct  121  LLAHLKQIAEKNLETQISNCVIGIPSYFTALQRRAYLHAAEIA  163



>ref|XP_004232717.1| PREDICTED: heat shock 70 kDa protein 16 [Solanum lycopersicum]
Length=753

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+ VA+QRGIDV+LNDES RETPA+V FGEKQRF+G AGAA++ MNP
Sbjct  1    MSVVGFDVGNENCVIGVAKQRGIDVILNDESNRETPAVVSFGEKQRFIGAAGAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR++ +P +Q+DLK  PF+ +EGPDG  LI+  Y+ E  +FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLLPFATSEGPDGGILINLHYMDEKHSFTPVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK IAE NL   V DC IGIP YFTDLQRRA ++AA IA
Sbjct  121  LFAHLKQIAEKNLETDVSDCVIGIPSYFTDLQRRAYLNAAEIA  163



>ref|XP_010931798.1| PREDICTED: heat shock 70 kDa protein 16 [Elaeis guineensis]
Length=784

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GN++CV+A  +QRGIDV+LNDESKRETPA+V FGEKQRFLGT GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESKRETPAVVSFGEKQRFLGTTGAASAAMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            ++T+SQVKRLIGR F  P++Q DL+  PF  ++ PDG  LIH RYL E R FTP Q+LGM
Sbjct  61   RSTVSQVKRLIGRAFDHPDVQADLRRLPFLTSQAPDGGILIHLRYLNEDRAFTPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L++LK +AE +L   V DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LLAHLKDVAEKSLETLVSDCVIGIPSYFTDLQRRAYLDAAAIA  163



>gb|AII99889.1| heat shock protein [Cicer arietinum]
Length=771

 Score =   236 bits (603),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV +Q G+DV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQGGVDVLLNDESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F+D ++Q DLK  P   +EG DG  LIH +YL E   FTP Q+L M
Sbjct  61   KSTVSQVKRLIGRRFADLDVQNDLKRLPIETSEGSDGGILIHLKYLKETHKFTPVQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            + ++LK+IAE +L  AV DC IG+P YFTDLQRRA +DAATI
Sbjct  121  LFAHLKTIAENDLGTAVSDCVIGVPSYFTDLQRRAYLDAATI  162



>ref|XP_004491392.1| PREDICTED: heat shock 70 kDa protein 16-like [Cicer arietinum]
Length=773

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV +Q G+DV+LNDES RETPA+VCFGEKQRFLG+AGAA++MM+P
Sbjct  1    MSVVGFDIGNENCVIAVVKQGGVDVLLNDESNRETPAVVCFGEKQRFLGSAGAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F+D ++Q DLK  P   +EG DG  LIH +YL E   FTP Q+L M
Sbjct  61   KSTVSQVKRLIGRRFADLDVQNDLKRLPIETSEGSDGGILIHLKYLKETHKFTPVQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            + ++LK+IAE +L  AV DC IG+P YFTDLQRRA +DAATI
Sbjct  121  LFAHLKTIAENDLGTAVSDCVIGVPSYFTDLQRRAYLDAATI  162



>ref|XP_002278262.1| PREDICTED: heat shock 70 kDa protein 16 [Vitis vinifera]
Length=771

 Score =   236 bits (602),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV++V +QRGIDV+LNDESKRETP++VCFGEKQR LG+AGAA++ MNP
Sbjct  1    MSVVGFDIGNENCVISVVKQRGIDVLLNDESKRETPSVVCFGEKQRILGSAGAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            ++TI QVKRLIG  FS+P ++ +LK FPF  +EGPDG  LIH +YLGE  TFTP Q+L M
Sbjct  61   RSTIFQVKRLIGLNFSEPHIKDELKMFPFETSEGPDGGILIHLQYLGERHTFTPVQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK I E NL   ++DC IGIP YFTDLQRRA + AA IA
Sbjct  121  LFAHLKDITEKNLEFPILDCVIGIPSYFTDLQRRAYLYAAEIA  163



>ref|XP_008465078.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
 ref|XP_008465079.1| PREDICTED: heat shock 70 kDa protein 16 [Cucumis melo]
Length=762

 Score =   236 bits (601),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV+RQRGIDV+LN+ES+RET A++CFGEKQRFLG+A AA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAVSRQRGIDVLLNEESQRETSAVICFGEKQRFLGSAAAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            ++TISQVKRLIGR F++P +Q DLK FPF  +E  DG  L+H +YLGE  TFTP Q++GM
Sbjct  61   RSTISQVKRLIGRNFTEPGVQIDLKMFPFKTSEALDGSILVHVKYLGETHTFTPVQIMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L++L+ +AE NL A   DC IGIP YFTDLQRR   +AA IA
Sbjct  121  LLAHLRDVAEKNLGAPFSDCVIGIPSYFTDLQRRLYWNAAAIA  163



>ref|XP_008806739.1| PREDICTED: heat shock 70 kDa protein 16 isoform X2 [Phoenix dactylifera]
Length=782

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GN++CV+A  +QRGIDV+LNDES+RETPA+V FGEKQRFLG+ GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESERETPAVVSFGEKQRFLGSTGAASAAMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            ++T+SQVKRL+GR F  P++Q DL+  PF  ++  DG  LIH RYL E RTFTP Q+LGM
Sbjct  61   RSTVSQVKRLVGRAFGHPDVQSDLRRLPFPTSQASDGGILIHIRYLNEDRTFTPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L++LK +AE +L  +V DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LLAHLKDVAEKSLETSVSDCVIGIPSYFTDLQRRAYLDAAAIA  163



>ref|XP_008806738.1| PREDICTED: heat shock 70 kDa protein 16 isoform X1 [Phoenix dactylifera]
Length=783

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GN++CV+A  +QRGIDV+LNDES+RETPA+V FGEKQRFLG+ GAA++ MNP
Sbjct  1    MSVVGFDIGNDNCVIAAVKQRGIDVLLNDESERETPAVVSFGEKQRFLGSTGAASAAMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            ++T+SQVKRL+GR F  P++Q DL+  PF  ++  DG  LIH RYL E RTFTP Q+LGM
Sbjct  61   RSTVSQVKRLVGRAFGHPDVQSDLRRLPFPTSQASDGGILIHIRYLNEDRTFTPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L++LK +AE +L  +V DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LLAHLKDVAEKSLETSVSDCVIGIPSYFTDLQRRAYLDAAAIA  163



>gb|KJB69295.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69296.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69297.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
 gb|KJB69298.1| hypothetical protein B456_011G014900 [Gossypium raimondii]
Length=774

