BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN046F23

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP19007.1|  unnamed protein product                                346   3e-117   Coffea canephora [robusta coffee]
ref|XP_002321186.1|  chlorophyll a/b-binding family protein             344   2e-116   Populus trichocarpa [western balsam poplar]
ref|XP_009365212.1|  PREDICTED: chlorophyll a-b binding protein 1...    344   4e-116   Pyrus x bretschneideri [bai li]
ref|XP_002301582.1|  chlorophyll a/b-binding family protein             342   1e-115   Populus trichocarpa [western balsam poplar]
gb|ABK96530.1|  unknown                                                 342   1e-115   Populus trichocarpa x Populus deltoides
ref|XP_011005408.1|  PREDICTED: chlorophyll a-b binding protein 1...    342   1e-115   Populus euphratica
ref|XP_004144543.1|  PREDICTED: chlorophyll a-b binding protein 1...    341   2e-115   Cucumis sativus [cucumbers]
gb|AFO67217.1|  putative chlorophyll a/b binding protein                341   2e-115   Aralia elata
gb|ACX54226.1|  chlorophyll A/B binding protein                         340   3e-115   Jatropha curcas
gb|KDP29912.1|  hypothetical protein JCGZ_18481                         340   3e-115   Jatropha curcas
ref|XP_011039316.1|  PREDICTED: chlorophyll a-b binding protein 5...    340   4e-115   Populus euphratica
ref|XP_008462084.1|  PREDICTED: chlorophyll a-b binding protein 1...    340   6e-115   Cucumis melo [Oriental melon]
ref|XP_002531690.1|  chlorophyll A/B binding protein, putative          340   7e-115   Ricinus communis
dbj|BAE46383.1|  chlorophyll a/b binding protein                        339   1e-114   Panax ginseng [Asiatic ginseng]
gb|EYU42755.1|  hypothetical protein MIMGU_mgv1a011961mg                339   1e-114   Erythranthe guttata [common monkey flower]
sp|P12062.1|CB26_PETSP  RecName: Full=Chlorophyll a-b binding pro...    338   2e-114   Petunia sp.
gb|AFJ25031.1|  chlorophyll a/b binding protein                         338   3e-114   Lonicera japonica [Japanese honeysuckle]
ref|XP_008379987.1|  PREDICTED: chlorophyll a-b binding protein 1...    338   3e-114   
ref|XP_010270182.1|  PREDICTED: chlorophyll a-b binding protein 1...    338   4e-114   Nelumbo nucifera [Indian lotus]
ref|XP_010112785.1|  Chlorophyll a-b binding protein 151                337   5e-114   Morus notabilis
ref|XP_007215825.1|  hypothetical protein PRUPE_ppa010078mg             337   5e-114   Prunus persica
gb|AEY78525.1|  chlorophyll a/b-binding protein                         337   8e-114   Tagetes erecta [big marigold]
ref|XP_009630805.1|  PREDICTED: chlorophyll a-b binding protein 3...    337   8e-114   Nicotiana tomentosiformis
ref|XP_010252708.1|  PREDICTED: chlorophyll a-b binding protein 1...    337   1e-113   Nelumbo nucifera [Indian lotus]
ref|XP_009343482.1|  PREDICTED: chlorophyll a-b binding protein 1...    336   1e-113   
ref|XP_011100602.1|  PREDICTED: chlorophyll a-b binding protein 5...    336   1e-113   Sesamum indicum [beniseed]
ref|XP_008342193.1|  PREDICTED: chlorophyll a-b binding protein 1...    336   2e-113   Malus domestica [apple tree]
ref|XP_010467054.1|  PREDICTED: chlorophyll a-b binding protein 1...    336   2e-113   Camelina sativa [gold-of-pleasure]
ref|NP_001234739.1|  chlorophyll a-b binding protein 4, chloropla...    336   2e-113   Solanum lycopersicum
emb|CDY15050.1|  BnaC03g44110D                                          336   2e-113   Brassica napus [oilseed rape]
gb|AHC95482.1|  chlorophyll A/B binding protein                         336   2e-113   Ziziphus jujuba [Chinese jujube]
gb|KDO58421.1|  hypothetical protein CISIN_1g024579mg                   336   2e-113   Citrus sinensis [apfelsine]
ref|XP_006296728.1|  hypothetical protein CARUB_v10014404mg             336   2e-113   Capsella rubella
ref|XP_009802594.1|  PREDICTED: chlorophyll a-b binding protein 3...    336   3e-113   Nicotiana sylvestris
ref|XP_008229895.1|  PREDICTED: chlorophyll a-b binding protein 1...    335   3e-113   Prunus mume [ume]
ref|XP_009626274.1|  PREDICTED: chlorophyll a-b binding protein 3...    335   5e-113   Nicotiana tomentosiformis
sp|P27494.1|CB23_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    335   5e-113   Nicotiana tabacum [American tobacco]
ref|XP_004293460.1|  PREDICTED: chlorophyll a-b binding protein 1...    335   7e-113   Fragaria vesca subsp. vesca
ref|XP_004251540.1|  PREDICTED: chlorophyll a-b binding protein 5...    335   7e-113   
ref|XP_002271687.1|  PREDICTED: chlorophyll a-b binding protein 1...    335   7e-113   Vitis vinifera
ref|XP_006447758.1|  hypothetical protein CICLE_v10016280mg             335   8e-113   Citrus clementina [clementine]
gb|AAC34983.1|  light harvesting chlorophyll A/B binding protein        334   8e-113   Prunus persica
ref|XP_006352013.1|  PREDICTED: chlorophyll a-b binding protein 3...    334   8e-113   Solanum tuberosum [potatoes]
ref|XP_002885789.1|  Lhcb2 protein                                      334   1e-112   Arabidopsis lyrata subsp. lyrata
ref|XP_009136161.1|  PREDICTED: chlorophyll a-b binding protein 1...    334   1e-112   Brassica rapa
ref|NP_178585.1|  photosystem II light harvesting complex protein...    334   1e-112   Arabidopsis thaliana [mouse-ear cress]
gb|AAL29886.1|M97171_1  chlorophyll a/b binding protein type II         334   1e-112   Glycine max [soybeans]
gb|AAD28771.1|AF134124_1  Lhcb2 protein                                 334   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010412501.1|  PREDICTED: chlorophyll a-b binding protein 1...    334   1e-112   Camelina sativa [gold-of-pleasure]
emb|CAA84525.1|  chlorophyll a,b binding protein type I                 334   2e-112   Solanum tuberosum [potatoes]
ref|XP_006363015.1|  PREDICTED: chlorophyll a-b binding protein 4...    333   3e-112   Solanum tuberosum [potatoes]
gb|AFK45300.1|  unknown                                                 333   3e-112   Medicago truncatula
ref|XP_003617948.1|  Chlorophyll a/b binding protein                    333   4e-112   Medicago truncatula
emb|CAA52750.1|  chlorophyll a/b binding protein                        333   4e-112   Amaranthus hypochondriacus [prince's feather]
gb|AFK45982.1|  unknown                                                 332   5e-112   Lotus japonicus
gb|AAO62942.1|  chlorophyll a/b binding protein                         332   5e-112   Nicotiana tabacum [American tobacco]
gb|AAD28769.1|AF134122_1  Lhcb2 protein                                 332   6e-112   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240183.1|  uncharacterized protein LOC100793702               332   6e-112   Glycine max [soybeans]
ref|XP_009618965.1|  PREDICTED: chlorophyll a-b binding protein 3...    332   6e-112   Nicotiana tomentosiformis
gb|AAD48017.1|AF165529_1  chlorophyll a/b binding protein               332   6e-112   Rumex palustris
gb|AFW90566.1|  chlorophyll a/b-binding protein                         332   8e-112   Solanum tuberosum [potatoes]
gb|AEK26372.1|  chloroplast photosystem II chlorophyll a/b bindin...    332   1e-111   Sedum alfredii
ref|NP_178582.1|  photosystem II light harvesting complex protein...    332   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111582.1|  PREDICTED: chlorophyll a-b binding protein 3...    332   1e-111   Brassica rapa
gb|AII25433.1|  light-harvesting chlorophyll a/b binding protein        331   1e-111   Sedum alfredii
gb|KFK23428.1|  hypothetical protein AALP_AAs45999U001400               331   1e-111   Arabis alpina [alpine rockcress]
gb|ACJ84374.1|  unknown                                                 331   2e-111   Medicago truncatula
ref|XP_009792415.1|  PREDICTED: chlorophyll a-b binding protein 3...    330   3e-111   Nicotiana sylvestris
ref|XP_007142492.1|  hypothetical protein PHAVU_008G285100g             330   3e-111   Phaseolus vulgaris [French bean]
ref|NP_001241179.1|  uncharacterized protein LOC100815789               330   3e-111   Glycine max [soybeans]
ref|XP_010045878.1|  PREDICTED: chlorophyll a-b binding protein 3...    330   4e-111   Eucalyptus grandis [rose gum]
ref|XP_010502775.1|  PREDICTED: chlorophyll a-b binding protein 5...    330   4e-111   Camelina sativa [gold-of-pleasure]
ref|XP_007049308.1|  Photosystem II light harvesting complex gene...    330   4e-111   Theobroma cacao [chocolate]
gb|KJB06589.1|  hypothetical protein B456_001G192000                    330   5e-111   Gossypium raimondii
gb|KJB06801.1|  hypothetical protein B456_001G192300                    330   7e-111   Gossypium raimondii
ref|XP_004491575.1|  PREDICTED: chlorophyll a-b binding protein 2...    330   7e-111   Cicer arietinum [garbanzo]
ref|XP_010665939.1|  PREDICTED: chlorophyll a-b binding protein 5...    330   7e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006291684.1|  hypothetical protein CARUB_v10017845mg             330   7e-111   Capsella rubella
emb|CDX83726.1|  BnaC07g24660D                                          329   1e-110   
ref|XP_010514479.1|  PREDICTED: chlorophyll a-b binding protein 5...    329   1e-110   Camelina sativa [gold-of-pleasure]
ref|XP_006395408.1|  hypothetical protein EUTSA_v10004777mg             329   1e-110   Eutrema salsugineum [saltwater cress]
ref|XP_009151928.1|  PREDICTED: chlorophyll a-b binding protein 5...    329   1e-110   Brassica rapa
gb|AEO51757.1|  chloroplast chlorophyll A/B binding protein             328   1e-110   Dimocarpus longan [longan]
emb|CDY13732.1|  BnaA06g31910D                                          329   2e-110   Brassica napus [oilseed rape]
gb|KJB10748.1|  hypothetical protein B456_001G220900                    328   2e-110   Gossypium raimondii
gb|AAW31512.1|  light-harvesting chlorophyll-a/b binding protein ...    328   2e-110   Pisum sativum [garden pea]
ref|XP_009397219.1|  PREDICTED: chlorophyll a-b binding protein 1...    328   2e-110   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAF89205.1|AF279248_1  LHCII type II chlorophyll a/b-binding p...    328   3e-110   Vigna radiata [mung bean]
ref|XP_006291597.1|  hypothetical protein CARUB_v10017751mg             329   3e-110   Capsella rubella
gb|ABO20852.1|  chlorophyll a/b binding protein of LHCII type I         328   3e-110   Lilium longiflorum [Easter lily]
ref|XP_010557706.1|  PREDICTED: chlorophyll a-b binding protein 5...    328   3e-110   Tarenaya hassleriana [spider flower]
emb|CDY03989.1|  BnaC02g37040D                                          328   3e-110   
sp|P27518.2|CB21_GOSHI  RecName: Full=Chlorophyll a-b binding pro...    328   3e-110   Gossypium hirsutum [American cotton]
ref|XP_002875397.1|  LHCB2:4                                            328   3e-110   
emb|CDY00149.1|  BnaC09g01520D                                          327   5e-110   
sp|P27520.1|CB215_PEA  RecName: Full=Chlorophyll a-b binding prot...    327   6e-110   Pisum sativum [garden pea]
ref|NP_189406.1|  photosystem II light harvesting complex protein...    327   6e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33682.1|  hypothetical protein AALP_AA5G045900                    326   2e-109   Arabis alpina [alpine rockcress]
gb|KFK33681.1|  hypothetical protein AALP_AA5G045800                    326   2e-109   Arabis alpina [alpine rockcress]
ref|XP_008810536.1|  PREDICTED: chlorophyll a-b binding protein 5...    325   3e-109   
gb|ABD92879.1|  chloroplast chlorophyll a/b binding protein             325   3e-109   Pachysandra terminalis
gb|AGZ15385.1|  chlorophyll a/b-binding protein (LHCII type II)         323   8e-109   Phaseolus vulgaris [French bean]
sp|P12332.2|CB21_SILPR  RecName: Full=Chlorophyll a-b binding pro...    322   9e-109   
gb|KFK33683.1|  hypothetical protein AALP_AA5G046000                    324   1e-108   Arabis alpina [alpine rockcress]
ref|XP_002875398.1|  LHCB2:4                                            324   1e-108   Arabidopsis lyrata subsp. lyrata
sp|P12328.1|CB21_LEMGI  RecName: Full=Chlorophyll a-b binding pro...    323   1e-108   Lemna gibba
ref|XP_010908796.1|  PREDICTED: chlorophyll a-b binding protein 5...    322   6e-108   Elaeis guineensis
gb|AEZ49172.1|  chlorophyll a/b binding protein of LHCII type I         322   1e-107   Wolffia australiana
ref|XP_006836754.1|  hypothetical protein AMTR_s00088p00153020          321   2e-107   Amborella trichopoda
gb|ABK21429.1|  unknown                                                 316   2e-105   Picea sitchensis
gb|ABQ02464.1|  chloroplast chlorophyll a/b binding protein             316   2e-105   Phyllostachys edulis [kikko-chiku]
gb|AAC15992.1|  chlorophyll a/b binding protein                         315   5e-105   Oryza sativa Japonica Group [Japonica rice]
gb|ABK21859.1|  unknown                                                 314   9e-105   Picea sitchensis
ref|NP_001050586.1|  Os03g0592500                                       313   1e-104   
gb|ABK21323.1|  unknown                                                 314   1e-104   Picea sitchensis
ref|XP_006664981.1|  PREDICTED: chlorophyll a-b binding protein, ...    313   1e-104   Oryza brachyantha
dbj|BAA00537.1|  type II light-harvesting chlorophyll a/b-binding...    313   1e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010412415.1|  PREDICTED: chlorophyll a-b binding protein, ...    310   1e-104   Camelina sativa [gold-of-pleasure]
prf||1707316B  chlorophyll a/b binding protein 2                        313   2e-104   Oryza sativa [red rice]
gb|AFV34723.1|  light harvesting chlorophyll a/b-binding protein 2-1    313   2e-104   Dendrocalamus latiflorus [sweet bamboo]
gb|ABR17665.1|  unknown                                                 312   4e-104   Picea sitchensis
gb|ACO06085.1|  chlorophyll a-b binding protein                         309   6e-104   Triticum aestivum [Canadian hard winter wheat]
gb|ABK22382.1|  unknown                                                 311   9e-104   Picea sitchensis
gb|ACE88963.1|  chloroplast chlorophyll a/b binding protein             308   9e-104   Phyllostachys edulis [kikko-chiku]
gb|ABQ02463.1|  chloroplast chlorophyll a/b binding protein             311   2e-103   Phyllostachys edulis [kikko-chiku]
gb|EMS46868.1|  Chlorophyll a-b binding protein, chloroplastic          310   2e-103   Triticum urartu
gb|AEW70716.1|  light harvesting chlorophyll a-b binding protein 2-1    310   2e-103   Phyllostachys edulis [kikko-chiku]
ref|XP_003562323.1|  PREDICTED: chlorophyll a-b binding protein, ...    310   3e-103   Brachypodium distachyon [annual false brome]
emb|CAA43907.1|  chlorophyll a/b-binding protein                        310   5e-103   Pinus thunbergii [green pine]
gb|ACO06088.1|  chlorophyll a-b binding protein                         309   5e-103   Triticum aestivum [Canadian hard winter wheat]
gb|ABO10493.1|  light-harvesting chlorophyll a/b binding protein        309   8e-103   Bambusa oldhamii
gb|ABK21446.1|  unknown                                                 308   1e-102   Picea sitchensis
gb|ABR25974.1|  chloroplast chlorophyll a-b binding protein precu...    308   1e-102   Oryza sativa Indica Group [Indian rice]
gb|AAV74408.1|  chloroplast chlorophyll A/B binding protein             307   2e-102   Manihot esculenta [manioc]
ref|NP_001148271.1|  chlorophyll a-b binding protein                    307   3e-102   Zea mays [maize]
gb|ACG30954.1|  chlorophyll a-b binding protein                         307   4e-102   Zea mays [maize]
gb|AAB19040.1|  type 2 light-harvesting chlorophyll a/b-binding p...    306   8e-102   Pinus palustris [longleaf pine]
ref|XP_004982492.1|  PREDICTED: chlorophyll a-b binding protein, ...    306   1e-101   Setaria italica
gb|ABK22497.1|  unknown                                                 305   2e-101   Picea sitchensis
ref|XP_002466863.1|  hypothetical protein SORBIDRAFT_01g015400          305   4e-101   Sorghum bicolor [broomcorn]
sp|P10049.1|CB21_PINTH  RecName: Full=Chlorophyll a-b binding pro...    305   5e-101   Pinus thunbergii [green pine]
ref|WP_039311140.1|  hypothetical protein                               301   6e-101   
ref|XP_002986911.1|  light-harvesting complex                           302   4e-100   Selaginella moellendorffii
gb|AAB82142.1|  chlorophyll a-b binding protein                         299   5e-99    Oryza sativa Indica Group [Indian rice]
