BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN046I21

Length=517
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010656172.1|  PREDICTED: uncharacterized protein LOC100266...  85.9    9e-17   Vitis vinifera
ref|XP_010656174.1|  PREDICTED: uncharacterized protein LOC100266...  85.9    1e-16   
ref|XP_002514886.1|  conserved hypothetical protein                   79.0    3e-14   
ref|XP_010250652.1|  PREDICTED: uncharacterized protein LOC104592840  78.2    7e-14   Nelumbo nucifera [Indian lotus]
gb|KJB30854.1|  hypothetical protein B456_005G164100                  75.5    2e-13   Gossypium raimondii
gb|KJB30852.1|  hypothetical protein B456_005G164100                  75.5    7e-13   Gossypium raimondii
ref|XP_006437983.1|  hypothetical protein CICLE_v10031707mg           73.9    2e-12   
gb|KDO81827.1|  hypothetical protein CISIN_1g015546mg                 73.9    2e-12   Citrus sinensis [apfelsine]
emb|CAN72196.1|  hypothetical protein VITISV_014980                   73.6    4e-12   Vitis vinifera
ref|XP_009591285.1|  PREDICTED: uncharacterized protein LOC104088330  72.4    6e-12   Nicotiana tomentosiformis
gb|KJB60935.1|  hypothetical protein B456_009G332000                  72.4    7e-12   Gossypium raimondii
ref|XP_010027268.1|  PREDICTED: uncharacterized protein LOC104417743  72.0    1e-11   
ref|XP_008222202.1|  PREDICTED: uncharacterized protein LOC103322...  70.9    2e-11   Prunus mume [ume]
ref|XP_008222201.1|  PREDICTED: uncharacterized protein LOC103322...  70.5    3e-11   Prunus mume [ume]
ref|XP_002299323.2|  hypothetical protein POPTR_0001s13570g           70.1    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_007043918.1|  Uncharacterized protein TCM_008615               69.3    1e-10   
ref|XP_011036107.1|  PREDICTED: uncharacterized protein LOC105133719  68.9    1e-10   Populus euphratica
gb|KDP26836.1|  hypothetical protein JCGZ_17994                       63.9    6e-09   Jatropha curcas
gb|KJB30853.1|  hypothetical protein B456_005G164100                  63.2    8e-09   Gossypium raimondii
ref|XP_009771615.1|  PREDICTED: uncharacterized protein LOC104222123  62.8    1e-08   Nicotiana sylvestris
ref|XP_008389910.1|  PREDICTED: uncharacterized protein LOC103452...  62.4    2e-08   Malus domestica [apple tree]
ref|XP_008389909.1|  PREDICTED: uncharacterized protein LOC103452...  62.4    2e-08   
ref|XP_009343132.1|  PREDICTED: uncharacterized protein LOC103935107  62.0    2e-08   
ref|XP_008389907.1|  PREDICTED: uncharacterized protein LOC103452...  62.0    2e-08   
ref|XP_008389908.1|  PREDICTED: uncharacterized protein LOC103452...  62.0    2e-08   Malus domestica [apple tree]
ref|XP_004310225.1|  PREDICTED: uncharacterized protein LOC101307...  61.2    4e-08   Fragaria vesca subsp. vesca
ref|XP_011457500.1|  PREDICTED: uncharacterized protein LOC101307...  60.8    5e-08   Fragaria vesca subsp. vesca
emb|CDP13369.1|  unnamed protein product                              60.8    6e-08   Coffea canephora [robusta coffee]
ref|XP_004239242.1|  PREDICTED: uncharacterized protein LOC101252392  60.1    1e-07   Solanum lycopersicum
gb|KCW61917.1|  hypothetical protein EUGRSUZ_H04615                   60.1    1e-07   Eucalyptus grandis [rose gum]
ref|XP_008340399.1|  PREDICTED: uncharacterized protein LOC103403371  59.3    2e-07   
ref|XP_007223089.1|  hypothetical protein PRUPE_ppa007017mg           58.5    3e-07   
ref|XP_010090655.1|  hypothetical protein L484_017461                 56.6    2e-06   
ref|XP_009372251.1|  PREDICTED: uncharacterized protein LOC103961...  56.2    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_011086830.1|  PREDICTED: uncharacterized protein LOC105168442  55.8    3e-06   Sesamum indicum [beniseed]
ref|XP_006385888.1|  hypothetical protein POPTR_0003s16715g           52.0    6e-06   
ref|XP_010682717.1|  PREDICTED: uncharacterized protein LOC104897530  52.4    4e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011020800.1|  PREDICTED: uncharacterized protein LOC105123041  52.4    4e-05   Populus euphratica
ref|XP_010249079.1|  PREDICTED: uncharacterized protein LOC104591...  52.0    5e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010249078.1|  PREDICTED: uncharacterized protein LOC104591...  52.0    6e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010044846.1|  PREDICTED: uncharacterized protein LOC104433701  51.2    1e-04   Eucalyptus grandis [rose gum]
ref|XP_006470092.1|  PREDICTED: uncharacterized protein LOC102616547  47.8    2e-04   
ref|XP_008808109.1|  PREDICTED: uncharacterized protein LOC103720272  50.1    2e-04   Phoenix dactylifera
ref|XP_010913028.1|  PREDICTED: uncharacterized protein LOC105038820  49.7    3e-04   Elaeis guineensis
ref|XP_008459858.1|  PREDICTED: uncharacterized protein LOC103498856  49.7    4e-04   Cucumis melo [Oriental melon]
ref|XP_006589802.1|  PREDICTED: uncharacterized protein LOC102661485  49.3    4e-04   Glycine max [soybeans]
ref|XP_010543088.1|  PREDICTED: uncharacterized protein LOC104816114  48.9    6e-04   Tarenaya hassleriana [spider flower]
ref|XP_008805338.1|  PREDICTED: uncharacterized protein LOC103718341  48.5    8e-04   Phoenix dactylifera