 Score =   233 bits (595),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 134/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVG D+GNE+C++AVA+QRGIDV+LNDESKRETPA V FGEKQRF+G+AGAA++ MNP
Sbjct  1    MSVVGLDIGNENCIIAVAKQRGIDVLLNDESKRETPAAVSFGEKQRFIGSAGAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            ++TI QVKRLIGR+F++P L+++LK FPF   E PDG  LI  +++GE+  FTP Q+LGM
Sbjct  61   RSTILQVKRLIGRKFNEPGLEKELKLFPFETFESPDGGILIRLQFMGEVHEFTPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE NL   V +C IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFSHLKQIAEKNLEMPVSECVIGIPSYFTDLQRRAYLDAAAIA  163



>ref|XP_004294376.1| PREDICTED: heat shock 70 kDa protein 16 [Fragaria vesca subsp. 
vesca]
Length=767

 Score =   233 bits (594),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVG D+GNE+CV+AV +QRGIDV+LN+ESKRETPA+VCFGEKQRFLG+A +A++MM+P
Sbjct  1    MSVVGIDIGNENCVIAVVKQRGIDVLLNEESKRETPAVVCFGEKQRFLGSAASASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F++ ++Q+DL+  PF  +EGPDG  LIH  YLG    FTP Q+  M
Sbjct  61   KSTVSQVKRLIGRRFNEADVQKDLRMLPFKTSEGPDGSILIHLSYLGGTHMFTPVQITAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++L+ I E NL   + DC IGIP YFTDLQRRA +DAAT+A
Sbjct  121  LFAHLREIIEKNLEMPISDCVIGIPSYFTDLQRRAYLDAATVA  163



>ref|XP_011096072.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096074.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
 ref|XP_011096075.1| PREDICTED: heat shock 70 kDa protein 16 [Sesamum indicum]
Length=756

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AVA++RGIDV+LNDESKRE PA+V FGEKQRF+G AGAA++ M+P
Sbjct  1    MSVVGFDIGNENCVIAVAKERGIDVLLNDESKRENPAVVSFGEKQRFIGCAGAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR +S+P +Q DL+  PF  +EGPDG  LIH +YL E +TFTP Q+L M
Sbjct  61   KSTISQVKRLIGRTYSEPTVQDDLRLLPFETSEGPDGGILIHLQYLDEKQTFTPIQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L++LK I E NL   + +C IGIP YFT LQRRA + AA IA
Sbjct  121  LLAHLKQITEKNLEKQITNCVIGIPSYFTALQRRAYLHAAEIA  163



>ref|XP_006348107.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Solanum 
tuberosum]
Length=753

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+GFDVGNE+CV+ VA+QRGIDV+LNDES RETPA+V FG+KQRF+G AGAA++ MNP
Sbjct  1    MSVIGFDVGNENCVIGVAKQRGIDVILNDESNRETPAVVSFGDKQRFIGAAGAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR++ +P +Q+DLK FPF+ +EG DG  LI+  Y+ E ++FTP Q++ M
Sbjct  61   KSTISQVKRLIGRKYREPAVQKDLKLFPFATSEGQDGGILINLHYMDEKQSFTPVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK IAE NL   V DC IGIP YFTDLQRRA + AA IA
Sbjct  121  LFAHLKQIAEKNLETDVSDCVIGIPSYFTDLQRRAYLYAAEIA  163



>gb|KHN45217.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=766

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCFGEKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFGEKQRILGSAGAASAMMHI  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y+GE+  FTP Q+L M
Sbjct  61   KSTISQIKRLIGRKFADPDVEKELKMLPVETSEGQDGGILIHLKYMGEIHVFTPVQLLSM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK++ E +L   + DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKTMTEKDLEMPISDCVIGIPSYFTDLQRRAYLDAAKIA  163



>ref|XP_003553093.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=766

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 135/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCFGEKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFGEKQRILGSAGAASAMMHI  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y+GE+  FTP Q+L M
Sbjct  61   KSTISQIKRLIGRKFADPDVEKELKMLPVETSEGQDGGILIHLKYMGEIHVFTPVQLLSM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK++ E +L   + DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKTMTEKDLEMLISDCVIGIPSYFTDLQRRAYLDAAKIA  163



>gb|AFG63451.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63452.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63453.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63454.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63455.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63456.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
 gb|AFG63457.1| hypothetical protein UMN_2640_01, partial [Pinus taeda]
Length=124

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNESC+VAVARQRGIDVVLNDESKRETPA+VCFGEKQRF+GTAGA++S+MNP
Sbjct  1    MSVVGFDVGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGEKQRFIGTAGASSSLMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN +SQ+KRLIG+QF DPE+QRDL+S P++V EGPDG   IHARYLG+ R FT TQ+L M
Sbjct  61   KNAVSQIKRLIGKQFRDPEVQRDLQSLPYTVDEGPDGGVRIHARYLGDSRAFTATQILAM  120

Query  494  VLSN  505
            +LSN
Sbjct  121  LLSN  124



>gb|KJB22069.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=686

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + ETNL   V+DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKYMTETNLGLPVLDCVIGIPSYFTDLQRRAYLDAAKIA  163



>ref|XP_007146461.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
 gb|ESW18455.1| hypothetical protein PHAVU_006G042400g [Phaseolus vulgaris]
Length=771

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV R+RGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRERGIDVLLNYESKRETPAVVCFNEKQRLLGSAGAASAMMHI  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F+DP++ ++LK  P   +E PDG  LIH +YLGE+  FTP Q++ M
Sbjct  61   KSTISQIKRLIGRKFADPDVDKELKMLPLETSESPDGGILIHLKYLGEIHVFTPVQIMSM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK++ E +L   + DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKTMTEKDLEMPISDCVIGIPSYFTDLQRRAYLDAAKIA  163



>ref|XP_002305580.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
 gb|EEE86091.2| hypothetical protein POPTR_0004s01640g [Populus trichocarpa]
Length=757

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+CV+AVA++RGIDV+LNDES RETPA+V F EKQRF+G+ GAA+  MNP
Sbjct  1    MSVVGFDFGNENCVIAVAKERGIDVLLNDESNRETPAVVSFFEKQRFMGSEGAASLTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F + E+Q DLK FPF + EG DG  LI  +YLGE+  F+P Q+LGM
Sbjct  61   KSTVSQVKRLIGRKFKEVEVQDDLKLFPFEIVEGHDGGILIKVQYLGEIHEFSPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE +L   + DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFSHLKQIAEKSLEMPISDCVIGIPCYFTDLQRRAYLDAAAIA  163