gb|KDO58422.1|  hypothetical protein CISIN_1g024579mg                   297   2e-98    Citrus sinensis [apfelsine]
gb|EMT32028.1|  Chlorophyll a-b binding protein, chloroplastic          296   3e-98    
sp|P14279.1|CB25_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    296   3e-98    Solanum lycopersicum
emb|CAA89823.1|  light-harvesting chlorophyll a/b binding protein...    296   5e-98    Pseudotsuga menziesii
ref|XP_001757271.1|  predicted protein                                  293   2e-96    
ref|XP_001755762.1|  predicted protein                                  285   2e-93    
ref|XP_001762089.1|  predicted protein                                  283   1e-92    
gb|AAA60965.1|  light-harvesting chlorophyll a/b binding protein ...    283   2e-92    Ginkgo biloba [ginkgo]
gb|ACI90635.1|  chloroplast light harvesting chlorophyll a/b bind...    281   5e-92    Pinus yunnanensis [Yunnan pine]
emb|CAA48641.1|  type II light-harvesting chlorophyll a /b-bindin...    280   1e-91    Zea mays [maize]
gb|ACI90632.1|  chloroplast light harvesting chlorophyll a/b bind...    280   2e-91    Pinus tabuliformis var. henryi
gb|ABK22798.1|  unknown                                                 279   3e-91    Picea sitchensis
emb|CAC38830.1|  chlorophyll a/b binding protein                        280   3e-91    Pinus contorta
gb|ACI90631.1|  chloroplast light harvesting chlorophyll a/b bind...    278   8e-91    Pinus bungeana [lacebark pine]
emb|CAA47950.1|  chlorophyll a/b binding protein                        278   1e-90    Pinus contorta
gb|ACY66805.1|  chlorophyll a/b-binding protein                         278   1e-90    Pinus massoniana [Chinese red pine]
gb|AHB24928.1|  chloroplast chlorophyll a-b binding protein 2/3         278   2e-90    Sedum alfredii
emb|CAA57408.1|  light harvesting chlorophyll a /b-binding protei...    278   2e-90    Picea abies
ref|XP_001774812.1|  predicted protein                                  278   2e-90    
emb|CAA57409.1|  light harvesting chlorophyll a /b-binding protei...    278   2e-90    Picea abies
gb|ABK20976.1|  unknown                                                 278   2e-90    Picea sitchensis
ref|XP_001761868.1|  predicted protein                                  277   3e-90    
ref|XP_001751426.1|  predicted protein                                  277   3e-90    
sp|P15194.1|CB2B_PINSY  RecName: Full=Chlorophyll a-b binding pro...    276   6e-90    Pinus sylvestris [Scotch pine]
ref|XP_001779318.1|  predicted protein                                  276   6e-90    
prf||1615137A  chlorophyll a/b binding protein P25                      275   7e-90    Pinus sylvestris [Scotch pine]
gb|AAA33636.1|  major chlorophyll binding protein                       276   1e-89    Physcomitrella patens
sp|P24006.1|CB2A_PYRPY  RecName: Full=Chlorophyll a-b binding pro...    276   1e-89    Pyrus pyrifolia [sha li]
gb|ACN40194.1|  unknown                                                 276   1e-89    Picea sitchensis
gb|AAC78690.1|  chlorophyll a/b-binding protein                         276   1e-89    Pinus thunbergii [green pine]
ref|XP_001774452.1|  predicted protein                                  276   1e-89    
sp|P15193.1|CB2A_PINSY  RecName: Full=Chlorophyll a-b binding pro...    276   1e-89    Pinus sylvestris [Scotch pine]
gb|AAU89261.1|  chloroplast light harvesting chlorophyll a/b bind...    275   2e-89    Pinus monophylla [singleleaf pinyon pine]
gb|ABK22510.1|  unknown                                                 275   3e-89    Picea sitchensis
ref|XP_002960494.1|  light-harvesting complex                           275   3e-89    Selaginella moellendorffii
ref|XP_001751359.1|  predicted protein                                  275   3e-89    
gb|AAU89257.1|  chloroplast light harvesting chlorophyll a/b bind...    274   3e-89    Pinus flexilis [limber pine]
gb|AAU89262.1|  chloroplast light harvesting chlorophyll a/b bind...    274   3e-89    Pinus remota
gb|AAU89264.1|  chloroplast light harvesting chlorophyll a/b bind...    273   5e-89    Pinus nelsonii
gb|AIW07979.1|  chloroplast light harvesting chlorophyll a/b bind...    273   6e-89    Pinus krempfii
gb|AAY81730.1|  chloroplast putative light harvesting chlorophyll...    273   6e-89    Pinus krempfii
gb|AAU89250.1|  chloroplast light harvesting chlorophyll a/b bind...    273   6e-89    Pinus echinata [shortleaf pine]
gb|AAU89254.1|  chloroplast light harvesting chlorophyll a/b bind...    273   7e-89    Pinus merkusii [Mindoro pine]
gb|AIW08054.1|  chloroplast light harvesting chlorophyll a/b bind...    273   7e-89    Pinus krempfii
ref|XP_002967230.1|  light-harvesting complex                           273   8e-89    
gb|AAU89255.1|  chloroplast light harvesting chlorophyll a/b bind...    273   8e-89    Pinus roxburghii [chir pine]
gb|AAU89251.1|  chloroplast light harvesting chlorophyll a/b bind...    273   8e-89    Pinus ponderosa [Pacific ponderosa pine]
gb|AAU89253.1|  chloroplast light harvesting chlorophyll a/b bind...    273   9e-89    Pinus contorta
gb|AAU89265.1|  chloroplast light harvesting chlorophyll a/b bind...    273   1e-88    Picea sitchensis
gb|AAY81729.1|  chloroplast putative light harvesting chlorophyll...    273   1e-88    Pinus gerardiana
gb|AAU89256.1|  chloroplast light harvesting chlorophyll a/b bind...    273   1e-88    Pinus chiapensis
gb|ABF97414.1|  Chlorophyll a-b binding protein, chloroplast prec...    271   2e-88    Oryza sativa Japonica Group [Japonica rice]
gb|AAU89252.1|  chloroplast light harvesting chlorophyll a/b bind...    271   5e-88    Pinus radiata
ref|XP_001751602.1|  predicted protein                                  271   5e-88    
gb|ACN40044.1|  unknown                                                 271   8e-88    Picea sitchensis
ref|XP_001754234.1|  predicted protein                                  271   9e-88    
dbj|BAJ87356.1|  predicted protein                                      269   1e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P12329.1|CB21_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    270   2e-87    Zea mays [maize]
ref|XP_011045092.1|  PREDICTED: chlorophyll a-b binding protein o...    270   2e-87    Populus euphratica
ref|XP_001754307.1|  predicted protein                                  270   2e-87    
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                  270   2e-87    Populus trichocarpa [western balsam poplar]
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                  270   2e-87    Populus trichocarpa [western balsam poplar]
ref|XP_011045093.1|  PREDICTED: chlorophyll a-b binding protein o...    270   2e-87    Populus euphratica
gb|AAA80591.1|  chlorophyll a/b binding protein                         270   2e-87    Solanum tuberosum [potatoes]
gb|ABK23816.1|  unknown                                                 266   3e-87    Picea sitchensis
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic       269   3e-87    Genlisea aurea
emb|CAA57407.1|  light harvesting chlorophyll a /b-binding protei...    270   4e-87    Picea abies
gb|ACN40027.1|  unknown                                                 269   6e-87    Picea sitchensis
gb|ABK26071.1|  unknown                                                 269   6e-87    Picea sitchensis
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...    268   6e-87    
ref|NP_001147639.1|  chlorophyll a-b binding protein 1, chloropla...    268   6e-87    
ref|XP_008229463.1|  PREDICTED: chlorophyll a-b binding protein, ...    267   7e-87    Prunus mume [ume]
gb|ABK22330.1|  unknown                                                 269   7e-87    Picea sitchensis
ref|XP_001765456.1|  predicted protein                                  268   7e-87    
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...    268   8e-87    Solanum tuberosum [potatoes]
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                  268   8e-87    Populus trichocarpa [western balsam poplar]
gb|ABK23849.1|  unknown                                                 269   8e-87    Picea sitchensis
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...    268   8e-87    Solanum tuberosum [potatoes]
ref|NP_565786.1|  photosystem II light harvesting complex protein...    268   8e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004957570.1|  PREDICTED: chlorophyll a-b binding protein 1...    268   1e-86    Setaria italica
ref|XP_002460622.1|  hypothetical protein SORBIDRAFT_02g032040          268   1e-86    Sorghum bicolor [broomcorn]
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...    268   1e-86    
ref|XP_004293579.1|  PREDICTED: chlorophyll a-b binding protein o...    268   1e-86    Fragaria vesca subsp. vesca
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein, ...    268   1e-86    Cucumis sativus [cucumbers]
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...    268   1e-86    
gb|AAU89263.1|  chloroplast light harvesting chlorophyll a/b bind...    267   2e-86    Pinus longaeva [western bristlecone pine]
gb|AAA80593.1|  chlorophyll a/b binding protein                         268   2e-86    Solanum tuberosum [potatoes]
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...    267   2e-86    Solanum tuberosum [potatoes]
ref|XP_006295385.1|  hypothetical protein CARUB_v10024479mg             267   2e-86    Capsella rubella
ref|XP_002515206.1|  chlorophyll A/B binding protein, putative          267   2e-86    Ricinus communis
gb|AAT08668.1|  chloroplast chlorophyll A-B binding protein 40          266   2e-86    Hyacinthus orientalis [common hyacinth]
ref|XP_010316912.1|  PREDICTED: chlorophyll a-b binding protein 1...    267   2e-86    
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...    267   2e-86    Prunus mume [ume]
ref|XP_010509756.1|  PREDICTED: chlorophyll a-b binding protein 1...    267   3e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...    267   3e-86    Eucalyptus grandis [rose gum]
prf||1204205B  protein 1B,chlorophyll binding                           267   3e-86    Solanum lycopersicum
ref|XP_006844081.1|  hypothetical protein AMTR_s00006p00251360          267   3e-86    Amborella trichopoda
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...    266   3e-86    
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg             266   4e-86    Prunus persica
ref|XP_008358195.1|  PREDICTED: chlorophyll a-b binding protein o...    266   4e-86    Malus domestica [apple tree]
gb|ABW70800.1|  chloroplast light harvesting chlorophyll a/b bind...    266   4e-86    Populus euphratica
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...    266   4e-86    
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...    266   4e-86    Prunus mume [ume]
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...    266   5e-86    Sedum alfredii
gb|AAA80594.1|  chlorophyll a/b binding protein                         266   5e-86    Solanum tuberosum [potatoes]
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...    266   5e-86    Populus euphratica
ref|XP_010504897.1|  PREDICTED: chlorophyll a-b binding protein 1...    266   6e-86    
ref|XP_001775090.1|  predicted protein                                  266   6e-86    
gb|ACL50948.1|  putative chloroplast chlorophyll a/b binding protein    265   7e-86    Solanum nigrum
gb|AFW90594.1|  chloroplast chlorophyll a/b binding protein             266   7e-86    Solanum tuberosum [potatoes]
ref|XP_004134603.1|  PREDICTED: chlorophyll a-b binding protein o...    266   8e-86    
ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...    266   8e-86    Cucumis melo [Oriental melon]
ref|XP_004170962.1|  PREDICTED: chlorophyll a-b binding protein o...    266   8e-86    
ref|XP_004134608.1|  PREDICTED: chlorophyll a-b binding protein o...    266   9e-86    
ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...    266   9e-86    Solanum tuberosum [potatoes]
gb|AAC25775.1|  chlorophyll a/b binding protein                         266   9e-86    Medicago sativa [alfalfa]
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein       265   1e-85    Nicotiana sylvestris
gb|AAA80592.1|  chlorophyll a/b binding protein                         265   1e-85    Solanum tuberosum [potatoes]
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...    265   1e-85    Pyrus x bretschneideri [bai li]
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg             265   1e-85    Prunus persica
ref|XP_006856963.1|  hypothetical protein AMTR_s00189p00032350          265   1e-85    Amborella trichopoda
ref|XP_004148579.1|  PREDICTED: chlorophyll a-b binding protein 3...    265   1e-85    Cucumis sativus [cucumbers]
sp|P92919.1|CB23_APIGR  RecName: Full=Chlorophyll a-b binding pro...    265   1e-85    Apium graveolens
ref|XP_009363087.1|  PREDICTED: chlorophyll a-b binding protein o...    265   1e-85    
ref|NP_001266111.1|  chlorophyll a-b binding protein AB80, chloro...    265   1e-85    Cicer arietinum [garbanzo]
gb|AFK40204.1|  unknown                                                 263   1e-85    Lotus japonicus
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...    265   2e-85    Nicotiana tomentosiformis
gb|AFK40061.1|  unknown                                                 265   2e-85    Medicago truncatula
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...    265   2e-85    Nicotiana sylvestris
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...    265   2e-85    Nicotiana tomentosiformis
sp|P27496.1|CB25_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    265   2e-85    Nicotiana tabacum [American tobacco]
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                     268   2e-85    Eucalyptus grandis [rose gum]
sp|P15195.1|CB23_POLMU  RecName: Full=Chlorophyll a-b binding pro...    265   2e-85    Polystichum munitum [common sword fern]
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...    265   2e-85    Fragaria vesca subsp. vesca
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...    265   2e-85    Nicotiana sylvestris
sp|P27490.1|CB28_PEA  RecName: Full=Chlorophyll a-b binding prote...    265   2e-85    
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...    265   2e-85    
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...    265   2e-85    
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...    265   2e-85    
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    264   2e-85    
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...    265   2e-85    
gb|AAW31511.1|  light-harvesting chlorophyll-a/b binding protein ...    265   2e-85    
gb|ABN49454.2|  chloroplast chlorophyll a/b binding protein             265   2e-85    
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...    265   2e-85    
gb|ACO06086.1|  chlorophyll a-b binding protein                         263   2e-85    
ref|XP_004302854.1|  PREDICTED: chlorophyll a-b binding protein o...    265   3e-85    
gb|ABQ32304.1|  chloroplast light-harvesting chlorophyll a/b-bind...    264   3e-85    
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein             264   3e-85    
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...    264   3e-85    
ref|XP_006840304.1|  hypothetical protein AMTR_s00045p00069900          264   3e-85    
ref|XP_010097596.1|  Chlorophyll a-b binding protein 40                 264   3e-85    
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...    264   3e-85    
gb|ACD64978.1|  chloroplast chlorophyll a/b-binding protein             264   3e-85    
sp|P07371.1|CB22_PEA  RecName: Full=Chlorophyll a-b binding prote...    264   3e-85    
gb|EYU28184.1|  hypothetical protein MIMGU_mgv1a011918mg                264   4e-85    
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...    264   4e-85    
ref|XP_007221496.1|  hypothetical protein PRUPE_ppa010066mg             264   4e-85    
gb|AAT08651.1|  chloroplast chlorophyll A-B binding protein             263   4e-85    
ref|XP_002283566.1|  PREDICTED: chlorophyll a-b binding protein o...    264   4e-85    
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...    264   4e-85    
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein 4...    264   5e-85    
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...    264   5e-85    