>ref|XP_010656172.1| PREDICTED: uncharacterized protein LOC100266157 isoform X1 [Vitis 
vinifera]
 emb|CBI27683.3| unnamed protein product [Vitis vinifera]
Length=381

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            EI+N + YDG  N G      E++ + P++ +SKESIRR KSQSN  QFT+   D NGNR
Sbjct  307  EIKNGIFYDGGCNNGDRMLPDEDIMIFPQRTLSKESIRRYKSQSNPPQFTLCGNDSNGNR  366

Query  348  ECWIKSDADYLVLEL  304
            E WIK+DADYLVLEL
Sbjct  367  EYWIKTDADYLVLEL  381



>ref|XP_010656174.1| PREDICTED: uncharacterized protein LOC100266157 isoform X2 [Vitis 
vinifera]
Length=381

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            EI+N + YDG  N G      E++ + P++ +SKESIRR KSQSN  QFT+   D NGNR
Sbjct  307  EIKNGIFYDGGCNNGDRMLPDEDIMIFPQRTLSKESIRRYKSQSNPPQFTLCGNDSNGNR  366

Query  348  ECWIKSDADYLVLEL  304
            E WIK+DADYLVLEL
Sbjct  367  EYWIKTDADYLVLEL  381



>ref|XP_002514886.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47440.1| conserved hypothetical protein [Ricinus communis]
Length=388

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -2

Query  465  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            E + ++P++ +SK SIRR KSQSN  QFT+S  + NG+RECWIK+DADYLVLEL
Sbjct  335  EEITVLPQRALSKRSIRRYKSQSNPPQFTLSSSESNGSRECWIKTDADYLVLEL  388



>ref|XP_010250652.1| PREDICTED: uncharacterized protein LOC104592840 [Nelumbo nucifera]
Length=383

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            EI++N + DG  N G      E + + P++ +SKE IRR KSQSN  QF +S  D NGNR
Sbjct  309  EIKSNGLNDGGCNNGDHTLPDEYIMIFPQRTISKERIRRYKSQSNPPQFALSGSDSNGNR  368

Query  348  ECWIKSDADYLVLEL  304
            E WIK+DADYLVLEL
Sbjct  369  EYWIKTDADYLVLEL  383



>gb|KJB30854.1| hypothetical protein B456_005G164100 [Gossypium raimondii]
Length=313

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 5/75 (7%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            E + N+ YDG +  GG     +++ + P++ +SK+ +RR KSQS   QFT++  D NGNR
Sbjct  240  ENKENIFYDGGHEDGGHMLTDDDIMIFPQRALSKK-MRRYKSQSIPPQFTLNCNDSNGNR  298