>emb|CDP04389.1| unnamed protein product [Coffea canephora]
Length=767

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+G DVGNE+CVVAVA+QRGIDV+LNDESKRETPA+V FGEKQRF+G  GAA++ MNP
Sbjct  1    MSVLGLDVGNENCVVAVAKQRGIDVLLNDESKRETPAVVSFGEKQRFMGAVGAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            ++TISQVKRLIGR+F +P +Q DLK  PF  +EGPDG  LIH  YL E ++FTP Q++ M
Sbjct  61   RSTISQVKRLIGRKFREPSVQDDLKLVPFETSEGPDGGILIHLYYLDEKQSFTPFQIMVM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +  +LK I+E NL   V DC IGIP YFTDLQRRA + AA IA
Sbjct  121  LFGHLKQISEKNLETHVSDCVIGIPSYFTDLQRRAYLHAAEIA  163



>ref|XP_011037663.1| PREDICTED: heat shock 70 kDa protein 16 [Populus euphratica]
Length=769

 Score =   230 bits (586),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNE+CV+AVA++RGIDV+LNDES RETPA+V F EKQRF+G+ GAA+  MNP
Sbjct  1    MSVVGFDFGNENCVIAVAKERGIDVLLNDESNRETPAVVSFFEKQRFMGSEGAASLTMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR+F + E+Q DLK FPF + EG DG  LI  +YLGE+  F+P Q+LGM
Sbjct  61   KSTVSQVKRLIGRKFKEVEVQDDLKLFPFEIVEGHDGGILIKVQYLGEIHEFSPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK IAE +L   + DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFSHLKQIAEKSLEMPISDCVIGIPCYFTDLQRRAYLDAAAIA  163



>gb|KHG25442.1| Heat shock 70 kDa 16 -like protein [Gossypium arboreum]
Length=757

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + ETNL   V+DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKYMTETNLGLPVLDCVIGIPSYFTDLQRRAYLDAAKIA  163



>gb|KJB22068.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
 gb|KJB22070.1| hypothetical protein B456_004G027900 [Gossypium raimondii]
Length=757

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE CV+A  +QRG+DV+LNDESKRETPALVCFGEKQRFLG+A AA++MM+P
Sbjct  1    MSVVGFDIGNEKCVIAAVKQRGVDVLLNDESKRETPALVCFGEKQRFLGSAAAASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K T+SQVKRLIGR+F DP++Q +L+  PF  +EG DG  LIH +YLGE   FTP Q++ M
Sbjct  61   KTTVSQVKRLIGRKFQDPDVQNELRMLPFETSEGQDGGILIHLKYLGETHRFTPVQIMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + ETNL   V+DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKYMTETNLGLPVLDCVIGIPSYFTDLQRRAYLDAAKIA  163



>ref|XP_008365284.1| PREDICTED: heat shock 70 kDa protein 16, partial [Malus domestica]
Length=683

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AV  Q G+DV+LNDESKRETPA VCFGEKQRFLG+AGAA++MMNP
Sbjct  1    MSVVGFDVGNENCVIAVVXQXGVDVLLNDESKRETPAXVCFGEKQRFLGSAGAASAMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRL GR+F++P++QRDL       +E PDG  LIH +YLG   TFTP QV  M
Sbjct  61   KSTVSQVKRLXGRKFTEPDVQRDLXILXXXTSEAPDGGILIHLKYLGATHTFTPVQVTAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK + E N    + DC IGIP YFTD QRRA +DAA +A
Sbjct  121  LFAHLKDLIEKNQEMPIXDCVIGIPSYFTDXQRRAYLDAAXVA  163



>ref|XP_006475182.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Citrus 
sinensis]
 gb|KDO62656.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=708

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 129/163 (79%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+A  + RG+DV+LN+ES RETP++VCFGEKQRF+G AG A++MM+P
Sbjct  1    MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR++ DP +Q+DL   PF   E PDG   I  +YLGE  TF P QV+GM
Sbjct  61   KSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK +AE NL   VVDC IG+P YFTDLQRR  ++AA+IA
Sbjct  121  LFSHLKDVAEKNLEMPVVDCVIGVPSYFTDLQRREYLNAASIA  163



>ref|XP_006452327.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 ref|XP_006475181.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Citrus 
sinensis]
 gb|ESR65567.1| hypothetical protein CICLE_v10007538mg [Citrus clementina]
 gb|KDO62654.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
 gb|KDO62655.1| hypothetical protein CISIN_1g004296mg [Citrus sinensis]
Length=763

 Score =   227 bits (578),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 129/163 (79%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+A  + RG+DV+LN+ES RETP++VCFGEKQRF+G AG A++MM+P
Sbjct  1    MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+T+SQVKRLIGR++ DP +Q+DL   PF   E PDG   I  +YLGE  TF P QV+GM
Sbjct  61   KSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK +AE NL   VVDC IG+P YFTDLQRR  ++AA+IA
Sbjct  121  LFSHLKDVAEKNLEMPVVDCVIGVPSYFTDLQRREYLNAASIA  163



>gb|KHM99573.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=769

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFSEKQRILGSAGAASAMMHI  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y GE+  FTP Q L M
Sbjct  61   KSTISQIKRLIGRKFADPDVKKELKMLPGKTSEGQDGGILIHLKYSGEIHVFTPVQFLSM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK++ E +L   + DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKTMTENDLEMPISDCVIGIPSYFTDLQRRAYLDAAKIA  163



>ref|XP_003532123.1| PREDICTED: heat shock 70 kDa protein 16-like [Glycine max]
Length=769

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+AV RQRGIDV+LN ESKRETPA+VCF EKQR LG+AGAA++MM+ 
Sbjct  1    MSVVGFDIGNENCVIAVVRQRGIDVLLNYESKRETPAVVCFSEKQRILGSAGAASAMMHI  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F+DP+++++LK  P   +EG DG  LIH +Y GE+  FTP Q L M
Sbjct  61   KSTISQIKRLIGRKFADPDVKKELKMLPGKTSEGQDGGILIHLKYSGEIHVFTPVQFLSM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + ++LK++ E +L   + DC IGIP YFTDLQRRA +DAA IA
Sbjct  121  LFAHLKTMTENDLEMPISDCVIGIPSYFTDLQRRAYLDAAKIA  163



>ref|XP_010665569.1| PREDICTED: heat shock 70 kDa protein 16 [Beta vulgaris subsp. 
vulgaris]
Length=767

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+CV+A  +QRGIDV+LN+ESKRETP +V FGE QR  G+A AA++ MNP
Sbjct  1    MSVVGFDIGNENCVIAAVKQRGIDVLLNEESKRETPGVVSFGENQRLFGSAAAASATMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
             +TISQVKRLIGR+F +P++Q DL+ FPF  +EGPDG+ LIH +YLGE++TFTP Q+L M
Sbjct  61   TSTISQVKRLIGRRFDNPKVQNDLRLFPFETSEGPDGYILIHLKYLGELQTFTPVQLLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + S+LK  A+ +L+  V DC IGIP YFT LQR   +DAA IA
Sbjct  121  LFSHLKETADKSLDVPVNDCVIGIPSYFTVLQRYLYMDAAKIA  163