ref|XP_002273106.2|  PREDICTED: chlorophyll a-b binding protein o...    264   5e-85    
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...    264   5e-85    
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...    264   5e-85    
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...    264   5e-85    
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...    263   6e-85    
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                     265   6e-85    
ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...    264   6e-85    
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...    263   6e-85    
gb|KFK44818.1|  hypothetical protein AALP_AA1G306800                    263   6e-85    
gb|ABK26463.1|  unknown                                                 263   7e-85    
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...    263   7e-85    
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...    263   7e-85    
ref|XP_008343203.1|  PREDICTED: chlorophyll a-b binding protein o...    266   7e-85    
gb|EYU28183.1|  hypothetical protein MIMGU_mgv1a012019mg                263   7e-85    
gb|EYU28185.1|  hypothetical protein MIMGU_mgv1a012021mg                263   7e-85    
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...    263   7e-85    
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...    263   8e-85    
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...    263   8e-85    
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein    263   8e-85    
ref|XP_008447450.1|  PREDICTED: chlorophyll a-b binding protein o...    263   8e-85    
ref|XP_011460161.1|  PREDICTED: chlorophyll a-b binding protein o...    263   8e-85    
ref|XP_010549470.1|  PREDICTED: chlorophyll a-b binding protein 1...    263   8e-85    
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...    263   9e-85    
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...    263   9e-85    
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    263   1e-84    
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...    263   1e-84    
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...    263   1e-84    
gb|AAA34148.1|  chlorophyll a/b-binding protein Cab-3C                  263   1e-84    
gb|EYU19649.1|  hypothetical protein MIMGU_mgv1a011927mg                263   1e-84    
ref|XP_006449644.1|  hypothetical protein CICLE_v10016074mg             264   1e-84    
ref|XP_010460769.1|  PREDICTED: chlorophyll a-b binding protein 1...    263   1e-84    
gb|AHM26643.1|  a-b binding protein                                     263   1e-84    
gb|AAR10886.1|  chlorophyll a/b binding protein                         263   1e-84    
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...    263   1e-84    
gb|AIB04243.1|  chloroplast light harvesting chlorophyll a/b bind...    261   1e-84    
gb|AAB87573.1|  chlorophyll a/b binding protein of LHCII type I p...    263   1e-84    
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...    263   1e-84    
ref|XP_003548104.1|  PREDICTED: chlorophyll a-b binding protein 2...    262   2e-84    
gb|ACI90636.1|  chloroplast light harvesting chlorophyll a/b bind...    261   2e-84    
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...    262   2e-84    
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...    262   2e-84    
gb|KEH25005.1|  light-harvesting complex I chlorophyll A/B-bindin...    262   2e-84    
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...    262   2e-84    
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...    262   2e-84    
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...    262   2e-84    
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...    262   2e-84    
ref|NP_001240146.1|  chlorophyll a-b binding protein 21, chloropl...    262   2e-84    
gb|AFI60242.1|  light harvesting chlorophyll a/b binding protein        262   2e-84    
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...    262   2e-84    
gb|EYU28187.1|  hypothetical protein MIMGU_mgv1a009948mg                264   2e-84    
ref|XP_006415534.1|  hypothetical protein EUTSA_v10008479mg             262   2e-84    
gb|AEV59638.1|  chloroplast photosystem II light harvesting compl...    260   2e-84    
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...    262   2e-84    
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...    262   2e-84    
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...    262   2e-84    
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative         262   2e-84    
gb|AFK39586.1|  unknown                                                 262   2e-84    
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...    262   2e-84    
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...    262   2e-84    
gb|AES74698.2|  light-harvesting complex I chlorophyll A/B-bindin...    262   2e-84    
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...    262   2e-84    
emb|CDX84316.1|  BnaC04g10780D                                          262   2e-84    
ref|NP_174286.1|  chlorophyll A/B binding protein 1                     262   2e-84    
emb|CDY17247.1|  BnaA05g09410D                                          262   2e-84    
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg             262   3e-84    
gb|ACU23816.1|  unknown                                                 262   3e-84    
gb|AAB61236.1|  chlorophyll a/b-binding protein                         262   3e-84    
ref|XP_009143778.1|  PREDICTED: chlorophyll a-b binding protein 1...    262   3e-84    
gb|EYU28462.1|  hypothetical protein MIMGU_mgv1a012008mg                262   3e-84    
ref|XP_010499509.1|  PREDICTED: chlorophyll a-b binding protein 1...    262   3e-84    
gb|KEH25006.1|  light-harvesting complex I chlorophyll A/B-bindin...    262   3e-84    
dbj|BAF95850.1|  putative chloroplast chlorophyll a/b binding pro...    261   3e-84    
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...    262   3e-84    
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...    263   3e-84    
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...    262   3e-84    
gb|AEV59641.1|  chloroplast photosystem II light harvesting compl...    261   3e-84    
ref|XP_010478366.1|  PREDICTED: chlorophyll a-b binding protein 1...    262   3e-84    
gb|EYU28186.1|  hypothetical protein MIMGU_mgv1a012011mg                261   3e-84    
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    262   3e-84    
gb|AAL38341.1|  chlorophyll a/b-binding protein                         262   3e-84    
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein             261   3e-84    
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...    261   3e-84    
gb|KDP37945.1|  hypothetical protein JCGZ_04588                         261   3e-84    
ref|NP_564339.1|  chlorophyll A/B binding protein 3                     261   3e-84    
ref|XP_010538237.1|  PREDICTED: chlorophyll a-b binding protein 1...    261   4e-84    
gb|AFW90512.1|  chlorophyll a/b-binding protein                         261   4e-84    
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...    261   4e-84    
gb|ADI88502.1|  protoporphyrin IX magnesium chelatase                   261   4e-84    
gb|AEV59640.1|  chloroplast photosystem II light harvesting compl...    261   4e-84    
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...    261   4e-84    
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...    261   4e-84    
ref|XP_003548106.1|  PREDICTED: chlorophyll a/b-binding protein p...    261   4e-84    
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...    261   4e-84    
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein             261   4e-84    
ref|XP_010499505.1|  PREDICTED: chlorophyll a-b binding protein 2...    261   4e-84    
gb|AHA84197.1|  chlorophyll a/b-binding protein                         261   4e-84    
gb|KJB69716.1|  hypothetical protein B456_011G041600                    261   4e-84    
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...    261   4e-84    
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...    261   4e-84    
gb|AEV59642.1|  chloroplast photosystem II light harvesting compl...    260   4e-84    
gb|ABK23263.1|  unknown                                                 262   5e-84    
emb|CDP06329.1|  unnamed protein product                                261   5e-84    
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...    261   5e-84    
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg               261   5e-84    
gb|AGV54498.1|  LHCII type I chlorophyll a/b-binding protein            261   5e-84    
ref|XP_006356075.1|  PREDICTED: chlorophyll a-b binding protein 3...    261   5e-84    
gb|KFK44817.1|  hypothetical protein AALP_AA1G306700                    261   5e-84    
ref|XP_006356076.1|  PREDICTED: chlorophyll a-b binding protein 3...    261   5e-84    
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...    261   5e-84    
gb|AAF26741.1|AF220527_1  chlorophyll a/b binding protein precursor     261   6e-84    
ref|XP_007158464.1|  hypothetical protein PHAVU_002G154500g             261   6e-84    
emb|CDP06328.1|  unnamed protein product                                261   6e-84    
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...    261   6e-84    
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like                 261   6e-84    
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg             261   6e-84    
ref|XP_010097597.1|  Chlorophyll a-b binding protein 40                 261   6e-84    
ref|XP_009377327.1|  PREDICTED: chlorophyll a-b binding protein o...    261   7e-84    
gb|AIB04244.1|  chloroplast light harvesting chlorophyll a/b bind...    259   7e-84    
gb|AGV54521.1|  LHCII type I chlorophyll a/b-binding protein            261   7e-84    
gb|AEV59639.1|  chloroplast photosystem II light harvesting compl...    260   7e-84    
gb|EYU38943.1|  hypothetical protein MIMGU_mgv1a012024mg                261   7e-84    
sp|P08963.1|CB22_HORVU  RecName: Full=Chlorophyll a-b binding pro...    261   7e-84    
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...    261   7e-84    
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...    261   7e-84    
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...    261   7e-84    
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...    261   7e-84    
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...    261   7e-84    
gb|AAG52048.1|AC022455_2  chlorophyll A-B-binding protein 2 precu...    260   8e-84    
ref|XP_010926397.1|  PREDICTED: chlorophyll a-b binding protein o...    261   8e-84    
ref|XP_006415537.1|  hypothetical protein EUTSA_v10008476mg             261   8e-84    
ref|XP_006356080.1|  PREDICTED: chlorophyll a-b binding protein 3...    261   9e-84    
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative          260   9e-84    
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...    260   9e-84    
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...    261   9e-84    
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                     260   9e-84    
gb|AAB61238.1|  chlorophyll a/b-binding protein                         260   1e-83    
ref|XP_006305533.1|  hypothetical protein CARUB_v10010022mg             260   1e-83    
gb|AEY85026.1|  light-harvesting complex II protein                     260   1e-83    
gb|EYU35814.1|  hypothetical protein MIMGU_mgv1a011908mg                260   1e-83    
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein             260   1e-83    
ref|WP_037445947.1|  hypothetical protein                               257   1e-83    
gb|AAA18529.1|  chlorophyll A/B binding protein                         260   1e-83    
ref|XP_002302798.2|  hypothetical protein POPTR_0002s19010g             260   1e-83    
ref|XP_007151992.1|  hypothetical protein PHAVU_004G0927000g            258   1e-83    
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...    263   1e-83    
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...    260   1e-83    
sp|P09756.1|CB23_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    260   1e-83    
ref|NP_001241277.1|  uncharacterized protein LOC100805310               260   1e-83    
emb|CDX79562.1|  BnaC03g18980D                                          260   1e-83    
sp|P13851.1|CB21_SINAL  RecName: Full=Chlorophyll a-b binding pro...    260   1e-83    
ref|XP_010231015.1|  PREDICTED: chlorophyll a-b binding protein o...    260   1e-83    
emb|CDX98158.1|  BnaC07g09400D                                          260   1e-83    
emb|CDY17248.1|  BnaA05g09400D                                          260   1e-83    
ref|XP_002893588.1|  hypothetical protein ARALYDRAFT_473203             260   1e-83    
gb|AAL67432.1|AF458406_1  chlorophyll a/b binding protein               260   1e-83    
sp|P12470.1|CB25_NICPL  RecName: Full=Chlorophyll a-b binding pro...    260   2e-83    
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...    260   2e-83    
gb|KFK36334.1|  hypothetical protein AALP_AA4G109200                    260   2e-83    
ref|XP_002881334.1|  chlorophyll A-B-binding protein 2 precursor        259   2e-83    
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1    260   2e-83    
gb|ACU23974.1|  unknown                                                 259   2e-83    
ref|XP_009786355.1|  PREDICTED: chlorophyll a-b binding protein 2...    259   2e-83    
gb|KHN28981.1|  Chlorophyll a-b binding protein 3, chloroplastic        259   2e-83    
ref|XP_010460768.1|  PREDICTED: chlorophyll a-b binding protein 2...    259   2e-83    
ref|XP_007158961.1|  hypothetical protein PHAVU_002G196400g             259   2e-83    
ref|XP_004961193.1|  PREDICTED: chlorophyll a-b binding protein M...    259   2e-83    
gb|AEO51755.1|  chloroplast chlorophyll A/B binding protein             259   2e-83    
gb|AAB61237.1|  chlorophyll a/b-binding protein                         259   2e-83    
gb|AAF89206.1|AF279249_1  LHCII type I chlorophyll a/b-binding pr...    259   2e-83    
emb|CDY26306.1|  BnaA09g26570D                                          259   2e-83    
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...    259   2e-83    
ref|XP_009782821.1|  PREDICTED: chlorophyll a-b binding protein 7...    259   2e-83    
ref|XP_009782905.1|  PREDICTED: chlorophyll a-b binding protein 7...    259   2e-83    
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg                259   2e-83    
gb|AGU28449.1|  chlorophyll A/B binding protein 1                       257   3e-83    
ref|XP_009102798.1|  PREDICTED: chlorophyll a-b binding protein 1...    259   3e-83    
ref|XP_002519724.1|  chlorophyll A/B binding protein, putative          259   3e-83    
gb|AAO45885.1|  chlorophyll a/b-binding protein precursor               258   3e-83    
sp|P27491.1|CB27_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    259   3e-83    
ref|XP_009775533.1|  PREDICTED: chlorophyll a-b binding protein 7...    259   3e-83    
dbj|BAJ90643.1|  predicted protein                                      259   3e-83    
gb|KEH25007.1|  light-harvesting complex I chlorophyll A/B-bindin...    259   3e-83    
ref|NP_001235283.1|  chlorophyll a/b-binding protein                    259   3e-83    
sp|P12333.1|CB2A_SPIOL  RecName: Full=Chlorophyll a-b binding pro...    259   3e-83    
gb|AHA84168.1|  chlorophyll a/b-binding protein                         259   3e-83    
gb|AAD21625.1|  putative chlorophyll a/b-binding protein                259   3e-83    
gb|ABQ81857.1|  chloroplast chlorophyll a/b binding protein             259   3e-83    
gb|AGU28448.1|  light-harvesting chlorophyll-protein complex II s...    259   3e-83    
emb|CDY66768.1|  BnaAnng22920D                                          259   4e-83    
gb|AEV59645.1|  chloroplast photosystem II light harvesting compl...    258   4e-83    
sp|P04783.1|CB25_PETSP  RecName: Full=Chlorophyll a-b binding pro...    259   4e-83    
gb|AEV59643.1|  chloroplast photosystem II light harvesting compl...    258   4e-83    
ref|XP_006467509.1|  PREDICTED: chlorophyll a-b binding protein 3...    259   4e-83    
ref|XP_006304391.1|  hypothetical protein CARUB_v10010908mg             259   4e-83    