Query  348  ECWIKSDADYLVLEL  304
            ECWIK+DADYLVLEL
Sbjct  299  ECWIKTDADYLVLEL  313



>gb|KJB30852.1| hypothetical protein B456_005G164100 [Gossypium raimondii]
Length=398

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 5/75 (7%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            E + N+ YDG +  GG     +++ + P++ +SK+ +RR KSQS   QFT++  D NGNR
Sbjct  325  ENKENIFYDGGHEDGGHMLTDDDIMIFPQRALSKK-MRRYKSQSIPPQFTLNCNDSNGNR  383

Query  348  ECWIKSDADYLVLEL  304
            ECWIK+DADYLVLEL
Sbjct  384  ECWIKTDADYLVLEL  398



>ref|XP_006437983.1| hypothetical protein CICLE_v10031707mg [Citrus clementina]
 ref|XP_006484156.1| PREDICTED: uncharacterized protein LOC102622478 [Citrus sinensis]
 gb|ESR51223.1| hypothetical protein CICLE_v10031707mg [Citrus clementina]
Length=405

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  447  PKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            P+  +SKE IRR KSQSN  QFTIS  D NGNRE WIK+DADYLVLEL
Sbjct  358  PQTNLSKEKIRRYKSQSNPPQFTISGSDSNGNREFWIKTDADYLVLEL  405



>gb|KDO81827.1| hypothetical protein CISIN_1g015546mg [Citrus sinensis]
Length=405

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  447  PKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            P+  +SKE IRR KSQSN  QFTIS  D NGNRE WIK+DADYLVLEL
Sbjct  358  PQTNLSKEKIRRYKSQSNPPQFTISGSDSNGNREFWIKTDADYLVLEL  405



>emb|CAN72196.1| hypothetical protein VITISV_014980 [Vitis vinifera]
Length=458

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            EI+N + YDG  N G      E++ + P++ +SKESIRR KSQSN  QFT+   D NGNR
Sbjct  373  EIKNGIFYDGGCNNGDRMLPDEDIMIFPQRTLSKESIRRYKSQSNPPQFTLCGNDSNGNR  432

Query  348  ECWIKSDAD  322
            E WIK+DAD
Sbjct  433  EYWIKTDAD  441



>ref|XP_009591285.1| PREDICTED: uncharacterized protein LOC104088330 [Nicotiana tomentosiformis]
Length=381

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 43/54 (80%), Gaps = 4/54 (7%)
 Frame = -2

Query  465  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            E++ ++P  R+SK+SI   K QSNM QFT+ D D NGNRECWIK+DA+YLVLEL
Sbjct  332  EDITIIPHHRLSKDSI---KGQSNMQQFTL-DGDSNGNRECWIKTDAEYLVLEL  381



>gb|KJB60935.1| hypothetical protein B456_009G332000 [Gossypium raimondii]
Length=391

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (67%), Gaps = 5/75 (7%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            E +  + Y+G    GG     E++ + P++  SK+ +RR  SQ+N  QFT+S  D NGNR
Sbjct  318  ENKKGIGYNGGQENGGPILAEEDIVIFPQRAHSKD-MRRYNSQANPSQFTLSCNDSNGNR  376

Query  348  ECWIKSDADYLVLEL  304
            ECWIK+DADYLVLEL
Sbjct  377  ECWIKTDADYLVLEL  391



>ref|XP_010027268.1| PREDICTED: uncharacterized protein LOC104417743 [Eucalyptus grandis]
Length=395

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 4/75 (5%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            E++        +N+G      E++ ++P++ + KE IRRL+SQSN  +  ++  + NGNR
Sbjct  321  EVKKKATRGHGHNVGNQVLPEEDIVIVPEKILLKEKIRRLRSQSNRARILVTGDESNGNR  380

Query  348  ECWIKSDADYLVLEL  304
            ECWIK+DADYLVLEL
Sbjct  381  ECWIKTDADYLVLEL  395



>ref|XP_008222202.1| PREDICTED: uncharacterized protein LOC103322099 isoform X2 [Prunus 
mume]
Length=386