>ref|XP_006306833.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39731.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=737

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGID++LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDILLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG  LI  RY+GEM+ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEGSDGGILIQLRYMGEMQGFSPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK IAE +L   V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIA  163



>ref|XP_006306834.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
 gb|EOA39732.1| hypothetical protein CARUB_v10008380mg [Capsella rubella]
Length=763

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 133/163 (82%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGID++LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDILLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG  LI  RY+GEM+ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEGSDGGILIQLRYMGEMQGFSPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK IAE +L   V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIA  163



>gb|KDO75458.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75459.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=692

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  310
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  311  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  490
            PK+TISQVKRL+GR+F + ++Q+DLK FPF   E  DG  LI   YLGE   FTP Q+LG
Sbjct  61   PKSTISQVKRLLGRKFREDDVQKDLKLFPFETCESHDGGILIMLEYLGETHKFTPVQILG  120

Query  491  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            M+LSNLK I E N+   + +C IG+P Y TD+QRRA +DAATIA
Sbjct  121  MLLSNLKQITEKNIKIPISNCVIGVPCYLTDVQRRAYLDAATIA  164



>ref|XP_006595737.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X2 [Glycine 
max]
Length=773

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MS VG D+GNE+CV+A  +QR IDV+LNDESKRETP +VCFGEKQRF+G+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQRVIDVLLNDESKRETPGVVCFGEKQRFIGSAGAVSAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR+F+DP++Q DLK  P   +EGPDG  LI  +YL E+  FTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFTDPDVQNDLKLLPVETSEGPDGGILIRLKYLKEIHAFTPVQIVAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            + ++LK+IAE +   AV DC IG+P YFT+LQR+A +DAA I
Sbjct  121  LFAHLKTIAEKDFGTAVSDCVIGVPSYFTNLQRQAYLDAAAI  162



>ref|XP_006595736.1| PREDICTED: heat shock 70 kDa protein 16-like isoform X1 [Glycine 
max]
 gb|KHN11927.1| Heat shock 70 kDa protein 16 [Glycine soja]
Length=802

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MS VG D+GNE+CV+A  +QR IDV+LNDESKRETP +VCFGEKQRF+G+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQRVIDVLLNDESKRETPGVVCFGEKQRFIGSAGAVSAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQVKRLIGR+F+DP++Q DLK  P   +EGPDG  LI  +YL E+  FTP Q++ M
Sbjct  61   KSTISQVKRLIGRRFTDPDVQNDLKLLPVETSEGPDGGILIRLKYLKEIHAFTPVQIVAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            + ++LK+IAE +   AV DC IG+P YFT+LQR+A +DAA I
Sbjct  121  LFAHLKTIAEKDFGTAVSDCVIGVPSYFTNLQRQAYLDAAAI  162



>ref|XP_006468028.1| PREDICTED: heat shock 70 kDa protein 16-like [Citrus sinensis]
 gb|KDO75456.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
 gb|KDO75457.1| hypothetical protein CISIN_1g004211mg [Citrus sinensis]
Length=768

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  310
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  311  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  490
            PK+TISQVKRL+GR+F + ++Q+DLK FPF   E  DG  LI   YLGE   FTP Q+LG
Sbjct  61   PKSTISQVKRLLGRKFREDDVQKDLKLFPFETCESHDGGILIMLEYLGETHKFTPVQILG  120

Query  491  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            M+LSNLK I E N+   + +C IG+P Y TD+QRRA +DAATIA
Sbjct  121  MLLSNLKQITEKNIKIPISNCVIGVPCYLTDVQRRAYLDAATIA  164



>ref|XP_010493114.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
 ref|XP_010493121.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=764

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK  AE +L   V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  LLSHLKQTAEKSLKTPVSDCVIGIPSYFTNAQRLAYLDAAAIA  163



>ref|XP_002889885.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66144.1| hypothetical protein ARALYDRAFT_888478 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +E  DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK IAE +L   V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIA  163



>ref|XP_010458573.1| PREDICTED: heat shock 70 kDa protein 16-like [Camelina sativa]
Length=765

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE++ F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQRFSPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK  AE +L   V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  LLSHLKQTAEKSLKTPVSDCVIGIPSYFTNAQRLAYLDAAAIA  163



>ref|XP_010476099.1| PREDICTED: heat shock 70 kDa protein 16 [Camelina sativa]
Length=764

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +EG DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFEASEGSDGGIQIQLRYMGEIQSFSPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK  AE +L   V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  LLSHLKLTAEKSLKTPVSDCVIGIPSYFTNAQRLAYLDAAAIA  163



>ref|NP_172631.2| heat shock protein 70 (Hsp 70) family protein [Arabidopsis thaliana]
 sp|Q9SAB1.1|HSP7Q_ARATH RecName: Full=Heat shock 70 kDa protein 16; AltName: Full=Heat 
shock protein 70-16; Short=AtHsp70-16 [Arabidopsis thaliana]
 gb|AAD30257.1|AC007296_18 Strong similarity to gb|Z70314 heat-shock protein from Arabidopsis 
thaliana and is a member of the PF|00012 Hsp70 protein 
family [Arabidopsis thaliana]
 gb|AEE28767.1| heat shock protein 70 (Hsp 70) family protein [Arabidopsis thaliana]
Length=763

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F +P++Q DL+ FPF  +E  DG   I  RY+GE+++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEIQSFSPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK IAE +L   V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIA  163



>emb|CBI36157.3| unnamed protein product [Vitis vinifera]
Length=784

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 120/163 (74%), Gaps = 41/163 (25%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD GNESC+VAVARQRGIDVVLNDESKRETPA+VCFG+KQRF+GTAGAA++MMNP
Sbjct  1    MSVVGFDFGNESCIVAVARQRGIDVVLNDESKRETPAIVCFGDKQRFIGTAGAASTMMNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KN+ISQ+KRLIGRQFSDPELQ+DLKS PF+VTEGPD                        
Sbjct  61   KNSISQMKRLIGRQFSDPELQQDLKSLPFTVTEGPD------------------------  96

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
                             VDCCIGIPVYFTDLQRRAV+DAATIA
Sbjct  97   -----------------VDCCIGIPVYFTDLQRRAVLDAATIA  122



>ref|XP_006417329.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
 gb|ESQ35682.1| hypothetical protein EUTSA_v10006883mg [Eutrema salsugineum]
Length=763

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE PA+V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIG ++ +P++Q DL+ FPF  +E  DG   I  RY+GEM++F+P Q+LGM
Sbjct  61   KSTISQLKRLIGMKYREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEMQSFSPVQLLGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK IAE +L   V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  LLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIA  163