>emb|CDP19007.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   346 bits (887),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+ GIQQSAFAGQ+ALK Q +LLRKVGS G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSGIQQSAFAGQTALKPQNELLRKVGSFGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  179



>ref|XP_002321186.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
 gb|EEE99501.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
Length=265

 Score =   344 bits (882),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RKVGSSG  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSSGDGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  179



>ref|XP_009365212.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Pyrus x bretschneideri]
Length=287

 Score =   344 bits (882),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = +1

Query  13   KLRRAEESSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWY  192
            KL+  ++  +MA+  IQQSAFAGQ+ALK   +L+RK+G  G  RF+MRRTVKSAPQSIWY
Sbjct  13   KLQTEKKQQAMATSAIQQSAFAGQTALKQSNELVRKIGGLGGGRFSMRRTVKSAPQSIWY  72

Query  193  GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGAL  372
            GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGAL
Sbjct  73   GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGAL  132

Query  373  GCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGF  552
            GCVFPEILS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF
Sbjct  133  GCVFPEILSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGF  192

Query  553  VEGYRVGGG  579
            +EGYRVGGG
Sbjct  193  IEGYRVGGG  201



>ref|XP_002301582.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
 gb|ABK95270.1| unknown [Populus trichocarpa]
 gb|ABK95825.1| unknown [Populus trichocarpa]
 gb|EEE80855.1| chlorophyll a/b-binding family protein [Populus trichocarpa]
Length=265

 Score =   342 bits (877),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   DL+RKVGS G  R TMRRTVKSAPQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQQSAFAGQTALKQPNDLVRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGE+VWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGESVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  179



>gb|ABK96530.1| unknown [Populus trichocarpa x Populus deltoides]
Length=265

 Score =   342 bits (876),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   DL+RKVGS G  R TMRRTVKSAPQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQQSAFAGQTALKQPNDLVRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGE+VWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGESVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  179



>ref|XP_011005408.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Populus euphratica]
Length=265

 Score =   342 bits (876),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RKVG SG  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGCSGDGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  179



>ref|XP_004144543.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164056.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Cucumis sativus]
 gb|KGN43422.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   341 bits (875),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RKVG+ G ARFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGALGGARFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179



>gb|AFO67217.1| putative chlorophyll a/b binding protein [Aralia elata]
Length=265

 Score =   341 bits (875),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK Q +L+RKVGS G    TMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKPQNELVRKVGSFGGGHITMRRTVKSAPESIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGG  179



>gb|ACX54226.1| chlorophyll A/B binding protein [Jatropha curcas]
Length=261

 Score =   340 bits (873),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSFGGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGG  179



>gb|KDP29912.1| hypothetical protein JCGZ_18481 [Jatropha curcas]
Length=265

 Score =   340 bits (873),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSFGGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGG  179



>ref|XP_011039316.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Populus 
euphratica]
Length=265

 Score =   340 bits (873),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   DL+RKVGS G  R TMRRTVKSAPQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQQSAFAGQTALKQPNDLVRKVGSFGGGRVTMRRTVKSAPQSIWYGPDRPKFLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  179



>ref|XP_008462084.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Cucumis melo]
Length=265

 Score =   340 bits (871),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RKVG+ G +RFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQAALKQSNELVRKVGAVGGSRFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179



>ref|XP_002531690.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF30681.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   340 bits (871),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKPSNELVRKVGSVGGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILAK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179



>dbj|BAE46383.1| chlorophyll a/b binding protein [Panax ginseng]
Length=265

 Score =   339 bits (869),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ+SAFAGQ+ALK Q +L+RK+GS G  R TMRRTV+SAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQRSAFAGQTALKPQNELVRKIGSLGGGRITMRRTVRSAPESIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL++
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAR  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGG  179



>gb|EYU42755.1| hypothetical protein MIMGU_mgv1a011961mg [Erythranthe guttata]
Length=265

 Score =   339 bits (869),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF+G++ALK Q +L+RK+G+ G  RFTMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFSGKTALKPQNELIRKIGNVGGGRFTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEVLSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA+QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGFVEGYRVGGG  179



>sp|P12062.1|CB26_PETSP RecName: Full=Chlorophyll a-b binding protein 37, chloroplastic; 
AltName: Full=LHCII type I CAB-37; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA28639.1| chlorophyll a/b binding protein [Petunia x hybrida]
Length=265

 Score =   338 bits (868),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALKSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGG
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYRVGGG  179



>gb|AFJ25031.1| chlorophyll a/b binding protein [Lonicera japonica]
Length=265

 Score =   338 bits (867),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ SAFAGQ+ LK Q +L+RKVGS GS+R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQHSAFAGQTVLKQQNELVRKVGSFGSSRTTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEIL+K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILAK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRIGGG  179



>ref|XP_008379987.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Malus domestica]
Length=265

 Score =   338 bits (866),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RK+G  G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSXELVRKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILS+
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSR  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGG  179



>ref|XP_010270182.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Nelumbo nucifera]
Length=264

 Score =   338 bits (866),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 170/179 (95%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK Q +L+RKVG SG  R +MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQQNELVRKVGVSG-GRISMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH+RWAMLGALGCVFPEIL+K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCVFPEILAK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGG  178



>ref|XP_010112785.1| Chlorophyll a-b binding protein 151 [Morus notabilis]
 gb|EXC34900.1| Chlorophyll a-b binding protein 151 [Morus notabilis]
Length=265

 Score =   337 bits (865),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RK G+ G  R TMRRTV+SAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKAGAVGGGRATMRRTVRSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRIGGG  179



>ref|XP_007215825.1| hypothetical protein PRUPE_ppa010078mg [Prunus persica]
 gb|EMJ17024.1| hypothetical protein PRUPE_ppa010078mg [Prunus persica]
Length=265

 Score =   337 bits (865),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RK+G  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  179



>gb|AEY78525.1| chlorophyll a/b-binding protein [Tagetes erecta]
Length=265

 Score =   337 bits (864),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAG +ALK Q +L++K GS    RFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGSAALKPQNELVKKTGSFTGGRFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEVLSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  179



>ref|XP_009630805.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   337 bits (864),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALKSQ +L+RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  179



>ref|XP_010252708.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Nelumbo nucifera]
Length=264

 Score =   337 bits (863),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 169/179 (94%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK Q +L+RKVG SG  R +MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQQNELVRKVGVSG-GRVSMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH+RWAMLGALGCVFPEIL K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHARWAMLGALGCVFPEILEK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAFQVVLMGFVEGYRVGGG  178



>ref|XP_009343482.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Pyrus x bretschneideri]
Length=265

 Score =   336 bits (862),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ LK   +L++K+G  G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTVLKQSNELVQKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGG  179



>ref|XP_011100602.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Sesamum 
indicum]
Length=266

 Score =   336 bits (862),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 168/180 (93%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGS-SGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+   QQSAF GQ+ALK Q +L+RKVG+ S   RFTMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MATSAFQQSAFGGQTALKPQNELIRKVGNVSAGGRFTMRRTVKSAPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILS
Sbjct  61   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  180



>ref|XP_008342193.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Malus domestica]
Length=265

 Score =   336 bits (862),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ+SAFAGQ+ LK   +L+RK+G  G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQRSAFAGQTVLKQSNELVRKIGGLGGGRFSMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRVGGG  179



>ref|XP_010467054.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
 ref|XP_010488741.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   336 bits (862),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  179



>ref|NP_001234739.1| chlorophyll a-b binding protein 4, chloroplastic [Solanum lycopersicum]
 sp|P14278.1|CB24_SOLLC RecName: Full=Chlorophyll a-b binding protein 4, chloroplastic; 
AltName: Full=LHCII type I CAB-4; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34141.1| chlorophyll a/b-binding protein precursor [Solanum lycopersicum]
Length=265

 Score =   336 bits (862),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+C IQQSAF GQ+  KSQ + +RKVG+ G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATCAIQQSAFVGQAVGKSQNEFIRKVGNFGEGRITMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  179



>emb|CDY15050.1| BnaC03g44110D [Brassica napus]
Length=265

 Score =   336 bits (861),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  179



>gb|AHC95482.1| chlorophyll A/B binding protein [Ziziphus jujuba]
Length=264

 Score =   336 bits (861),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RKVGS G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGSGG-GRITMRRTVKSVPQSIWYGPDRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  120  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  178



>gb|KDO58421.1| hypothetical protein CISIN_1g024579mg [Citrus sinensis]
Length=265

 Score =   336 bits (861),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+AL+   + +RKVG +   R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIGGG  179



>ref|XP_006296728.1| hypothetical protein CARUB_v10014404mg [Capsella rubella]
 gb|EOA29626.1| hypothetical protein CARUB_v10014404mg [Capsella rubella]
Length=265

 Score =   336 bits (861),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQAALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  179



>ref|XP_009802594.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score =   336 bits (861),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF+GQ+ALKSQ +L+RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFSGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  179



>ref|XP_008229895.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Prunus mume]
Length=265

 Score =   335 bits (860),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  I QSAFAGQ+ALK   +L+RK+G  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIHQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRIGGG  179



>ref|XP_009626274.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Nicotiana tomentosiformis]
Length=265

 Score =   335 bits (859),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALKSQ +L+RK+G     R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNELVRKIGCFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  179



>sp|P27494.1|CB23_TOBAC RecName: Full=Chlorophyll a-b binding protein 36, chloroplastic; 
AltName: Full=LHCII type I CAB-36; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41188.1| chlorophyll a/b binding protein [Nicotiana tabacum]
Length=265

 Score =   335 bits (859),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  I+QSAFAGQ+ALKSQ +L+RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIEQSAFAGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILA+WASQVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYRVGGG  179



>ref|XP_004293460.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=265

 Score =   335 bits (858),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RK+GS G  R +MRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKPSNELVRKIGSLGGGRISMRRTVKSAPESIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+LSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEVLSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGG  179



>ref|XP_004251540.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Solanum 
lycopersicum]
Length=265

 Score =   335 bits (858),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ SAFAGQ+ALKSQ + +RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQHSAFAGQTALKSQNEFIRKIGSFEGGRVTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  179



>ref|XP_002271687.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Vitis vinifera]
 emb|CAN71610.1| hypothetical protein VITISV_000630 [Vitis vinifera]
Length=265

 Score =   335 bits (858),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ+SAFAGQ+ALK   +L+RKVG  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQRSAFAGQTALKQPNELVRKVGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  179



>ref|XP_006447758.1| hypothetical protein CICLE_v10016280mg [Citrus clementina]
 ref|XP_006469510.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Citrus sinensis]
 gb|ESR60998.1| hypothetical protein CICLE_v10016280mg [Citrus clementina]
Length=265

 Score =   335 bits (858),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+AL+   + +RKVG +   R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIGGG  179



>gb|AAC34983.1| light harvesting chlorophyll A/B binding protein [Prunus persica]
Length=265

 Score =   334 bits (857),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RK+G  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELIRKIGGLGGGRITMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+N ELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNGELEVIHSRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  179



>ref|XP_006352013.1| PREDICTED: chlorophyll a-b binding protein 37, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   334 bits (857),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALKSQ + +R +GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNEFIRTIGSFEGGRVTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  179



>ref|XP_002885789.1| Lhcb2 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62048.1| Lhcb2 protein [Arabidopsis lyrata subsp. lyrata]
Length=265

 Score =   334 bits (857),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQS+FAGQ+ALK   DLLRK G SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKAGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGG  179



>ref|XP_009136161.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Brassica rapa]
 emb|CDX93077.1| BnaA03g37990D [Brassica napus]
Length=265

 Score =   334 bits (857),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQS+FAGQ+ALK   DLLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRIGGG  179



>ref|NP_178585.1| photosystem II light harvesting complex protein 2.1 [Arabidopsis 
thaliana]
 gb|AAD31358.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAK96468.1| At2g05100/F15L11.2 [Arabidopsis thaliana]
 gb|AAK96540.1| At2g05100/F15L11.2 [Arabidopsis thaliana]
 gb|AAN71932.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AEC05894.1| photosystem II light harvesting complex protein 2.1 [Arabidopsis 
thaliana]
Length=265

 Score =   334 bits (857),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQS+FAGQ+ALK   +LLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNELLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGG  179



>gb|AAL29886.1|M97171_1 chlorophyll a/b binding protein type II [Glycine max]
Length=265

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RK G +G  R TMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQLNELVRKTGGAGKGRTTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGG  179



>gb|AAD28771.1|AF134124_1 Lhcb2 protein [Arabidopsis thaliana]
Length=265

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQS+FAGQ+ALK   +LLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNELLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGG  179



>ref|XP_010412501.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   334 bits (856),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQS+FAGQ+ALK   DLLRKVG S   R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNDLLRKVGVSSGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  179



>emb|CAA84525.1| chlorophyll a,b binding protein type I [Solanum tuberosum]
Length=265

 Score =   334 bits (856),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALKSQ + +RK+GS    R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKSQNEFIRKIGSFEGGRVTMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARN ELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNLELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  121  NGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  179



>ref|XP_006363015.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   333 bits (853),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF GQ+  KSQ + +RKVGS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQAVGKSQNEFVRKVGSFGEGRITMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  179



>gb|AFK45300.1| unknown [Medicago truncatula]
Length=265

 Score =   333 bits (853),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF G++ LK   + +RK GS G +RFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLKQGNEFIRKAGSFGQSRFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGG  179



>ref|XP_003617948.1| Chlorophyll a/b binding protein [Medicago truncatula]
 gb|AET00907.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=265

 Score =   333 bits (853),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF G++ LK   + +RK GS G +RFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLKQGNEFIRKAGSFGQSRFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGG  179



>emb|CAA52750.1| chlorophyll a/b binding protein [Amaranthus hypochondriacus]
Length=264