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 5/68 (7%)
 Frame = -2

Query  492  DGAYNLGGA----ENVALMPKQRMS-KESIRRLKSQSNMHQFTISDPDCNGNRECWIKSD  328
            DGAYN G      E++ L P++  S K+S+RR KSQSN  QF +S  D N NRE WIK+D
Sbjct  319  DGAYNSGDQVLPDEDIMLYPERGFSLKQSMRRYKSQSNPPQFALSSIDSNENREHWIKTD  378

Query  327  ADYLVLEL  304
            ADYLVLEL
Sbjct  379  ADYLVLEL  386



>ref|XP_008222201.1| PREDICTED: uncharacterized protein LOC103322099 isoform X1 [Prunus 
mume]
Length=394

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 5/68 (7%)
 Frame = -2

Query  492  DGAYNLGGA----ENVALMPKQRMS-KESIRRLKSQSNMHQFTISDPDCNGNRECWIKSD  328
            DGAYN G      E++ L P++  S K+S+RR KSQSN  QF +S  D N NRE WIK+D
Sbjct  327  DGAYNSGDQVLPDEDIMLYPERGFSLKQSMRRYKSQSNPPQFALSSIDSNENREHWIKTD  386

Query  327  ADYLVLEL  304
            ADYLVLEL
Sbjct  387  ADYLVLEL  394



>ref|XP_002299323.2| hypothetical protein POPTR_0001s13570g [Populus trichocarpa]
 gb|EEE84128.2| hypothetical protein POPTR_0001s13570g [Populus trichocarpa]
Length=390

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = -2

Query  465  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            E++ ++P+  +SK SIRR KSQSN   F  +  D NG+RECWIK+DADYLVLEL
Sbjct  338  EDITIVPRT-LSKRSIRRFKSQSNPPHFMFTGCDSNGSRECWIKTDADYLVLEL  390



>ref|XP_007043918.1| Uncharacterized protein TCM_008615 [Theobroma cacao]
 gb|EOX99749.1| Uncharacterized protein TCM_008615 [Theobroma cacao]
Length=499

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 5/69 (7%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            E +  ++YDG +  GG     E++ L P++ +SK ++RR KSQSN  QFTIS  D NGNR
Sbjct  384  ENKKGILYDGGHENGGHTLEDEDIMLFPQRALSK-NMRRYKSQSNPPQFTISCNDSNGNR  442

Query  348  ECWIKSDAD  322
            ECWIK+DAD
Sbjct  443  ECWIKTDAD  451



>ref|XP_011036107.1| PREDICTED: uncharacterized protein LOC105133719 [Populus euphratica]
Length=390

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = -2

Query  465  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            E++ ++P Q + K SIRR KSQSN   F  +  D NG+RECWIK+DADYLVLEL
Sbjct  338  EDITIVP-QTLPKMSIRRFKSQSNPPHFMFTGCDSNGSRECWIKTDADYLVLEL  390



>gb|KDP26836.1| hypothetical protein JCGZ_17994 [Jatropha curcas]
Length=390

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -2

Query  465  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            E + ++P + +SK SIRR KSQSN  QFT+S  D +G+RE WIK+DADYLVLEL
Sbjct  337  EEITIIPPKALSKRSIRRYKSQSNPPQFTLSSSDSSGSREYWIKTDADYLVLEL  390



>gb|KJB30853.1| hypothetical protein B456_005G164100 [Gossypium raimondii]
Length=313

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 47/69 (68%), Gaps = 5/69 (7%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            E + N+ YDG +  GG     +++ + P++ +SK+ +RR KSQS   QFT++  D NGNR
Sbjct  240  ENKENIFYDGGHEDGGHMLTDDDIMIFPQRALSKK-MRRYKSQSIPPQFTLNCNDSNGNR  298

Query  348  ECWIKSDAD  322
            ECWIK+DAD
Sbjct  299  ECWIKTDAD  307



>ref|XP_009771615.1| PREDICTED: uncharacterized protein LOC104222123 [Nicotiana sylvestris]
Length=381

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 41/54 (76%), Gaps = 4/54 (7%)
 Frame = -2

Query  465  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            E++ ++P  R+SK+SI   K QSNM Q T+ D + + NRECWIK+DADYLVLEL
Sbjct  332  EDITIIPHHRLSKDSI---KGQSNMQQCTL-DGELDENRECWIKTDADYLVLEL  381