>emb|CDY49794.1| BnaCnng18070D [Brassica napus]
Length=761

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  490
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFREPDVQKDLKLFPFETSEDSADGGIQIRLRYMGEVQSFSPVQILG  120

Query  491  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            M+LS+LK +AE +LN  V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  MLLSHLKQVAEKSLNTPVSDCVIGIPSYFTNSQRLAYLDAAAIA  164



>emb|CDX97975.1| BnaA06g07260D [Brassica napus]
Length=761

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  490
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFKEPDVQKDLKLFPFETSEDSADGGIQIQLRYMGEVQSFSPVQILG  120

Query  491  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            M+LS+LK +AE +L   V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  MLLSHLKQVAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIA  164



>ref|XP_009148495.1| PREDICTED: heat shock 70 kDa protein 16 [Brassica rapa]
 ref|XP_009148496.1| PREDICTED: heat shock 70 kDa protein 16 [Brassica rapa]
Length=761

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGNE+CV+AVA+QRGIDV+LNDES RE P +V FGEKQRF+G A AA++ M+P
Sbjct  1    MSVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPGMVSFGEKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTE-GPDGFPLIHARYLGEMRTFTPTQVLG  490
            K+TISQ+KRLIGR+F +P++Q+DLK FPF  +E   DG   I  RY+GE+++F+P Q+LG
Sbjct  61   KSTISQLKRLIGRKFKEPDVQKDLKLFPFETSEDSADGGIQIQLRYMGEVQSFSPVQILG  120

Query  491  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            M+LS+LK +AE +L   V DC IGIP YFT+ QR A +DAA IA
Sbjct  121  MLLSHLKQVAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIA  164



>ref|XP_009420545.1| PREDICTED: heat shock 70 kDa protein 16 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGN+SCVVA  RQRGIDV+LNDES+RE PA+V FGEKQRFLG AGAA++   P
Sbjct  1    MSVVGFDVGNDSCVVAAVRQRGIDVLLNDESQRENPAVVSFGEKQRFLGAAGAASAARFP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            ++T+SQVKRL+GR F DP +Q DL+  PF  +E PDG  LI  R+L E R FTP Q+L M
Sbjct  61   RSTVSQVKRLLGRPFRDPAVQDDLRRLPFPTSEAPDGGILIRIRFLNEERVFTPVQILAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L++LK IAE +L   V DC IGIP Y TDLQRRA +DAATIA
Sbjct  121  LLAHLKLIAEKSLETLVSDCVIGIPSYLTDLQRRAYLDAATIA  163



>ref|XP_007142282.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
 gb|ESW14276.1| hypothetical protein PHAVU_008G267400g [Phaseolus vulgaris]
Length=765

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MS VG D+GNE+CV+A  +Q G+DV+LNDESKRETPA+VCFGEKQRFLG+AGA ++MM+P
Sbjct  1    MSGVGIDIGNENCVIAAVKQGGVDVLLNDESKRETPAVVCFGEKQRFLGSAGADSAMMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+ ISQVKRLIGR+F+DP++Q +LK  P   +E  DG  LIH +Y+ E   FTP Q++ M
Sbjct  61   KSAISQVKRLIGRRFADPDVQNELKMLPVETSESADGGILIHLKYMKESHVFTPVQIVAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            + ++LK+IAE      V DC IG+P YFT+LQR+  ++AA I
Sbjct  121  LFAHLKTIAEKGFGTTVSDCVIGVPSYFTNLQRQDYLNAAAI  162



>ref|XP_010533816.1| PREDICTED: heat shock 70 kDa protein 16 [Tarenaya hassleriana]
Length=763

 Score =   211 bits (536),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 128/163 (79%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            M+VVGFDVGNE C++AVA+QRGIDV+LN+ES RETP++V FG+KQRF+G A AA++ M+P
Sbjct  1    MNVVGFDVGNEKCIIAVAKQRGIDVLLNEESNRETPSVVSFGDKQRFMGAAAAASATMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLIGR+F +P++Q DL+ FPF   EG DG   I  +Y G   +F+P Q+LGM
Sbjct  61   KSTISQLKRLIGRKFGEPDVQNDLRLFPFETFEGSDGGVQIRLQYSGMTHSFSPVQILGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK I E NL   V DC IGIP YFT+LQR A +DAA IA
Sbjct  121  LLSHLKQITEKNLKMPVSDCVIGIPSYFTNLQRLAYLDAAAIA  163



>gb|EPS74057.1| hypothetical protein M569_00693, partial [Genlisea aurea]
Length=738

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 122/162 (75%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GN++CV+AVA QRG+DV+LNDESKRETPA+V FG+KQRF+G++GAA++ M+P
Sbjct  1    MSVVGFDIGNDNCVIAVANQRGVDVLLNDESKRETPAVVSFGDKQRFMGSSGAASTTMHP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TISQ+KRLI   + DP +Q +L+  PF  +EG DG  LIH RYLG+   FTP QVL M
Sbjct  61   KSTISQIKRLITLSYRDPSVQNELQLLPFETSEGADGGILIHLRYLGQRHIFTPVQVLAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            +L  LK + E NL   +  C I IP YFTD QR + + AA I
Sbjct  121  LLGYLKELTEKNLGMEIASCVISIPSYFTDSQRSSYLYAAEI  162



>ref|XP_006449032.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62272.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=646

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 116/164 (71%), Gaps = 17/164 (10%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  310
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  311  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  490
            PK+TISQ                DLK FPF   E  DG  LI   YLGE+  FTP Q+LG
Sbjct  61   PKSTISQ----------------DLKLFPFETCESHDGGILIMLEYLGELHKFTPVQILG  104

Query  491  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            M+LSNLK I E N+   + +C IG+P Y TD+QRRA +DAATIA
Sbjct  105  MLLSNLKQITEKNIKIPISNCVIGVPCYLTDVQRRAYLDAATIA  148



>ref|XP_006449031.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
 gb|ESR62271.1| hypothetical protein CICLE_v10014383mg [Citrus clementina]
Length=752

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 116/164 (71%), Gaps = 17/164 (10%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRG-IDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMN  310
            MSVVGFD+GNE+CV+A  +Q G +DV+LNDESKRETP +V F EKQRFLG+AGAA++MMN
Sbjct  1    MSVVGFDIGNENCVIAAVKQGGMLDVLLNDESKRETPTVVSFSEKQRFLGSAGAASAMMN  60

Query  311  PKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLG  490
            PK+TISQ                DLK FPF   E  DG  LI   YLGE+  FTP Q+LG
Sbjct  61   PKSTISQ----------------DLKLFPFETCESHDGGILIMLEYLGELHKFTPVQILG  104