 Score =   333 bits (853),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF GQ+ LK Q +L+RKVG +G  RF+MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSTIQQSAFVGQTLLKQQNELVRKVGGNG-GRFSMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIF EGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  120  NGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGG  178



>gb|AFK45982.1| unknown [Lotus japonicus]
Length=265

 Score =   332 bits (852),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF GQ+ALK   +LLRK G  G  RFTMRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGQTALKQGNELLRKAGGFGKGRFTMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEIL +
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILER  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGLIEGYRVGGG  179



>gb|AAO62942.1| chlorophyll a/b binding protein [Nicotiana tabacum]
Length=265

 Score =   332 bits (852),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF GQ+  KSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTVAKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGLIEGYRVGGG  179



>gb|AAD28769.1|AF134122_1 Lhcb2 protein [Arabidopsis thaliana]
Length=265

 Score =   332 bits (852),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            M +  IQQS+FAGQ+ALK   +LLRKVG SG  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MGTSAIQQSSFAGQTALKPSNELLRKVGVSGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGG  179



>ref|NP_001240183.1| uncharacterized protein LOC100793702 [Glycine max]
 gb|ACU18219.1| unknown [Glycine max]
 gb|KHN43946.1| Chlorophyll a-b binding protein 151, chloroplastic [Glycine soja]
Length=265

 Score =   332 bits (852),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RK G +G  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQLNELVRKTGGAGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGG  179



>ref|XP_009618965.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   332 bits (852),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF GQ+  KSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTVAKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGLIEGYRVGGG  179



>gb|AAD48017.1|AF165529_1 chlorophyll a/b binding protein [Rumex palustris]
Length=264

 Score =   332 bits (851),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+ GIQ SA AGQ+ALK Q +L+RKVG +G  RF MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MAASGIQFSAIAGQTALKPQNELVRKVGGNG-GRFFMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLSK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGV+FGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  120  NGVQFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  178



>gb|AFW90566.1| chlorophyll a/b-binding protein [Solanum tuberosum]
Length=271

 Score =   332 bits (852),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF GQ+  KSQ + +RKVGS G +R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGQAVGKSQNEFVRKVGSCGESRITMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSY TGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYSTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  179



>gb|AEK26372.1| chloroplast photosystem II chlorophyll a/b binding protein [Sedum 
alfredii]
 gb|AHB24930.1| chloroplast photosystem II light harvesting complex protein 2.1 
[Sedum alfredii]
Length=265

 Score =   332 bits (850),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ SAFAGQ++LK Q +L+RKVG+    R TMRRTVKS PQSIWYG DRPKYLGP
Sbjct  1    MATSAIQSSAFAGQTSLKQQNELVRKVGNFSGGRATMRRTVKSTPQSIWYGADRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRVGGG  179



>ref|NP_178582.1| photosystem II light harvesting complex protein 2.2 [Arabidopsis 
thaliana]
 gb|AAD28770.1|AF134123_1 Lhcb2 protein [Arabidopsis thaliana]
 gb|AAD25595.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAL06878.1| At2g05070/F1O13.20 [Arabidopsis thaliana]
 gb|AAL32641.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AAL47403.1| At2g05070/F1O13.20 [Arabidopsis thaliana]
 gb|AAM13371.1| putative chlorophyll a/b binding protein [Arabidopsis thaliana]
 gb|AEC05893.1| photosystem II light harvesting complex protein 2.2 [Arabidopsis 
thaliana]
Length=265

 Score =   332 bits (850),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQS+FAGQ+ALK  +DL++KVG  G  R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSSDLIQKVGVLGGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFIEGYRIGGG  179



>ref|XP_009111582.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Brassica rapa]
 emb|CDY20039.1| BnaA09g02120D [Brassica napus]
Length=265

 Score =   332 bits (850),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S   R  MRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGRVVMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  179



>gb|AII25433.1| light-harvesting chlorophyll a/b binding protein [Sedum alfredii]
Length=265

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ SAFAGQ++LK Q +L+RKVG+    R TMRRTVKS PQSIWYG DRPKYLGP
Sbjct  1    MATSAIQSSAFAGQTSLKQQNELVRKVGNFSGGRATMRRTVKSTPQSIWYGADRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGLIEGYRVGGG  179



>gb|KFK23428.1| hypothetical protein AALP_AAs45999U001400 [Arabis alpina]
Length=265

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQS+FAGQ+ALK   ++LRKVG S   R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSSFAGQTALKPSNEILRKVGVSSGGRVTMRRTVKSTPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILSK
Sbjct  61   FSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  179



>gb|ACJ84374.1| unknown [Medicago truncatula]
Length=265

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF G++ LK   + +RK GS G +RFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLKQGNEFIRKAGSFGQSRFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA++VVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATRVVLMGFVEGYRVGGG  179



>ref|XP_009792415.1| PREDICTED: chlorophyll a-b binding protein 37, chloroplastic-like 
[Nicotiana sylvestris]
Length=265

 Score =   330 bits (847),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF G++  KSQ +L+RK+GS G  R TMRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFVGRTVAKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGLIEGYRVGGG  179



>ref|XP_007142492.1| hypothetical protein PHAVU_008G285100g [Phaseolus vulgaris]
 gb|AGV54257.1| LHCII type II chlorophyll a/b-binding protein [Phaseolus vulgaris]
 gb|ESW14486.1| hypothetical protein PHAVU_008G285100g [Phaseolus vulgaris]
Length=265

 Score =   330 bits (847),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+   QQSAFAGQ+ALK   + +RK G SG  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAFQQSAFAGQTALKQVNEFVRKTGGSGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  179



>ref|NP_001241179.1| uncharacterized protein LOC100815789 [Glycine max]
 gb|ACU19775.1| unknown [Glycine max]
 gb|KHN46928.1| Chlorophyll a-b binding protein 215, chloroplastic [Glycine soja]
Length=265

 Score =   330 bits (847),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF GQ+ALK   + +RK G +G  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGQTALKQLNEFVRKTGGAGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGG  179



>ref|XP_010045878.1| PREDICTED: chlorophyll a-b binding protein 36, chloroplastic 
[Eucalyptus grandis]
 gb|KCW88692.1| hypothetical protein EUGRSUZ_A01047 [Eucalyptus grandis]
Length=265

 Score =   330 bits (847),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK  ++L+RKVG+    R TMRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATTVIQQSAFAGQTALKQSSELVRKVGNFAGGRATMRRTVKSVPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEIL K
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILQK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGG  179



>ref|XP_010502775.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic-like 
[Camelina sativa]
Length=266

 Score =   330 bits (846),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ALK   DLLRKVGSS G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGSSNGGGRIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180



>ref|XP_007049308.1| Photosystem II light harvesting complex gene 2.1 [Theobroma cacao]
 gb|EOX93465.1| Photosystem II light harvesting complex gene 2.1 [Theobroma cacao]
Length=265

 Score =   330 bits (846),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+RKVG  G  R TMRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVRKVGVFGGGRVTMRRTVKSAPASIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILS+
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSR  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179



>gb|KJB06589.1| hypothetical protein B456_001G192000 [Gossypium raimondii]
 gb|KJB06590.1| hypothetical protein B456_001G192000 [Gossypium raimondii]
Length=265

 Score =   330 bits (846),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF GQ+ALK   +LLRKVG+    R TMRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTALKQSNELLRKVGAFDGGRVTMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179



>gb|KJB06801.1| hypothetical protein B456_001G192300 [Gossypium raimondii]
Length=265

 Score =   330 bits (845),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF GQ+ALK   +LLRKVG+    R TMRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFVGQTALKQSNELLRKVGAFDGGRVTMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179



>ref|XP_004491575.1| PREDICTED: chlorophyll a-b binding protein 215, chloroplastic-like 
[Cicer arietinum]
Length=265

 Score =   330 bits (845),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF G++ L+   + +RK GS G  RFTMRRTVKS P+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLRQGNEFIRKAGSFGQGRFTMRRTVKSTPESIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGG  179



>ref|XP_010665939.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 emb|CAA74179.1| chlorophyll a/b-binding protein [Beta vulgaris subsp. vulgaris]
Length=264

 Score =   330 bits (845),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ LK Q +L+RK G +G  R +MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSTIQQSAFAGQTILKPQNELVRKFGGNG-GRASMRRTVKSAPQSIWYGPDRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIF EGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  120  NGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  178



>ref|XP_006291684.1| hypothetical protein CARUB_v10017845mg [Capsella rubella]
 gb|EOA24582.1| hypothetical protein CARUB_v10017845mg [Capsella rubella]
Length=266

 Score =   330 bits (845),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ LK   DLLRKVG+S G AR  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTTLKPSNDLLRKVGASNGGARIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180



>emb|CDX83726.1| BnaC07g24660D [Brassica napus]
Length=266

 Score =   329 bits (844),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180



>ref|XP_010514479.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Camelina 
sativa]
Length=266

 Score =   329 bits (843),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S F+GQ+ALK   DLLRKVGSS G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSTFSGQTALKPSNDLLRKVGSSNGGGRIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180



>ref|XP_006395408.1| hypothetical protein EUTSA_v10004777mg [Eutrema salsugineum]
 dbj|BAJ33772.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ32694.1| hypothetical protein EUTSA_v10004777mg [Eutrema salsugineum]
Length=266

 Score =   329 bits (843),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180



>ref|XP_009151928.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic-like 
[Brassica rapa]
 emb|CDY49770.1| BnaA02g29010D [Brassica napus]
Length=266

 Score =   329 bits (843),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180



>gb|AEO51757.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=265

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  +Q S+FAGQ++L    + +RKVGS G  R TMRRTVKS P SIWYGPDRPKYLGP
Sbjct  1    MATTALQHSSFAGQTSLNLSNEFIRKVGSFGEGRITMRRTVKSVPASIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYR+GGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRIGGG  179



>emb|CDY13732.1| BnaA06g31910D [Brassica napus]
Length=266

 Score =   329 bits (843),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPANDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180



>gb|KJB10748.1| hypothetical protein B456_001G220900 [Gossypium raimondii]
Length=265

 Score =   328 bits (842),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+ KVG+ G  R +MRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVCKVGAVGGGRVSMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179



>gb|AAW31512.1| light-harvesting chlorophyll-a/b binding protein Lhcb2 [Pisum 
sativum]
Length=265

 Score =   328 bits (842),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF G++ L+   + +RK G+ G ARFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLRQGNEFIRKAGNFGQARFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPE+L K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGG  179



>ref|XP_009397219.1| PREDICTED: chlorophyll a-b binding protein 151, chloroplastic 
[Musa acuminata subsp. malaccensis]
 gb|ABF70157.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=264

 Score =   328 bits (841),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  +QQSAFAGQ+ALK Q +L+R+VGSS   RF MRRT  S P+SIWYGPDRPKYLGP
Sbjct  1    MATSALQQSAFAGQTALKQQNELVRRVGSS-RGRFFMRRTTASTPKSIWYGPDRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEIL+K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLGALGCVFPEILAK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  178



>gb|AAF89205.1|AF279248_1 LHCII type II chlorophyll a/b-binding protein [Vigna radiata]
Length=265

 Score =   328 bits (841),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+   QQSAFAGQ+ALK   + +RK G SG  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATTAFQQSAFAGQTALKQVNEFVRKTGGSGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG VFPEIL K
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGIVFPEILEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGG  179



>ref|XP_006291597.1| hypothetical protein CARUB_v10017751mg [Capsella rubella]
 gb|EOA24495.1| hypothetical protein CARUB_v10017751mg [Capsella rubella]
Length=293

 Score =   329 bits (843),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = +1

Query  40   SMASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYL  216
            +MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYL
Sbjct  27   AMATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRIVMRRTVKSTPQSIWYGPDRPKYL  86

Query  217  GPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL  396
            GPFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEIL
Sbjct  87   GPFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEIL  146

Query  397  SKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGG  576
            SKNGVKFGEAVWF+AG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GG
Sbjct  147  SKNGVKFGEAVWFRAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGG  206

Query  577  G  579
            G
Sbjct  207  G  207



>gb|ABO20852.1| chlorophyll a/b binding protein of LHCII type I [Lilium longiflorum]
Length=264

 Score =   328 bits (840),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF GQ+ALK++ +L+RKVG  G  R +MRRTVKSAPQSIWYG DRPKYLGP
Sbjct  1    MATSAIQQSAFTGQTALKNRDELVRKVGVVG-GRVSMRRTVKSAPQSIWYGADRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRIGGG  178



>ref|XP_010557706.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Tarenaya 
hassleriana]
Length=266

 Score =   328 bits (840),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            A+  IQ++AFAGQ+AL    + LRKVG S   R TMRRTVKSAPQSIWYGPDRPKYLGPF
Sbjct  3    ATSAIQKTAFAGQTALNQSNEFLRKVGVSSGGRVTMRRTVKSAPQSIWYGPDRPKYLGPF  62

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            SE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKN
Sbjct  63   SENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKN  122

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  123  GVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  180



>emb|CDY03989.1| BnaC02g37040D [Brassica napus]
Length=266

 Score =   328 bits (840),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSVIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180



>sp|P27518.2|CB21_GOSHI RecName: Full=Chlorophyll a-b binding protein 151, chloroplastic; 
AltName: Full=LHCII type II CAB-151; Short=LHCP; Flags: 
Precursor [Gossypium hirsutum]
 emb|CAA38025.1| chlorophyll ab binding protein [Gossypium hirsutum]
 gb|KHG21776.1| Chlorophyll a-b binding protein, chloroplastic [Gossypium arboreum]
Length=265

 Score =   328 bits (840),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK   +L+ K+G+ G  R +MRRTVKSAP SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFAGQTALKQSNELVCKIGAVGGGRVSMRRTVKSAPTSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FS+Q PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  61   FSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179



>ref|XP_002875397.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51656.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   328 bits (840),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 165/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ALK   DL+RKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLIRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180



>emb|CDY00149.1| BnaC09g01520D [Brassica napus]
Length=266

 Score =   327 bits (839),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+F GQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFTGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180



>sp|P27520.1|CB215_PEA RecName: Full=Chlorophyll a-b binding protein 215, chloroplastic; 
AltName: Full=LHCII type II CAB-215; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 emb|CAA40365.1| chlorophyll a/b-binding protein [Pisum sativum]
Length=265

 Score =   327 bits (839),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAF G++ L+   + +RK G+ G ARFTMRRTVKSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSAIQQSAFTGKTGLRQGNEFIRKRGNFGQARFTMRRTVKSAPESIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPE+L K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA+QVVLMGFVEGYRVGGG
Sbjct  121  NGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGG  179



>ref|NP_189406.1| photosystem II light harvesting complex protein 2.3 [Arabidopsis 
thaliana]
 gb|AAD28772.1|AF134125_1 Lhcb2 protein [Arabidopsis thaliana]
 gb|AAK48984.1|AF370557_1 light harvesting chlorophyll a/b-binding protein [Arabidopsis 
thaliana]
 dbj|BAB02693.1| light harvesting chlorophyll a/b-binding protein [Arabidopsis 
thaliana]
 gb|AAP13406.1| At3g27700 [Arabidopsis thaliana]
 gb|AEE77352.1| photosystem II light harvesting complex protein 2.3 [Arabidopsis 
thaliana]
Length=266