>ref|XP_008389910.1| PREDICTED: uncharacterized protein LOC103452173 isoform X4 [Malus 
domestica]
Length=384

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGAEN-VALMPKQRMSK-ESIRRLKSQSNMHQFTISDPDCNGNREC  343
            + +     +G Y+ G  E+ + L P+Q  S   S+RR KSQSN  Q  +S  D N NRE 
Sbjct  312  QTKKKTSSEGTYSNGDQEDDIILYPQQGFSSNPSMRRYKSQSNPPQIALSGMDSNDNREH  371

Query  342  WIKSDADYLVLEL  304
            WIK+DADYLVLEL
Sbjct  372  WIKTDADYLVLEL  384



>ref|XP_008389909.1| PREDICTED: uncharacterized protein LOC103452173 isoform X3 [Malus 
domestica]
Length=387

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGAEN-VALMPKQRMSK-ESIRRLKSQSNMHQFTISDPDCNGNREC  343
            + +     +G Y+ G  E+ + L P+Q  S   S+RR KSQSN  Q  +S  D N NRE 
Sbjct  315  QTKKKTSSEGTYSNGDQEDDIILYPQQGFSSNPSMRRYKSQSNPPQIALSGMDSNDNREH  374

Query  342  WIKSDADYLVLEL  304
            WIK+DADYLVLEL
Sbjct  375  WIKTDADYLVLEL  387



>ref|XP_009343132.1| PREDICTED: uncharacterized protein LOC103935107 [Pyrus x bretschneideri]
Length=384

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 2/65 (3%)
 Frame = -2

Query  492  DGAYNLGGAEN-VALMPKQRMSK-ESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADY  319
            +G Y+ G  E+ + L P+Q  S   S+RR KSQSN  Q  +S  D N NRE WIK+DADY
Sbjct  320  EGTYSNGDQEDDIILYPQQGFSSNPSMRRYKSQSNPPQIALSGMDSNDNREQWIKTDADY  379

Query  318  LVLEL  304
            LVLEL
Sbjct  380  LVLEL  384



>ref|XP_008389907.1| PREDICTED: uncharacterized protein LOC103452173 isoform X1 [Malus 
domestica]
Length=395

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGAEN-VALMPKQRMSK-ESIRRLKSQSNMHQFTISDPDCNGNREC  343
            + +     +G Y+ G  E+ + L P+Q  S   S+RR KSQSN  Q  +S  D N NRE 
Sbjct  323  QTKKKTSSEGTYSNGDQEDDIILYPQQGFSSNPSMRRYKSQSNPPQIALSGMDSNDNREH  382

Query  342  WIKSDADYLVLEL  304
            WIK+DADYLVLEL
Sbjct  383  WIKTDADYLVLEL  395



>ref|XP_008389908.1| PREDICTED: uncharacterized protein LOC103452173 isoform X2 [Malus 
domestica]
Length=392

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGGAEN-VALMPKQRMSK-ESIRRLKSQSNMHQFTISDPDCNGNREC  343
            + +     +G Y+ G  E+ + L P+Q  S   S+RR KSQSN  Q  +S  D N NRE 
Sbjct  320  QTKKKTSSEGTYSNGDQEDDIILYPQQGFSSNPSMRRYKSQSNPPQIALSGMDSNDNREH  379

Query  342  WIKSDADYLVLEL  304
            WIK+DADYLVLEL
Sbjct  380  WIKTDADYLVLEL  392



>ref|XP_004310225.1| PREDICTED: uncharacterized protein LOC101307273 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=389

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  465  ENVALMPKQRMSKESI-RRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            +++ L P+Q  S   I RR KSQSN  QF +   D NGN+E WIK+DADYLVLEL
Sbjct  335  QDIMLYPEQVSSSNQIMRRYKSQSNPPQFALGALDSNGNKEHWIKTDADYLVLEL  389



>ref|XP_011457500.1| PREDICTED: uncharacterized protein LOC101307273 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=397

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (2%)
 Frame = -2

Query  465  ENVALMPKQRMSKESI-RRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            +++ L P+Q  S   I RR KSQSN  QF +   D NGN+E WIK+DADYLVLEL
Sbjct  343  QDIMLYPEQVSSSNQIMRRYKSQSNPPQFALGALDSNGNKEHWIKTDADYLVLEL  397