Query  491  MVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            M+LSNLK I E N+   + +C IG+P Y TD+QRRA +DAATIA
Sbjct  105  MLLSNLKQITEKNIKIPISNCVIGVPCYLTDVQRRAYLDAATIA  148



>ref|XP_003082170.1| heat shock protein 91-Arabidopsis thaliana (ISS) [Ostreococcus 
tauri]
Length=779

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVG D GN + VVA+AR++GIDVVLNDESKRETP++V FGEKQRF+G+A A    M P
Sbjct  29   MSVVGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKINMKP  88

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +NT++QVKRL+GR F DPE+QRDL+   + V +G +G  L    YLG+ + FTP Q +  
Sbjct  89   RNTVTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQCVAS  148

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            +LS+LK IAE +    V DC I +PVY TD  RRA++DAA++
Sbjct  149  ILSDLKRIAEKDNGTKVTDCVISVPVYATDAHRRAMLDAASM  190



>emb|CEF99759.1| Heat shock protein 70 family [Ostreococcus tauri]
Length=801

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVG D GN + VVA+AR++GIDVVLNDESKRETP++V FGEKQRF+G+A A    M P
Sbjct  1    MSVVGIDFGNATNVVALARRKGIDVVLNDESKRETPSMVNFGEKQRFIGSAAADKINMKP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +NT++QVKRL+GR F DPE+QRDL+   + V +G +G  L    YLG+ + FTP Q +  
Sbjct  61   RNTVTQVKRLVGRAFDDPEVQRDLRGLFYPVKKGKNGEVLCEMEYLGKKKEFTPEQCVAS  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATI  619
            +LS+LK IAE +    V DC I +PVY TD  RRA++DAA++
Sbjct  121  ILSDLKRIAEKDNGTKVTDCVISVPVYATDAHRRAMLDAASM  162



>ref|XP_001695858.1| heat shock protein 70E [Chlamydomonas reinhardtii]
 gb|EDP01195.1| heat shock protein 70E [Chlamydomonas reinhardtii]
Length=803

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 119/163 (73%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            +SVVGFDVGN++  VA+AR+RGIDV++N ESKRETPA + FGEK RFLGT GAA   + P
Sbjct  4    VSVVGFDVGNDTSCVALARKRGIDVIMNKESKRETPAAINFGEKMRFLGTDGAAKLGLQP  63

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +NT+ Q+KR++G++F DP++Q D+   PF+V EGPDG  LI  RY  E   FTP QV+ M
Sbjct  64   QNTVHQLKRILGKKFKDPQVQEDIARLPFAVIEGPDGGCLIKVRYCNEEAVFTPEQVMAM  123

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            V+ +LK IAE     AV DC + +P YF + +R A+++AA IA
Sbjct  124  VIVDLKRIAEAEGGIAVTDCALSVPDYFVEAERYAMLNAAQIA  166



>ref|XP_002949519.1| heat shock protein Hsp70E [Volvox carteri f. nagariensis]
 gb|EFJ49538.1| heat shock protein Hsp70E [Volvox carteri f. nagariensis]
Length=809

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 118/163 (72%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            +SVVGFDVGN++  VA+AR+RGIDV++N ESKRETPA + FGEK RFLGT GAA   + P
Sbjct  4    VSVVGFDVGNDTSCVALARKRGIDVIMNKESKRETPAAINFGEKMRFLGTDGAAKLGLQP  63

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            +NT+ Q+KR++G++F DP +Q D+   PF+V EGPDG  LI  RY  E   FTP QV+ M
Sbjct  64   QNTVHQLKRILGKKFQDPLVQADIAKLPFAVLEGPDGGCLIKVRYCNEDAIFTPEQVMAM  123

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L +LK IAE      V DC + +P YFT+ +R A+++AA IA
Sbjct  124  ILVDLKRIAEAESGIPVTDCALSVPTYFTEAERYAMLNAAQIA  166



>ref|XP_002505210.1| heat shock protein 70 [Micromonas sp. RCC299]
 gb|ACO66468.1| heat shock protein 70 [Micromonas sp. RCC299]
Length=811

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVG D G+ + VVA+AR++GIDVVLN ESKRETPA+V FG+KQRF+G A A    M P
Sbjct  1    MSVVGLDFGSVNSVVALARRKGIDVVLNTESKRETPAMVNFGDKQRFIGCAAADKINMQP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTI Q+KRLIG +FSDPE+Q  + +F F ++ GP+   LI   YLGE +TFTP +++ M
Sbjct  61   KNTIVQLKRLIGLRFSDPEVQALVPAFLFPISGGPNDEILITVDYLGEKKTFTPERLVAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +LS+LK IAE +  A V D  I +PV+FTD QRRA++DAA+IA
Sbjct  121  ILSDLKVIAEADHGAKVTDSVISVPVFFTDAQRRAMLDAASIA  163



>ref|XP_002973871.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
 gb|EFJ24826.1| hypothetical protein SELMODRAFT_267697 [Selaginella moellendorffii]
Length=751

 Score =   186 bits (472),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 1/164 (1%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MS +G D+GNE   +A+ARQ G+DV L++ES RETP+++ F ++ R +G +GAA+++ N 
Sbjct  1    MSCLGLDLGNEHSRIAIARQGGVDVFLDEESSRETPSVISFTQRDRCIGASGAASALGNL  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+ Q+KR+IGR+F DPELQ DLK  P  VTEG  G+P IH  YLGE R F  T++LGM
Sbjct  61   KNTVWQIKRIIGRKFRDPELQSDLKLMPCLVTEGRGGWPAIHVSYLGEHRIFGATELLGM  120

Query  494  VLSNLKSIAETN-LNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VL++LKSIA  N +  A  +C IG P +  D+QRRA +DAA IA
Sbjct  121  VLAHLKSIAAKNMMGVAPGECVIGTPAFMDDVQRRAYVDAAAIA  164



>ref|XP_002969191.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
 gb|EFJ30307.1| hypothetical protein SELMODRAFT_440676 [Selaginella moellendorffii]
Length=743

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 1/164 (1%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MS +G D+GNE   +A+ARQ G+DV L++ES RETP+++ F ++ R +G +GAA+++ N 
Sbjct  1    MSCLGLDLGNEHSRIAIARQGGVDVFLDEESSRETPSVISFTQRDRCIGASGAASALGNL  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+ Q+KR+IGR+F DPELQ DLK  P  VTEG  G+P IH  YLGE R F  T++LGM
Sbjct  61   KNTVWQIKRIIGRKFRDPELQSDLKLMPCLVTEGRGGWPAIHVSYLGEHRIFGATELLGM  120

Query  494  VLSNLKSIAETN-LNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            VL++LKSIA  N +  A  +C IG P +  D+QRRA +DAA IA
Sbjct  121  VLAHLKSIAAKNMMGVAPGECVIGTPAFMDDVQRRAYVDAAAIA  164