 Score =   327 bits (838),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ LK   DLLRK+G+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSSFAGQTTLKPSNDLLRKIGASNGGGRIIMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180



>gb|KFK33682.1| hypothetical protein AALP_AA5G045900 [Arabis alpina]
Length=266

 Score =   326 bits (835),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYG DRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGADRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180



>gb|KFK33681.1| hypothetical protein AALP_AA5G045800 [Arabis alpina]
Length=266

 Score =   326 bits (835),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYG DRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNGGGRVVMRRTVKSTPQSIWYGADRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180



>ref|XP_008810536.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Phoenix 
dactylifera]
Length=265

 Score =   325 bits (834),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 166/178 (93%), Gaps = 1/178 (1%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            A+  +Q+SAFAGQ+ALK Q +L+RKVG     R +MRRTVKSAPQS+WYGPDRPKYLGPF
Sbjct  3    AASALQRSAFAGQTALKQQNELVRKVGVF-QGRISMRRTVKSAPQSMWYGPDRPKYLGPF  61

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILS+N
Sbjct  62   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSRN  121

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  122  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179



>gb|ABD92879.1| chloroplast chlorophyll a/b binding protein [Pachysandra terminalis]
Length=264

 Score =   325 bits (834),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  +QQSA AG++ALK Q +L++KVG  G  R +M RTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MATSALQQSALAGRTALKQQNELVKKVGVFG-GRISMHRTVKSTPQSIWYGPDRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  120  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFIEGYRVGGG  178



>gb|AGZ15385.1| chlorophyll a/b-binding protein (LHCII type II) [Phaseolus vulgaris]
Length=239

 Score =   323 bits (829),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+   QQSAFAGQ+ALK   + +RK G SG  R  MRRTVKSAPQSIWYGPDRPKYLGP
Sbjct  1    MATSAFQQSAFAGQTALKQVNEFVRKTGGSGKGRTNMRRTVKSAPQSIWYGPDRPKYLGP  60

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQ PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEIL K
Sbjct  61   FSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPEILEK  120

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF E YRVGGG
Sbjct  121  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFGERYRVGGG  179



>sp|P12332.2|CB21_SILPR RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor, 
partial [Silene latifolia subsp. alba]
 gb|AAB42157.1| chlorophyl-a/b-binding protein precursor, partial [Silene latifolia 
subsp. alba]
Length=205

 Score =   322 bits (825),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ LK Q +L+RKVG +G  R +MRRT+KSAP+SIWYGPDRPKYLGP
Sbjct  1    MATSTIQQSAFAGQTLLKPQNELVRKVGGNG-GRVSMRRTIKSAPESIWYGPDRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+K
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIF EGGLDYLGNPNL+HAQSILAIWA QVVLMG VEGYRVGGG
Sbjct  120  NGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSILAIWACQVVLMGAVEGYRVGGG  178



>gb|KFK33683.1| hypothetical protein AALP_AA5G046000 [Arabis alpina]
Length=266

 Score =   324 bits (831),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSA-RFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+FAGQ+ALK   DLLRKVG+S    R  MRRTVKS PQSIWYG DRPKYLG
Sbjct  1    MATSAIQHSSFAGQTALKPSNDLLRKVGASNDGGRVVMRRTVKSTPQSIWYGADRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRIGGG  180



>ref|XP_002875398.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51657.1| LHCB2:4 [Arabidopsis lyrata subsp. lyrata]
Length=266

 Score =   324 bits (830),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S+F GQ+ALK   DLLRKVG+S G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQYSSFTGQTALKPSNDLLRKVGASNGGGRVIMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLG+PNLIHAQSILAIWA QVVLMGF+EGYR+GGG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGSPNLIHAQSILAIWACQVVLMGFIEGYRIGGG  180



>sp|P12328.1|CB21_LEMGI RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor [Lemna 
gibba]
 gb|AAA33392.1| chlorophyll a/b apoprotein [Lemna gibba]
Length=264

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ SAFAGQ+ALK + +L+RKVG S   RF+MRRTVK+ PQSIWYG DRPK+LGP
Sbjct  1    MAASAIQSSAFAGQTALKQRDELVRKVGVS-DGRFSMRRTVKAVPQSIWYGADRPKFLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC+FPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGV+FGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA+QVVLMG +EGYRVGGG
Sbjct  120  NGVQFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYRVGGG  178



>ref|XP_010908796.1| PREDICTED: chlorophyll a-b binding protein 5, chloroplastic [Elaeis 
guineensis]
Length=265

 Score =   322 bits (825),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 166/180 (92%), Gaps = 2/180 (1%)
 Frame = +1

Query  43   MASC-GIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MAS    Q+SAFAGQ+ALK Q +L++KVG     R +MRRTVKSAPQS+WYGPDRPKYLG
Sbjct  1    MASASAFQRSAFAGQTALKRQNELVQKVGVF-EGRISMRRTVKSAPQSMWYGPDRPKYLG  59

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEIL+
Sbjct  60   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILA  119

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  120  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  179



>gb|AEZ49172.1| chlorophyll a/b binding protein of LHCII type I [Wolffia australiana]
Length=264

 Score =   322 bits (824),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ+SA AGQ  L+ + +L+RKVG S   R +MRRTVK+APQSIWYGPDRPK+LGP
Sbjct  1    MAASAIQKSALAGQRGLRQRDELVRKVGVS-DGRVSMRRTVKAAPQSIWYGPDRPKFLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH+RWAMLGALGC+FPE+LSK
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGCIFPELLSK  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA+QVVLMGF+EGYRVGGG
Sbjct  120  NGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWATQVVLMGFIEGYRVGGG  178



>ref|XP_006836754.1| hypothetical protein AMTR_s00088p00153020 [Amborella trichopoda]
 gb|ERM99607.1| hypothetical protein AMTR_s00088p00153020 [Amborella trichopoda]
Length=264

 Score =   321 bits (822),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 165/179 (92%), Gaps = 1/179 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQ S+FAGQ+ LK Q++L +KVG+ G  R  MRRTVKS PQSIWYGPDRPKYLGP
Sbjct  1    MAASAIQSSSFAGQTVLKPQSELAKKVGAYG-GRIFMRRTVKSVPQSIWYGPDRPKYLGP  59

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++
Sbjct  60   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR  119

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGE+VWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  120  NGVKFGESVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGG  178



>gb|ABK21429.1| unknown [Picea sitchensis]
 gb|ABK22448.1| unknown [Picea sitchensis]
 gb|ABK23914.1| unknown [Picea sitchensis]
 gb|ABK24064.1| unknown [Picea sitchensis]
 gb|ABK26103.1| unknown [Picea sitchensis]
 gb|ABK26818.1| unknown [Picea sitchensis]
 gb|ABR17641.1| unknown [Picea sitchensis]
 gb|ACN39896.1| unknown [Picea sitchensis]
 gb|ACN39974.1| unknown [Picea sitchensis]
 gb|ACN40033.1| unknown [Picea sitchensis]
 gb|ACN40585.1| unknown [Picea sitchensis]
 gb|ACN40649.1| unknown [Picea sitchensis]
Length=266

 Score =   316 bits (809),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 165/178 (93%), Gaps = 2/178 (1%)
 Frame = +1

Query  49   SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  180



>gb|ABQ02464.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=263

 Score =   316 bits (809),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/180 (86%), Positives = 165/180 (92%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  +QQ+ +F G +  + +  L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALQQTTSFLGTAPRRDE--LVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGG  177



>gb|AAC15992.1| chlorophyll a/b binding protein [Oryza sativa Japonica Group]
Length=263

 Score =   315 bits (806),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 164/180 (91%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  + +  L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  177



>gb|ABK21859.1| unknown [Picea sitchensis]
 gb|ABK21874.1| unknown [Picea sitchensis]
 gb|ABK24058.1| unknown [Picea sitchensis]
 gb|ABK24837.1| unknown [Picea sitchensis]
 gb|ABK26095.1| unknown [Picea sitchensis]
 gb|ACN39796.1| unknown [Picea sitchensis]
 gb|ACN40179.1| unknown [Picea sitchensis]
Length=266

 Score =   314 bits (804),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 2/178 (1%)
 Frame = +1

Query  49   SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKT  122

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  180



>ref|NP_001050586.1| Os03g0592500 [Oryza sativa Japonica Group]
 sp|Q10HD0.1|CB23_ORYSJ RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Oryza sativa Japonica Group]
 sp|A2XJ35.1|CB23_ORYSI RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Oryza sativa Indica Group]
 gb|AAT81763.1| chlorophyll a/b binding protein [Oryza sativa Japonica Group]
 gb|ABF97413.1| Chlorophyll a-b binding protein, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF12500.1| Os03g0592500 [Oryza sativa Japonica Group]
 gb|EAY90845.1| hypothetical protein OsI_12453 [Oryza sativa Indica Group]
 gb|EAZ27662.1| hypothetical protein OsJ_11611 [Oryza sativa Japonica Group]
 gb|AFI71846.1| chlorophyll a/b binbing protein [Oryza sativa]
Length=263

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 164/180 (91%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  + +  L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  177



>gb|ABK21323.1| unknown [Picea sitchensis]
Length=266

 Score =   314 bits (804),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 2/178 (1%)
 Frame = +1

Query  49   SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+ AP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRIAPESIWYGPDRPKYLGPF  62

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  180



>ref|XP_006664981.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Oryza brachyantha]
Length=263

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 163/180 (91%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQSA-FAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+  F G +  + +  L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTGFLGTAPRRDE--LVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  177



>dbj|BAA00537.1| type II light-harvesting chlorophyll a/b-binding protein [Oryza 
sativa Japonica Group]
Length=263

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 164/180 (91%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  +   D++R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DVVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELE+IHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELELIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  177



>ref|XP_010412415.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Camelina sativa]
Length=172

 Score =   310 bits (794),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 154/170 (91%), Gaps = 1/170 (1%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSS-GSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  IQ S F+GQ+ALK   DLLRKVGSS G  R  MRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MATSAIQHSTFSGQTALKPSNDLLRKVGSSNGGGRIVMRRTVKSTPQSIWYGPDRPKYLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSE TPSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPEILS
Sbjct  61   PFSENTPSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCTFPEILS  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG  549
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG
Sbjct  121  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMG  170



>prf||1707316B chlorophyll a/b binding protein 2
Length=263

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 164/180 (91%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  +   DL+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELE+IHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELELIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  177



>gb|AFV34723.1| light harvesting chlorophyll a/b-binding protein 2-1 [Dendrocalamus 
latiflorus]
Length=263

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 164/180 (91%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  + +  L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYR+GGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRIGGG  177



>gb|ABR17665.1| unknown [Picea sitchensis]
Length=266

 Score =   312 bits (800),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 2/178 (1%)
 Frame = +1

Query  49   SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQV LMG +EGYRVGGG
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVGLMGLIEGYRVGGG  180



>gb|ACO06085.1| chlorophyll a-b binding protein [Triticum aestivum]
Length=196

 Score =   309 bits (792),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 162/180 (90%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  118  KNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGG  177



>gb|ABK22382.1| unknown [Picea sitchensis]
 gb|ABK23122.1| unknown [Picea sitchensis]
 gb|ABK26462.1| unknown [Picea sitchensis]
 gb|ABR16136.1| unknown [Picea sitchensis]
 gb|ACN40237.1| unknown [Picea sitchensis]
Length=266

 Score =   311 bits (798),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 163/178 (92%), Gaps = 2/178 (1%)
 Frame = +1

Query  49   SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            +  IQ S+ AGQ+ L+  Q +L+ KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQISSLAGQTLLRPQQNELVSKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAFQVVLMGLIEGYRVGGG  180



>gb|ACE88963.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=181

 Score =   308 bits (790),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 151/173 (87%), Positives = 159/173 (92%), Gaps = 3/173 (2%)
 Frame = +1

Query  61   QQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTP  240
            Q ++F G +  + +  L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLGPFSEQTP
Sbjct  1    QTTSFLGTAPRRDE--LVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTP  57

Query  241  SYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFG  420
            SYLTGEF GDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFG
Sbjct  58   SYLTGEFAGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFG  117

Query  421  EAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            EAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  118  EAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGG  170



>gb|ABQ02463.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=263

 Score =   311 bits (796),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 163/180 (91%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G  A   + +L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLG--AAPRRDELVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEF GDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFAGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGG  177



>gb|EMS46868.1| Chlorophyll a-b binding protein, chloroplastic [Triticum urartu]
Length=263

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 162/180 (90%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  118  KNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGG  177



>gb|AEW70716.1| light harvesting chlorophyll a-b binding protein 2-1 [Phyllostachys 
edulis]
Length=263

 Score =   310 bits (795),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 163/180 (91%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G  A   + +L+R+VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLG--AAPRRDELVRRVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEF GDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFAGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRVGGG  177



>ref|XP_003562323.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Brachypodium 
distachyon]
Length=263

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 162/180 (90%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  118  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFIEGYRVGGG  177



>emb|CAA43907.1| chlorophyll a/b-binding protein [Pinus thunbergii]
Length=266

 Score =   310 bits (793),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 162/175 (93%), Gaps = 2/175 (1%)
 Frame = +1

Query  58   IQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQ  234
            IQ S+ AGQ+ L+  Q +L++KVG++  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSE 
Sbjct  7    IQSSSLAGQTLLRPQQNELVKKVGTA-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEG  65

Query  235  TPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVK  414
            TPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGC+FPE+L+KNGVK
Sbjct  66   TPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCLFPELLAKNGVK  125

Query  415  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  126  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGG  180



>gb|ACO06088.1| chlorophyll a-b binding protein [Triticum aestivum]
Length=263

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 162/180 (90%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  +   DL+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRD--DLVRSVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGF+EGYRVGGG
Sbjct  118  KNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFIEGYRVGGG  177



>gb|ABO10493.1| light-harvesting chlorophyll a/b binding protein [Bambusa oldhamii]
Length=263

 Score =   309 bits (791),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 162/180 (90%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  + +  L+R VG  G  R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRHVGDFG-GRITMRRTVKSAPQSIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNREL VIHSRWAMLGALGCVFPEILS
Sbjct  58   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELGVIHSRWAMLGALGCVFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWASQVVLMGFVEGYR+GGG
Sbjct  118  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWASQVVLMGFVEGYRIGGG  177



>gb|ABK21446.1| unknown [Picea sitchensis]
Length=266

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/178 (84%), Positives = 162/178 (91%), Gaps = 2/178 (1%)
 Frame = +1

Query  49   SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            +  IQ S+ AGQ+ L+  Q +L+ KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQISSLAGQTLLRPQQNELVSKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            SEQTPSYLTGEFPGDY WDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYRWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKT  122

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWAFQVVLMGLIEGYRVGGG  180



>gb|ABR25974.1| chloroplast chlorophyll a-b binding protein precursor [Oryza 
sativa Indica Group]
Length=253

 Score =   308 bits (788),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 1/160 (1%)
 Frame = +1

Query  100  QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW  279
            + +L+R+VG SG  R TMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDY W
Sbjct  9    RDELVRRVGDSG-GRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYRW  67

Query  280  DTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS  459
            DTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS
Sbjct  68   DTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS  127

Query  460  EGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            EGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  128  EGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGG  167