>emb|CDP13369.1| unnamed protein product [Coffea canephora]
Length=412

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 4/73 (5%)
 Frame = -2

Query  510  RNNLMYDGAYNLGGAEN----VALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNREC  343
            R+   Y   Y +GG E+    + + P Q +SKE +RR KSQSN  Q +++  +  G  E 
Sbjct  340  RSGGSYKRPYIIGGPEDTDEDIIITPYQPLSKERLRRFKSQSNPPQLSLNGGNPLGTGEH  399

Query  342  WIKSDADYLVLEL  304
            WIK+D+DYLVLEL
Sbjct  400  WIKTDSDYLVLEL  412



>ref|XP_004239242.1| PREDICTED: uncharacterized protein LOC101252392 [Solanum lycopersicum]
Length=380

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 8/65 (12%)
 Frame = -2

Query  486  AYNLGGA----ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADY  319
            A++ GG     +++ ++P  R+SK+SI   K Q  M Q T+ D D N NRECWIK+DADY
Sbjct  320  AHDRGGLSLARDDITIIPHHRLSKDSI---KGQPIMQQSTV-DGDSNENRECWIKTDADY  375

Query  318  LVLEL  304
             VLEL
Sbjct  376  FVLEL  380



>gb|KCW61917.1| hypothetical protein EUGRSUZ_H04615, partial [Eucalyptus grandis]
Length=380

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 4/69 (6%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLGG----AENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNR  349
            E++        +N+G      E++ ++P++ + KE IRRL+SQSN  +  ++  + NGNR
Sbjct  312  EVKKKATRGHGHNVGNQVLPEEDIVIVPEKILLKEKIRRLRSQSNRARILVTGDESNGNR  371

Query  348  ECWIKSDAD  322
            ECWIK+DAD
Sbjct  372  ECWIKTDAD  380



>ref|XP_008340399.1| PREDICTED: uncharacterized protein LOC103403371 [Malus domestica]
Length=436

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 2/65 (3%)
 Frame = -2

Query  492  DGAYNLGGA-ENVALMPKQRMSK-ESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADY  319
            +G YN GG  E++ L P+Q  S  +S+   KSQSN  QF +S  D   NRE WIK+ ADY
Sbjct  372  EGTYNNGGQDEDILLYPQQGFSSMQSMWHYKSQSNPLQFVLSGMDSXENREHWIKTGADY  431

Query  318  LVLEL  304
            LVLEL
Sbjct  432  LVLEL  436



>ref|XP_007223089.1| hypothetical protein PRUPE_ppa007017mg [Prunus persica]
 gb|EMJ24288.1| hypothetical protein PRUPE_ppa007017mg [Prunus persica]
Length=386

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 5/62 (8%)
 Frame = -2

Query  492  DGAYNLGGA----ENVALMPKQRMS-KESIRRLKSQSNMHQFTISDPDCNGNRECWIKSD  328
            DGAYN G      E++ L P++  S K+S+RR KSQSN  QF +S  D N NRE WIK+D
Sbjct  319  DGAYNSGDQVLPDEDIMLYPERGFSLKQSMRRYKSQSNPPQFALSSIDSNENREHWIKTD  378

Query  327  AD  322
            AD
Sbjct  379  AD  380



>ref|XP_010090655.1| hypothetical protein L484_017461 [Morus notabilis]
 gb|EXB40319.1| hypothetical protein L484_017461 [Morus notabilis]
Length=445

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 6/64 (9%)
 Frame = -2

Query  495  YDGAYNLGGA-----ENVALMPKQRMS-KESIRRLKSQSNMHQFTISDPDCNGNRECWIK  334
            Y GA N GG      E++ L P++ +  K+ IRR +SQSN  QFT    D NGNRE WIK
Sbjct  379  YGGAGNNGGQVHPDHEDIILCPQRALFLKQKIRRYRSQSNPPQFTFGSIDSNGNREQWIK  438

Query  333  SDAD  322
            +DAD
Sbjct  439  TDAD  442



>ref|XP_009372251.1| PREDICTED: uncharacterized protein LOC103961434 isoform X1 [Pyrus 
x bretschneideri]
Length=418