>ref|XP_003060408.1| heat shock protein 70 [Micromonas pusilla CCMP1545]
 gb|EEH55177.1| heat shock protein 70 [Micromonas pusilla CCMP1545]
Length=819

 Score =   182 bits (463),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 118/163 (72%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVG D GN + V+A+AR++GIDVVLN ESKRETP++V FGEKQRFLG A A    M P
Sbjct  1    MSVVGLDFGNANSVIALARRKGIDVVLNGESKRETPSMVNFGEKQRFLGCAAADKINMKP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            K+TI Q+K LIG ++SDPE+Q  L +F F +  GP+   LI   Y+ E + FTP +++ M
Sbjct  61   KDTIVQLKSLIGLRYSDPEVQAMLPNFVFPIAGGPNDEILITVTYMNEKKAFTPERLVAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
             L++LK IAE +  + V D  I IPV+FTD QRRA++DAA+IA
Sbjct  121  ALADLKIIAEQDQGSKVTDAVISIPVFFTDAQRRAMLDAASIA  163



>ref|XP_005642775.1| heat shock protein 70E [Coccomyxa subellipsoidea C-169]
 gb|EIE18231.1| heat shock protein 70E [Coccomyxa subellipsoidea C-169]
Length=792

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 120/163 (74%), Gaps = 1/163 (1%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV G D+G++   +AVAR+RGIDV++N ESKRETP+LV FG KQR LGT  A +  +NP
Sbjct  1    MSVAGIDIGDQKSCIAVARKRGIDVLMNKESKRETPSLVSFGTKQRQLGTDAAGSLTINP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+  +KRL+G+ FS+P++QRDL   P++V+EGPDG  LI+  YLGE ++FTP Q++  
Sbjct  61   KNTLFGLKRLLGKNFSNPDVQRDLPELPYNVSEGPDGGILINVDYLGERQSFTPEQIVAA  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            ++ ++K IAE +  + V DC + +P Y+ + +R A++ AA IA
Sbjct  121  IIVDMKDIAEVD-GSPVTDCVLSVPTYYLETERYAMLAAAKIA  162



>sp|Q06068.2|HSP97_STRPU RecName: Full=97 kDa heat shock protein; AltName: Full=Egg sperm 
receptor [Strongylocentrotus purpuratus]
 gb|AAB09737.1| sperm receptor [Strongylocentrotus purpuratus]
Length=889

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 112/163 (69%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+SQ KR I R+FSDP +Q+D K  P+ +T+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L+ LKS AE NL   VVDC I +P Y+TDL+RR VI AA IA
Sbjct  121  ILTKLKSTAEINLCRKVVDCVISVPQYYTDLERRGVIHAAEIA  163



>ref|NP_999695.1| 97 kDa heat shock protein [Strongylocentrotus purpuratus]
 gb|AAB17669.1| egg receptor for sperm [Strongylocentrotus purpuratus]
Length=889

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 112/163 (69%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+SQ KR I R+FSDP +Q+D K  P+ +T+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARRFSDPSVQKDAKVVPYKITQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L+ LKS AE NL   VVDC I +P Y+TDL+RR VI AA IA
Sbjct  121  ILTKLKSTAEINLCRKVVDCVISVPQYYTDLERRGVIHAAEIA  163



>sp|Q94738.1|HSP97_STRFN RecName: Full=97 kDa heat shock protein; AltName: Full=Heat shock 
protein 110 [Strongylocentrotus franciscanus]
 gb|AAB09038.1| heat shock protein 110 [Strongylocentrotus franciscanus]
Length=886

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGN S  +AVAR  GI+ + N+ S R TP++V FGEK R  G A  + ++ N 
Sbjct  1    MSVVGFDVGNLSSYIAVARGGGIETMANEYSDRLTPSVVSFGEKSRTQGHAARSQAITNY  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+SQ KR I RQFSDP +Q+D    P+ VT+ P+G   +  +YLGE  TFTP Q+  M
Sbjct  61   KNTLSQFKRFIARQFSDPSVQKDAHVVPYKVTQLPNGNVGMQVQYLGETETFTPEQIYAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L+ LK+ AE NL   VVDC I +P Y+TDL+RR VI AA IA
Sbjct  121  ILTKLKATAEVNLCRKVVDCVISVPQYYTDLERRGVIHAAEIA  163



>ref|XP_002585532.1| hypothetical protein BRAFLDRAFT_111895 [Branchiostoma floridae]
 gb|EEN41543.1| hypothetical protein BRAFLDRAFT_111895 [Branchiostoma floridae]
Length=385

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 108/163 (66%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GN SC + VARQ GI+ + N+ S R TP +V FGEKQR +GT      + N 
Sbjct  1    MSVVGFDLGNLSCYIGVARQGGIETIANEYSDRCTPTVVSFGEKQRSIGTPAKNQMVTNY  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+ Q KR +GR+F DP++Q +L+   +   E PDG   +   Y GE   F+  Q+ GM
Sbjct  61   KNTVYQFKRFLGRRFQDPQVQSELQHVQYRAAEMPDGSTGMKLHYQGEEHVFSTEQITGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L+ LK ++E NL   VVDC I +P +FTD +RRAV+D+A+IA
Sbjct  121  ILTKLKEVSEMNLKVKVVDCVISVPCFFTDAERRAVLDSASIA  163



>gb|KJE91467.1| hsp97-like protein [Capsaspora owczarzaki ATCC 30864]
Length=789

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 113/168 (67%), Gaps = 0/168 (0%)
 Frame = +2

Query  119  LLATKMSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAAT  298
             L+  MSVVGFD+GNE+C +AVARQ GI+VV N+ + R+TPA+V  G K+RF+G AG   
Sbjct  18   FLSRTMSVVGFDLGNENCFIAVARQGGIEVVANEYTYRQTPAVVSLGAKKRFIGEAGKTA  77

Query  299  SMMNPKNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPT  478
               NPKNT+   K L+GR+++DP  Q +LK   +  TE  DGF      + GE +TFT  
Sbjct  78   IPTNPKNTVYNFKHLLGRKYNDPFTQAELKRAFYRHTETADGFVGFKLDFQGETKTFTVQ  137

Query  479  QVLGMVLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            Q++GM+L+ L+  AE NL   V DC + +P +FTD QRRA++DAA IA
Sbjct  138  QIMGMLLTQLRGTAEMNLKMKVTDCVLSVPSFFTDAQRRALLDAAQIA  185



>ref|XP_004349347.1| hsp97-like protein [Capsaspora owczarzaki ATCC 30864]
Length=767