>gb|AAV74408.1| chloroplast chlorophyll A/B binding protein [Manihot esculenta]
Length=243

 Score =   307 bits (787),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/157 (93%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +1

Query  109  LLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA  288
            L+RK GS G  RF+MRRTVKSAP SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA
Sbjct  1    LVRKXGSFGGGRFSMRRTVKSAPPSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA  60

Query  289  GLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGG  468
            GLSADPETFA+NRELEVIH RWAMLGALGCVFPE+LSKNGVKFGEAVWFKAGAQIFSEGG
Sbjct  61   GLSADPETFAKNRELEVIHCRWAMLGALGCVFPEVLSKNGVKFGEAVWFKAGAQIFSEGG  120

Query  469  LDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            LDYLGNPNLIHAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  121  LDYLGNPNLIHAQSILAIWAVQVVLMGFVEGYRVGGG  157



>ref|NP_001148271.1| chlorophyll a-b binding protein [Zea mays]
 ref|XP_008665042.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic [Zea 
mays]
 gb|ACG30372.1| chlorophyll a-b binding protein [Zea mays]
 gb|ACR34075.1| unknown [Zea mays]
 tpg|DAA50197.1| TPA: type II light-harvesting chlorophyll a /b-binding protein 
isoform 1 [Zea mays]
 tpg|DAA50198.1| TPA: type II light-harvesting chlorophyll a /b-binding protein 
isoform 2 [Zea mays]
 tpg|DAA50201.1| TPA: light harvesting chlorophyll binding protein9 isoform 1 
[Zea mays]
 tpg|DAA50202.1| TPA: light harvesting chlorophyll binding protein9 isoform 2 
[Zea mays]
Length=260

 Score =   307 bits (787),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 157/180 (87%), Gaps = 7/180 (4%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F GQ+ +       R  G     R TMRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQALVS------RAAGVDAGGRITMRRTVKSVPQSIWYGPDRPKYLG  54

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL+
Sbjct  55   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  114

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  115  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  174



>gb|ACG30954.1| chlorophyll a-b binding protein [Zea mays]
Length=260

 Score =   307 bits (787),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 157/180 (87%), Gaps = 7/180 (4%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F GQ+ +       R  G     R TMRRTVKS PQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQALVA------RAAGVDAGDRITMRRTVKSVPQSIWYGPDRPKYLG  54

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL+
Sbjct  55   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  114

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  115  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  174



>gb|AAB19040.1| type 2 light-harvesting chlorophyll a/b-binding polypeptide, 
partial [Pinus palustris]
Length=246

 Score =   306 bits (783),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 154/160 (96%), Gaps = 1/160 (1%)
 Frame = +1

Query  100  QTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW  279
            Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW
Sbjct  2    QNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW  60

Query  280  DTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFS  459
            DTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L+KNGVKFGEAVWFKAGAQIFS
Sbjct  61   DTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGAQIFS  120

Query  460  EGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            EGGLDYLGNPNLIHAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  121  EGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGG  160



>ref|XP_004982492.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   306 bits (783),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 159/180 (88%), Gaps = 6/180 (3%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F GQ AL S+        +    R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQ-ALVSRP----AAAADAGGRITMRRTVKSAPQSIWYGPDRPKYLG  55

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL+
Sbjct  56   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  115

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  116  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  175



>gb|ABK22497.1| unknown [Picea sitchensis]
 gb|ABK24164.1| unknown [Picea sitchensis]
 gb|ABK26145.1| unknown [Picea sitchensis]
 gb|ABR17447.1| unknown [Picea sitchensis]
 gb|ABR17727.1| unknown [Picea sitchensis]
 gb|ACN39972.1| unknown [Picea sitchensis]
 gb|ACN40388.1| unknown [Picea sitchensis]
Length=266

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 157/168 (93%), Gaps = 2/168 (1%)
 Frame = +1

Query  79   GQSALKSQ-TDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTG  255
            GQ+ L+ Q  +L+RKVG S  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQTPSYLTG
Sbjct  14   GQTLLRPQHNELVRKVGMS-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEQTPSYLTG  72

Query  256  EFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWF  435
            EFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+K GVKFGEAVWF
Sbjct  73   EFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKTGVKFGEAVWF  132

Query  436  KAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  133  KAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  180



>ref|XP_002466863.1| hypothetical protein SORBIDRAFT_01g015400 [Sorghum bicolor]
 gb|EER93861.1| hypothetical protein SORBIDRAFT_01g015400 [Sorghum bicolor]
Length=262

 Score =   305 bits (780),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 157/180 (87%), Gaps = 5/180 (3%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F GQ+ +          G     R TMRRTVKSAPQSIWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGQALVSRPAAAAADAG----GRITMRRTVKSAPQSIWYGPDRPKYLG  56

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL+
Sbjct  57   PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILA  116

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYRVGGG
Sbjct  117  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGG  176



>sp|P10049.1|CB21_PINTH RecName: Full=Chlorophyll a-b binding protein type I, chloroplastic; 
Short=CAB; Short=LHCP; Flags: Precursor [Pinus thunbergii]
 emb|CAA31773.1| chlorophylla/b-binding preprotein (AA -37 to 229) [Pinus thunbergii]
Length=266

 Score =   305 bits (780),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 160/175 (91%), Gaps = 2/175 (1%)
 Frame = +1

Query  58   IQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQ  234
            IQ S+ AGQ+ L+  Q +L++KVG++  AR TMRRTV+SAP+SIWYGPDRPKYLGPFSE 
Sbjct  7    IQSSSLAGQTLLRPQQNELVKKVGTA-QARITMRRTVRSAPESIWYGPDRPKYLGPFSEG  65

Query  235  TPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVK  414
            TPSYLTGEFPGDYGWDTA +SADPETFA+NRELEVIH RWAMLGALGCVFPE+L+KNG+K
Sbjct  66   TPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGLK  125

Query  415  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            FGEAVWFKAGAQIFSEGGLDY GNPNLIHAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  126  FGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGG  180



>ref|WP_039311140.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91138.1| hypothetical protein QW71_36380, partial [Paenibacillus sp. IHB 
B 3415]
Length=191

 Score =   301 bits (772),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGP  222
            MA+  IQQSAFAGQ+ALK Q +L+RK+GS G  R TMRRTV+SAPQSIWYGPDRPKYLGP
Sbjct  28   MATSAIQQSAFAGQTALKPQNELVRKIGSFGGGRITMRRTVRSAPQSIWYGPDRPKYLGP  87

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSK
Sbjct  88   FSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSK  147

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSIL  516
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSIL
Sbjct  148  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSIL  185



>ref|XP_002986911.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ11993.1| light-harvesting complex [Selaginella moellendorffii]
Length=267

 Score =   302 bits (774),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  79   GQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGE  258
            GQ+ALKS  +L RKVG+ G AR  MRRT  S P SIWYGPDRPK+LGPFSEQTPSYLTGE
Sbjct  15   GQTALKSPNELSRKVGNLGEARTVMRRTRASTPDSIWYGPDRPKFLGPFSEQTPSYLTGE  74

Query  259  FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFK  438
            FPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCV PE+L+KNG+KFGEAVWFK
Sbjct  75   FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVTPELLAKNGIKFGEAVWFK  134

Query  439  AGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            AG+QIF EGGLDYLGNPNL+HAQSILAIWASQV+LMG VEGYRVGGG
Sbjct  135  AGSQIFKEGGLDYLGNPNLVHAQSILAIWASQVILMGAVEGYRVGGG  181



>gb|AAB82142.1| chlorophyll a-b binding protein [Oryza sativa Indica Group]
Length=263

 Score =   299 bits (766),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 160/180 (89%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASCGIQQS-AFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+  + Q+ +F G +  + +  L+R+VG+SG  R TMRRTVKSAPQ+IWYGPDRPKYLG
Sbjct  1    MAASALHQTTSFLGTAPRRDE--LVRRVGNSG-GRITMRRTVKSAPQNIWYGPDRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFSEQTPSYLTG+FPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGC FPEILS
Sbjct  58   PFSEQTPSYLTGKFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCFFPEILS  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGV FGEAVWFKAGAQIFSEGGLDYLGNP L+  QSILAIWA QVVLMGFVEGYRVGGG
Sbjct  118  KNGVNFGEAVWFKAGAQIFSEGGLDYLGNPALVRPQSILAIWAVQVVLMGFVEGYRVGGG  177



>gb|KDO58422.1| hypothetical protein CISIN_1g024579mg [Citrus sinensis]
Length=229

 Score =   297 bits (760),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  151  MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRE  330
            MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRE
Sbjct  1    MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRE  60

Query  331  LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  510
            LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS
Sbjct  61   LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  120

Query  511  ILAIWASQVVLMGFVEGYRVGGG  579
            ILAIWA QVVLMGFVEGYR+GGG
Sbjct  121  ILAIWACQVVLMGFVEGYRIGGG  143



>gb|EMT32028.1| Chlorophyll a-b binding protein, chloroplastic [Aegilops tauschii]
Length=229

 Score =   296 bits (758),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = +1

Query  151  MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRE  330
            MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRE
Sbjct  1    MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRE  60

Query  331  LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  510
            LEVIHSRWAMLGALGCVFPEILSKNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQS
Sbjct  61   LEVIHSRWAMLGALGCVFPEILSKNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQS  120

Query  511  ILAIWASQVVLMGFVEGYRVGGG  579
            ILAIWA QVVLMGF+EGYRVGGG
Sbjct  121  ILAIWAVQVVLMGFIEGYRVGGG  143



>sp|P14279.1|CB25_SOLLC RecName: Full=Chlorophyll a-b binding protein 5, chloroplastic; 
AltName: Full=LHCII type I CAB-5; Short=LHCP; Flags: Precursor, 
partial [Solanum lycopersicum]
 gb|AAA34142.1| chlorophyll a/b-binding protein precursor, partial [Solanum lycopersicum]
Length=237

 Score =   296 bits (758),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/146 (97%), Positives = 142/146 (97%), Gaps = 0/146 (0%)
 Frame = +1

Query  142  RFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAR  321
            R TMRRTVKSAPQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAR
Sbjct  6    RVTMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAR  65

Query  322  NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIH  501
            NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIH
Sbjct  66   NRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIH  125

Query  502  AQSILAIWASQVVLMGFVEGYRVGGG  579
            AQSILAIWASQVVLMGFVEGYRVGGG
Sbjct  126  AQSILAIWASQVVLMGFVEGYRVGGG  151



>emb|CAA89823.1| light-harvesting chlorophyll a/b binding protein of photosystem 
II [Pseudotsuga menziesii]
Length=234

 Score =   296 bits (757),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 138/147 (94%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = +1

Query  139  ARFTMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA  318
            AR TMRRTV+SAP+SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA
Sbjct  2    ARITMRRTVRSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA  61

Query  319  RNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLI  498
            +NRELEVIHSRWAMLGALGCVFPE+L+KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLI
Sbjct  62   KNRELEVIHSRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLI  121

Query  499  HAQSILAIWASQVVLMGFVEGYRVGGG  579
            HAQSILAIWA QVVLMG +EGYRVGGG
Sbjct  122  HAQSILAIWAFQVVLMGLIEGYRVGGG  148



>ref|XP_001757271.1| predicted protein [Physcomitrella patens]
 gb|EDQ77756.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            A+  +  +  AGQS LK   +L RKVGSS  AR TMRRTVKS   SIWYG DRPKYLGPF
Sbjct  3    AATAMHSTTLAGQSLLKPVNELSRKVGSS-EARVTMRRTVKSTSDSIWYGADRPKYLGPF  61

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            S +TPSYLTGEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+K+
Sbjct  62   SGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKS  121

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWASQVVLMG VEGYRV GG
Sbjct  122  GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVVLMGAVEGYRVAGG  179



>ref|XP_001755762.1| predicted protein [Physcomitrella patens]
 gb|EDQ79435.1| predicted protein [Physcomitrella patens]
Length=265

 Score =   285 bits (729),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            A+  +  +A AGQS LK   +L RKVG+   AR +MR+T   +  SIWYG DRPKYLGPF
Sbjct  3    AATAMHSTALAGQSLLKPVNELSRKVGNV-EARISMRKTASKSSDSIWYGADRPKYLGPF  61

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            S +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGCV PE+L+KN
Sbjct  62   SGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKN  121

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYRV GG
Sbjct  122  GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRVAGG  179



>ref|XP_001762089.1| predicted protein [Physcomitrella patens]
 gb|EDQ73193.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   283 bits (724),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 155/180 (86%), Gaps = 4/180 (2%)
 Frame = +1

Query  43   MASC-GIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLG  219
            MA+C     +A AGQ+ALKS  +L RKVG+   AR TMR+   S+  SIWYG DRPKYLG
Sbjct  1    MAACTATHSTALAGQTALKSINELSRKVGNV-QARVTMRKA--SSSDSIWYGADRPKYLG  57

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            P S +TPSYLTGEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGCV PE+L+
Sbjct  58   PLSGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLA  117

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KNGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYRV GG
Sbjct  118  KNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRVAGG  177



>gb|AAA60965.1| light-harvesting chlorophyll a/b binding protein of photosystem 
II [Ginkgo biloba]
Length=270

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 155/185 (84%), Gaps = 6/185 (3%)
 Frame = +1

Query  37   SSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRT----VKSAPQSIWYGPDR  204
            ++MAS G+  SAFAGQ  LK Q + +   G  G  R TMR+T    V ++  S WYGPDR
Sbjct  2    ATMASAGVASSAFAGQIVLKPQNEFVG--GVHGEGRITMRKTASKKVVASSGSPWYGPDR  59

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVF
Sbjct  60   VKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  119

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+LS+NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+LIHAQSILAIWA QV+LMG VEGY
Sbjct  120  PELLSRNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGY  179

Query  565  RVGGG  579
            R+ GG
Sbjct  180  RIAGG  184



>gb|ACI90635.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus yunnanensis]
Length=254

 Score =   281 bits (719),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 156/190 (82%), Gaps = 9/190 (5%)
 Frame = +1

Query  37   SSMASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIW  189
            ++MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S W
Sbjct  1    ATMASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPW  60

Query  190  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  369
            YGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGA
Sbjct  61   YGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA  120

Query  370  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG  549
            LGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG
Sbjct  121  LGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMG  180

Query  550  FVEGYRVGGG  579
             VEGYR+ GG
Sbjct  181  AVEGYRIAGG  190



>emb|CAA48641.1| type II light-harvesting chlorophyll a /b-binding protein [Zea 
mays]
Length=229

 Score =   280 bits (715),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/136 (96%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +1

Query  151  MRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRE  330
            MRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGW+TAG+SADPETFARNRE
Sbjct  1    MRRTVKSVPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWETAGVSADPETFARNRE  60

Query  331  LEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQS  510
            LEVIHSRWAMLGALGCVFPEIL+KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQS
Sbjct  61   LEVIHSRWAMLGALGCVFPEILAKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQS  120

Query  511  ILAIWASQVVLMGFVE  558
            ILAIWA QVVLMGFVE
Sbjct  121  ILAIWACQVVLMGFVE  136



>gb|ACI90632.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus tabuliformis var. henryi]
 gb|ACI90633.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus hwangshanensis]
 gb|ACI90634.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus tabuliformis]
Length=254