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (65%), Gaps = 2/65 (3%)
 Frame = -2

Query  492  DGAYNLGGA-ENVALMPKQRMSK-ESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADY  319
            +G YN G   E++ L P+Q  S  +S+R  KSQSN  QF +S  + N NR  WIK+ ADY
Sbjct  354  EGTYNNGDQDEDILLYPQQGFSSNQSMRLYKSQSNPPQFVLSGMNSNENRGHWIKTGADY  413

Query  318  LVLEL  304
            L+LEL
Sbjct  414  LILEL  418



>ref|XP_011086830.1| PREDICTED: uncharacterized protein LOC105168442 [Sesamum indicum]
Length=388

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = -2

Query  516  EIRNNLMYDGAYNLG---GAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRE  346
            EI  N     + ++G    AE++ + P+Q +SKE+    K+QS++ Q T S  D  GN E
Sbjct  316  EINYNTQLTASNSVGLRPSAEDIIIYPQQAISKENTWSHKNQSHLPQLTKSSSDIAGN-E  374

Query  345  CWIKSDADYLVLEL  304
             W+K+DADYLVLEL
Sbjct  375  FWVKTDADYLVLEL  388



>ref|XP_006385888.1| hypothetical protein POPTR_0003s16715g [Populus trichocarpa]
 gb|ERP63685.1| hypothetical protein POPTR_0003s16715g [Populus trichocarpa]
Length=91

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -2

Query  465  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            E++ ++P+    + + RR KSQSN   FT +  + N +RECWIK+DADYLVLEL
Sbjct  39   EDITIVPRTLSRRST-RRFKSQSNPPHFTFTGCESNESRECWIKTDADYLVLEL  91



>ref|XP_010682717.1| PREDICTED: uncharacterized protein LOC104897530 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  408  KSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            KS SN  QF+    D NG+RECWIK+DADYLVLEL
Sbjct  342  KSISNPTQFSEDGSDSNGSRECWIKTDADYLVLEL  376



>ref|XP_011020800.1| PREDICTED: uncharacterized protein LOC105123041 [Populus euphratica]
Length=384

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 1/54 (2%)
 Frame = -2

Query  465  ENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            E++ ++P+    + + RR KSQSN   FT +  + N +RECWIK+DADYLVLEL
Sbjct  332  EDITIVPRTLSRRST-RRFKSQSNPPHFTFTGCESNESRECWIKTDADYLVLEL  384



>ref|XP_010249079.1| PREDICTED: uncharacterized protein LOC104591766 isoform X2 [Nelumbo 
nucifera]
Length=388

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = -2

Query  465  ENVALMPKQRMSKES-IRRLKSQSNMH-QFTISDPDCNGNRECWIKSDADYLVLEL  304
            E++ + P+  +SKE  +R  +S SN   Q  +   D NGNRE WIK+DADYLVLEL
Sbjct  333  EDIMIFPQSAISKEGFLRHCESPSNPPPQLPLGGRDSNGNREYWIKTDADYLVLEL  388



>ref|XP_010249078.1| PREDICTED: uncharacterized protein LOC104591766 isoform X1 [Nelumbo 
nucifera]
Length=396

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = -2

Query  465  ENVALMPKQRMSKES-IRRLKSQSNMH-QFTISDPDCNGNRECWIKSDADYLVLEL  304
            E++ + P+  +SKE  +R  +S SN   Q  +   D NGNRE WIK+DADYLVLEL
Sbjct  341  EDIMIFPQSAISKEGFLRHCESPSNPPPQLPLGGRDSNGNREYWIKTDADYLVLEL  396



>ref|XP_010044846.1| PREDICTED: uncharacterized protein LOC104433701 [Eucalyptus grandis]
Length=367

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = -2

Query  387  QFTISDPDCNGNRECWIKSDADYLVLEL  304
            QF ++  + NGNRECWIK+DADYLVLEL
Sbjct  340  QFKLAGSESNGNRECWIKTDADYLVLEL  367



>ref|XP_006470092.1| PREDICTED: uncharacterized protein LOC102616547 [Citrus sinensis]
Length=98