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 111/163 (68%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GNE+C +AVARQ GI+VV N+ + R+TPA+V  G K+RF+G AG      NP
Sbjct  1    MSVVGFDLGNENCFIAVARQGGIEVVANEYTYRQTPAVVSLGAKKRFIGEAGKTAIPTNP  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+   K L+GR+++DP  Q +LK   +  TE  DGF      + GE +TFT  Q++GM
Sbjct  61   KNTVYNFKHLLGRKYNDPFTQAELKRAFYRHTETADGFVGFKLDFQGETKTFTVQQIMGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L+ L+  AE NL   V DC + +P +FTD QRRA++DAA IA
Sbjct  121  LLTQLRGTAEMNLKMKVTDCVLSVPSFFTDAQRRALLDAAQIA  163



>ref|XP_001641799.1| predicted protein [Nematostella vectensis]
 gb|EDO49736.1| predicted protein [Nematostella vectensis]
Length=843

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 109/163 (67%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFDVGN+SC +AVAR  GI+ V N+ S R TP+ V  G+KQR +GT+G    + N 
Sbjct  1    MSVVGFDVGNQSCYIAVARGGGIETVANEFSDRCTPSFVSLGDKQRLIGTSGKNQMISNL  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTISQ KR IGR+FSDP +Q+++   P+ V E P+    I  +YLG+   F+P QV+ M
Sbjct  61   KNTISQFKRFIGRKFSDPAVQKEIPHLPYKVVELPNDSIGIQVQYLGKQEVFSPEQVMAM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + + LK+ AE  L   V DC I +P Y+TD QRR ++DA+  A
Sbjct  121  LFTRLKTTAEIALKTKVTDCVISVPSYYTDRQRRCMLDASATA  163



>ref|XP_011304595.1| PREDICTED: 97 kDa heat shock protein isoform X2 [Fopius arisanus]
Length=806

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 107/163 (66%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+   KRL+GR+++DP++Q++L+S P+ VT  PDG   IH +YLGE   FTP Q+  M
Sbjct  64   KNTVFGFKRLLGRKYNDPQVQKELRSLPYKVTAQPDGTIGIHVQYLGEEHIFTPEQITAM  123

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + + LK I+ET L  AV DC I +P YFT  +R A+ DAA IA
Sbjct  124  LFTKLKEISETALQTAVNDCVISVPSYFTQSERLALFDAARIA  166



>ref|XP_011304586.1| PREDICTED: 97 kDa heat shock protein isoform X1 [Fopius arisanus]
Length=842

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 107/163 (66%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRGTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+   KRL+GR+++DP++Q++L+S P+ VT  PDG   IH +YLGE   FTP Q+  M
Sbjct  64   KNTVFGFKRLLGRKYNDPQVQKELRSLPYKVTAQPDGTIGIHVQYLGEEHIFTPEQITAM  123

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + + LK I+ET L  AV DC I +P YFT  +R A+ DAA IA
Sbjct  124  LFTKLKEISETALQTAVNDCVISVPSYFTQSERLALFDAARIA  166



>ref|XP_002585896.1| hypothetical protein BRAFLDRAFT_256670 [Branchiostoma floridae]
 gb|EEN41907.1| hypothetical protein BRAFLDRAFT_256670 [Branchiostoma floridae]
Length=738

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 108/163 (66%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSVVGFD+GN SC + VARQ GI+ + N+ S R TP +V FGEKQR +GT      + N 
Sbjct  1    MSVVGFDLGNLSCYIGVARQGGIETIANEYSDRCTPTVVSFGEKQRSIGTPAKNQMVTNY  60

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNT+ Q KR +GR+F DP++Q +L+   +   E PDG   +   Y GE   F+  Q+ GM
Sbjct  61   KNTVYQFKRFLGRRFQDPQVQSELQHVQYRAAEMPDGSTGMKLHYQGEEHIFSTEQITGM  120

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            +L+ LK ++E NL   VVDC I +P +FTD +RRAV+D+A+IA
Sbjct  121  ILTKLKEVSEMNLKVKVVDCVISVPCFFTDAERRAVLDSASIA  163



>ref|XP_003485911.1| PREDICTED: heat shock 70 kDa protein 4L-like [Bombus impatiens]
Length=866

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 107/163 (66%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRNTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTI   KRL+GR+++DP++QR+L++ PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQTLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + + LK I+ET L   V DC I +P Y+T  +R+A++DAA IA
Sbjct  124  LFTKLKDISETALQTVVNDCVISVPSYYTQAERQALLDAARIA  166



>ref|XP_006561225.1| PREDICTED: 97 kDa heat shock protein isoform X2 [Apis mellifera]
Length=831

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + + LK I+ET L   V DC I +P YFT  +R+A++DAA IA
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYFTQAERQALLDAARIA  166



>ref|XP_006615729.1| PREDICTED: 97 kDa heat shock protein-like isoform X2 [Apis dorsata]
Length=831

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + + LK I+ET L   V DC I +P YFT  +R+A++DAA IA
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYFTQAERQALLDAARIA  166



>ref|XP_006615728.1| PREDICTED: 97 kDa heat shock protein-like isoform X1 [Apis dorsata]
Length=867

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + + LK I+ET L   V DC I +P YFT  +R+A++DAA IA
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYFTQAERQALLDAARIA  166



>ref|XP_003691374.1| PREDICTED: heat shock 70 kDa protein 4L-like [Apis florea]
Length=866

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + + LK I+ET L   V DC I +P YFT  +R+A++DAA IA
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYFTQAERQALLDAARIA  166



>ref|XP_623199.2| PREDICTED: 97 kDa heat shock protein isoformX1 [Apis mellifera]
Length=867

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 106/163 (65%), Gaps = 0/163 (0%)
 Frame = +2

Query  134  MSVVGFDVGNESCVVAVARQRGIDVVLNDESKRETPALVCFGEKQRFLGTAGAATSMMNP  313
            MSV+G D GNESC VAVAR  GI+ + ND S R TP+ V F  K R LG A     + N 
Sbjct  4    MSVIGIDFGNESCYVAVARAGGIETIANDYSLRSTPSCVAFSGKNRILGVAAKNQMVTNM  63

Query  314  KNTISQVKRLIGRQFSDPELQRDLKSFPFSVTEGPDGFPLIHARYLGEMRTFTPTQVLGM  493
            KNTI   KRL+GR+++DP++QR+L+  PF VT   DG   IH +YLGE   F+P Q+  M
Sbjct  64   KNTIHGFKRLLGRKYNDPQVQRELQMLPFKVTHQSDGSIGIHVQYLGEEHIFSPEQITAM  123

Query  494  VLSNLKSIAETNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIA  622
            + + LK I+ET L   V DC I +P YFT  +R+A++DAA IA
Sbjct  124  LFTKLKDISETALQTIVNDCVISVPSYFTQAERQALLDAARIA  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950