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = -2

Query  495  YDGAYNLGGAENV-ALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADY  319
            Y+G +  GG +N     P    SK+ I   K +  + Q+ +     +GNRE WIK+DADY
Sbjct  34   YEGVHTDGGLDNDNKSSPPGCESKDQIEYHKIEKMLSQYGLRGSTSSGNREHWIKTDADY  93

Query  318  LVLEL  304
            LVLEL
Sbjct  94   LVLEL  98



>ref|XP_008808109.1| PREDICTED: uncharacterized protein LOC103720272 [Phoenix dactylifera]
Length=380

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -2

Query  444  KQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            K    KE+I   K   N     +S  D NGNRE WIK+DADYLVLEL
Sbjct  334  KSTCRKEAIPNFKFCPNASSLALSGSDSNGNREHWIKTDADYLVLEL  380



>ref|XP_010913028.1| PREDICTED: uncharacterized protein LOC105038820 [Elaeis guineensis]
Length=377

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 37/70 (53%), Gaps = 2/70 (3%)
 Frame = -2

Query  507  NNLMYDGAYN-LGGAENVALMP-KQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIK  334
            ++ M+ G  N   G    A+   K    KE I + K  SN     +   D NGNRE WIK
Sbjct  308  SDCMHRGGGNDFNGTRGAAMTAAKGACRKEGIPKSKFCSNSSSLVLCGSDSNGNREHWIK  367

Query  333  SDADYLVLEL  304
            +DADYLVLEL
Sbjct  368  TDADYLVLEL  377



>ref|XP_008459858.1| PREDICTED: uncharacterized protein LOC103498856 [Cucumis melo]
Length=385

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = -2

Query  504  NLMYDGAYNLG---GAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIK  334
            N  +DG  N G     E++ + P++  SK S +R+K+Q   H + ++  D N N+E WI 
Sbjct  317  NHNHDGCCNNGEQTSDEDIMIYPQRTQSKPSFQRVKNQFPPH-YGLNSSDPNDNKERWIN  375

Query  333  SDADYLVLEL  304
            SD DYLVLEL
Sbjct  376  SDEDYLVLEL  385



>ref|XP_006589802.1| PREDICTED: uncharacterized protein LOC102661485 [Glycine max]
Length=355

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 42/63 (67%), Gaps = 4/63 (6%)
 Frame = -2

Query  480  NLGGAENVALMPKQR--MSKES-IRRLKSQSNMHQFTIS-DPDCNGNRECWIKSDADYLV  313
            N G  E++ ++  +R  +SKE+  R+ K Q N  QFT+  + D + N+E WIK+DADYLV
Sbjct  293  NEGSEEDILMIQPKRAELSKENYTRQYKIQPNPFQFTLGCEEDSSENKEHWIKTDADYLV  352

Query  312  LEL  304
            LEL
Sbjct  353  LEL  355



>ref|XP_010543088.1| PREDICTED: uncharacterized protein LOC104816114 [Tarenaya hassleriana]
 ref|XP_010523253.1| PREDICTED: uncharacterized protein LOC104801635 [Tarenaya hassleriana]
 ref|XP_010523256.1| PREDICTED: uncharacterized protein LOC104801639 [Tarenaya hassleriana]
 ref|XP_010527358.1| PREDICTED: uncharacterized protein LOC104804714 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527359.1| PREDICTED: uncharacterized protein LOC104804714 isoform X2 [Tarenaya 
hassleriana]
Length=393

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 27/35 (77%), Gaps = 2/35 (6%)
 Frame = -2

Query  408  KSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            KSQ N  QFT+   D NGNRE WIKSDADYLVLEL
Sbjct  361  KSQFNT-QFTLKS-DSNGNREFWIKSDADYLVLEL  393



>ref|XP_008805338.1| PREDICTED: uncharacterized protein LOC103718341 [Phoenix dactylifera]
Length=375

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 31/60 (52%), Gaps = 2/60 (3%)
 Frame = -2

Query  483  YNLGGAENVALMPKQRMSKESIRRLKSQSNMHQFTISDPDCNGNRECWIKSDADYLVLEL  304
            +  GGA   A   K    KE     KS SN     IS    N NRE WIK+DADYLVLEL
Sbjct  318  HGCGGAAIAA--SKSICRKEGTPNFKSCSNAPPLAISGSGSNANREHWIKTDADYLVLEL  375



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325