 Score =   280 bits (716),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 155/190 (82%), Gaps = 9/190 (5%)
 Frame = +1

Query  37   SSMASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIW  189
            ++MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S W
Sbjct  1    ATMASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPW  60

Query  190  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  369
            YGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGA
Sbjct  61   YGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGA  120

Query  370  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG  549
            LGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG
Sbjct  121  LGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMG  180

Query  550  FVEGYRVGGG  579
             VEGYR+ GG
Sbjct  181  AVEGYRIAGG  190



>gb|ABK22798.1| unknown [Picea sitchensis]
Length=253

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 152/178 (85%), Gaps = 15/178 (8%)
 Frame = +1

Query  49   SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA             MLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFA-------------MLGALGCVFPELLAKT  109

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  110  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGLIEGYRVGGG  167



>emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta]
Length=274

 Score =   280 bits (715),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 154/188 (82%), Gaps = 9/188 (5%)
 Frame = +1

Query  43   MASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYG  195
            MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKAATKKVSVSASTSPWYG  60

Query  196  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  375
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  376  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  555
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  556  EGYRVGGG  579
            EGYR+ GG
Sbjct  181  EGYRIAGG  188



>gb|ACI90631.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus bungeana]
Length=254

 Score =   278 bits (711),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 156/190 (82%), Gaps = 9/190 (5%)
 Frame = +1

Query  37   SSMASCGIQQSAFAG--QSALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIW  189
            ++MA+CGI   AFAG   S+LK  T+ L  VG+   G +R TMR++       SA  S W
Sbjct  1    ATMATCGIGSCAFAGGQLSSLKPHTNQLLGVGAGVHGESRVTMRKSATKKSFASASPSPW  60

Query  190  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  369
            YGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGA
Sbjct  61   YGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGA  120

Query  370  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG  549
            LGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG
Sbjct  121  LGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMG  180

Query  550  FVEGYRVGGG  579
             VEGYR+ GG
Sbjct  181  AVEGYRIAGG  190



>emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta]
Length=274

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 153/188 (81%), Gaps = 9/188 (5%)
 Frame = +1

Query  43   MASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYG  195
            MASCGI    FAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCGFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSVSASTSPWYG  60

Query  196  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  375
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  376  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  555
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  556  EGYRVGGG  579
            EGYR+ GG
Sbjct  181  EGYRIAGG  188



>gb|ACY66805.1| chlorophyll a/b-binding protein [Pinus massoniana]
Length=274

 Score =   278 bits (712),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 153/188 (81%), Gaps = 9/188 (5%)
 Frame = +1

Query  43   MASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYG  195
            MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPWYG  60

Query  196  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  375
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALG  120

Query  376  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  555
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  556  EGYRVGGG  579
            EGYR+ GG
Sbjct  181  EGYRIAGG  188



>gb|AHB24928.1| chloroplast chlorophyll a-b binding protein 2/3 [Sedum alfredii]
Length=267

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 138/153 (90%), Gaps = 4/153 (3%)
 Frame = +1

Query  133  GSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  300
            GS R TMR+T      SA  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GSGRVTMRKTAAKPKPSASSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  301  DPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  480
            DPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  481  GNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GNPNL+HAQSILAIWASQVVLMG +EGYRVGGG
Sbjct  149  GNPNLVHAQSILAIWASQVVLMGLIEGYRVGGG  181



>emb|CAA57408.1| light harvesting chlorophyll a /b-binding protein Lhcb1*2-1 [Picea 
abies]
Length=274

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 154/188 (82%), Gaps = 9/188 (5%)
 Frame = +1

Query  43   MASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYG  195
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLLGVGAGVHGEARVTMRKSSTKKVSASASPSPWYG  60

Query  196  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  375
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  376  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  555
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAV  180

Query  556  EGYRVGGG  579
            EGYR+ GG
Sbjct  181  EGYRIAGG  188



>ref|XP_001774812.1| predicted protein [Physcomitrella patens]
 dbj|BAD08519.1| light-harvesting chlorophyll a/b-binding protein 2 [Physcomitrella 
patens]
 gb|EDQ60353.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 150/171 (88%), Gaps = 3/171 (2%)
 Frame = +1

Query  73   FAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLGPFSEQTPSY  246
             AGQS LK   +L RKVGSS  AR TMRRTV KSA   SIWYG DRPKYLGPFS +TPSY
Sbjct  12   LAGQSLLKPVNELSRKVGSS-QARVTMRRTVNKSAGSDSIWYGADRPKYLGPFSGETPSY  70

Query  247  LTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEA  426
            L GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGCV PE+L+K+GVKFGEA
Sbjct  71   LNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKSGVKFGEA  130

Query  427  VWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            VWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYRV GG
Sbjct  131  VWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGG  181



>emb|CAA57409.1| light harvesting chlorophyll a /b-binding protein Lhcb1*2-2 [Picea 
abies]
Length=275

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 155/189 (82%), Gaps = 10/189 (5%)
 Frame = +1

Query  43   MASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRR--TVK----SAPQSIWY  192
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR+  T K    SA  S WY
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLLGVGAGVHGEARVTMRKSSTTKKVSASASPSPWY  60

Query  193  GPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGAL  372
            GPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGAL
Sbjct  61   GPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGAL  120

Query  373  GCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGF  552
            GCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG 
Sbjct  121  GCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGA  180

Query  553  VEGYRVGGG  579
            VEGYR+ GG
Sbjct  181  VEGYRIAGG  189



>gb|ABK20976.1| unknown [Picea sitchensis]
 gb|ABK21395.1| unknown [Picea sitchensis]
 gb|ABK25775.1| unknown [Picea sitchensis]
 gb|ABR17147.1| unknown [Picea sitchensis]
 gb|ABR17370.1| unknown [Picea sitchensis]
 gb|ACN39891.1| unknown [Picea sitchensis]
 gb|ACN40202.1| unknown [Picea sitchensis]
 gb|ACN40506.1| unknown [Picea sitchensis]
 gb|ACN40508.1| unknown [Picea sitchensis]
Length=274

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 154/188 (82%), Gaps = 9/188 (5%)
 Frame = +1

Query  43   MASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYG  195
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLVGVGAGVHGEARVTMRKSSTKKVSASASTSPWYG  60

Query  196  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  375
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  376  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  555
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  556  EGYRVGGG  579
            EGYR+ GG
Sbjct  181  EGYRIAGG  188



>ref|XP_001761868.1| predicted protein [Physcomitrella patens]
 ref|XP_001761952.1| predicted protein [Physcomitrella patens]
 sp|P20866.2|CB2_PHYPA RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ73309.1| predicted protein [Physcomitrella patens]
 gb|EDQ73393.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 154/180 (86%), Gaps = 3/180 (2%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLG  219
            A+  +  +A AGQS +K   +L RKVG+   AR TMRRTV KSA   SIWYG DRPK+LG
Sbjct  3    AATAMHSTALAGQSLVKPVNELSRKVGNV-EARVTMRRTVSKSAGSDSIWYGADRPKFLG  61

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  121

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GG
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGG  181



>ref|XP_001751426.1| predicted protein [Physcomitrella patens]
 ref|XP_001785364.1| predicted protein [Physcomitrella patens]
 ref|XP_001785367.1| predicted protein [Physcomitrella patens]
 gb|EDQ49825.1| predicted protein [Physcomitrella patens]
 gb|EDQ49828.1| predicted protein [Physcomitrella patens]
 gb|EDQ83743.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   277 bits (708),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 153/179 (85%), Gaps = 3/179 (2%)
 Frame = +1

Query  49   SCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLGP  222
            +  +  +A AGQ  LK   +L RKVG+   AR TMRRTV KSA   SIWYG DRPK+LGP
Sbjct  4    ATAMHSTALAGQGVLKPVNELSRKVGNV-EARVTMRRTVSKSAGSDSIWYGADRPKFLGP  62

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FS +TPSYLTGEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+K
Sbjct  63   FSGETPSYLTGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAK  122

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GG
Sbjct  123  SGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGG  181



>sp|P15194.1|CB2B_PINSY RecName: Full=Chlorophyll a-b binding protein type 2 member 1B, 
chloroplastic; AltName: Full=Chlorophyll a-b binding protein 
type II 1B; Short=CAB; AltName: Full=LHCP; Flags: Precursor 
[Pinus sylvestris]
 emb|CAA32658.1| unnamed protein product [Pinus sylvestris]
Length=274

 Score =   276 bits (707),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 152/188 (81%), Gaps = 9/188 (5%)
 Frame = +1

Query  43   MASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYG  195
            MASCGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKLTASASTSPWYG  60

Query  196  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  375
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPE FA+NRELEVIH RWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALG  120

Query  376  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  555
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  556  EGYRVGGG  579
            EGYR+ GG
Sbjct  181  EGYRIAGG  188



>ref|XP_001779318.1| predicted protein [Physcomitrella patens]
 gb|EDQ55825.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   276 bits (706),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            A+  +  +  AGQS LK   +L RKVG+S  AR +MR++  S   SIWYG DRPK+LGPF
Sbjct  3    AATAMHSTTLAGQSLLKPVNELSRKVGTS-EARVSMRKS--SGSDSIWYGADRPKFLGPF  59

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            S +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGCV PE+L+KN
Sbjct  60   SGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLAKN  119

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYRV GG
Sbjct  120  GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGG  177



>prf||1615137A chlorophyll a/b binding protein P25
Length=226

 Score =   275 bits (702),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +1

Query  160  TVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEV  339
            TV+SAP+SIWYGPDRPKYLGPFSE TPSYLTGEFPGDYGWDTA +SADPETFA+NRELEV
Sbjct  1    TVRSAPESIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEV  60

Query  340  IHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILA  519
            IH RWAMLGALGCVFPE+L KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILA
Sbjct  61   IHCRWAMLGALGCVFPELLVKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILA  120

Query  520  IWASQVVLMGFVEGYRVGGG  579
            IWA QVVLMG +EGYRVGGG
Sbjct  121  IWACQVVLMGLIEGYRVGGG  140



>gb|AAA33636.1| major chlorophyll binding protein [Physcomitrella patens]
Length=269

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 153/180 (85%), Gaps = 2/180 (1%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLG  219
            A+  +  +A AGQS +K   +L RKV  +  AR TMRRTV KSA   +IWYG DRPK+LG
Sbjct  3    AATAMHSTALAGQSLVKPVNELSRKVLGNVEARVTMRRTVSKSAGSDTIWYGADRPKFLG  62

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+
Sbjct  63   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  122

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GG
Sbjct  123  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGG  182



>sp|P24006.1|CB2A_PYRPY RecName: Full=Chlorophyll a-b binding protein 1A, chloroplastic; 
AltName: Full=LHCII type II CAB-1A; Short=LHCP; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00449.1| light harvesting a/b binding protein [Pyrus pyrifolia var. culta]
Length=278

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 159/191 (83%), Gaps = 9/191 (5%)
 Frame = +1

Query  34   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVG-SSGSARFTMRR-----TVKSAPQSI  186
            +++MASCGI  + AFAG   S++K Q + L  VG + G AR TMR+     +V ++  S 
Sbjct  2    ATTMASCGIGSRCAFAGAQLSSVKPQNNQLLGVGGAHGEARLTMRKATGRKSVAASIDSP  61

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  62   WYGPDRVMYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWA QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILM  181

Query  547  GFVEGYRVGGG  579
            G +EGYRV GG
Sbjct  182  GAIEGYRVAGG  192



>gb|ACN40194.1| unknown [Picea sitchensis]
Length=274

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 154/188 (82%), Gaps = 9/188 (5%)
 Frame = +1

Query  43   MASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYG  195
            MASCGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYG
Sbjct  1    MASCGIGSCAFAGGQISSLKPHNNQLVGVGAGVHGEARVTMRKSSTKKVSASASTSPWYG  60

Query  196  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  375
            PDR  YLGPFS + PS+LTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSHLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  120

Query  376  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  555
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  556  EGYRVGGG  579
            EGYR+ GG
Sbjct  181  EGYRIAGG  188



>gb|AAC78690.1| chlorophyll a/b-binding protein [Pinus thunbergii]
Length=274

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 153/188 (81%), Gaps = 9/188 (5%)
 Frame = +1

Query  43   MASCGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYG  195
            MASCG  + AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYG
Sbjct  1    MASCGSGRCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPWYG  60

Query  196  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  375
            PDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALG
Sbjct  61   PDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALG  120

Query  376  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  555
            CVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG V
Sbjct  121  CVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAV  180

Query  556  EGYRVGGG  579
            EGYR+ GG
Sbjct  181  EGYRIAGG  188



>ref|XP_001774452.1| predicted protein [Physcomitrella patens]
 dbj|BAA77273.1| chlorophyll a/b-binding protein precursor [Physcomitrella patens]
 gb|EDQ60676.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 154/182 (85%), Gaps = 3/182 (2%)
 Frame = +1

Query  40   SMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVK--SAPQSIWYGPDRPKY  213
            + A+  +  +  AGQ+ LK  ++L RKV ++G AR TMR+TV   S   SIWYG DRPK+
Sbjct  2    ATAATAMNSTVLAGQALLKPVSELSRKV-NAGEARVTMRKTVSKSSGSDSIWYGADRPKF  60

Query  214  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI  393
            LGPFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+
Sbjct  61   LGPFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPEL  120

Query  394  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVG  573
            L+K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYRV 
Sbjct  121  LAKSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVA  180

Query  574  GG  579
            GG
Sbjct  181  GG  182



>sp|P15193.1|CB2A_PINSY RecName: Full=Chlorophyll a-b binding protein type 2 member 1A, 
chloroplastic; AltName: Full=Chlorophyll a-b binding protein 
type II 1A; Short=CAB; AltName: Full=LHCP; Flags: Precursor 
[Pinus sylvestris]
 emb|CAA32657.1| unnamed protein product [Pinus sylvestris]
Length=278

 Score =   276 bits (705),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 159/191 (83%), Gaps = 9/191 (5%)
 Frame = +1

Query  34   SSSMASCGI-QQSAFAGQ--SALKSQTDLLRKVG-SSGSARFTMRR-----TVKSAPQSI  186
            +++MASCGI  + AFAG   S++K Q + L  VG + G AR TMR+     +V ++  S 
Sbjct  2    ATTMASCGIGSRCAFAGAQLSSVKPQNNQLLGVGGAHGEARLTMRKATGKKSVAASIDSP  61

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+P LIHAQSILAIWA QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPQLIHAQSILAIWACQVILM  181

Query  547  GFVEGYRVGGG  579
            G +EGYRV GG
Sbjct  182  GAIEGYRVAGG  192



>gb|AAU89261.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus monophylla]
Length=256

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 152/185 (82%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAG--QSALKSQTDLLRKVGS--SGSARFTMRRT-----VKSAPQSIWYGPDR  204
            CGI   AFAG   S+LK  T+ L  VG+   G +R TMR++     V SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQXSSLKPHTNQLLGVGAGVHGESRVTMRKSATKKSVASASPSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|ABK22510.1| unknown [Picea sitchensis]
 gb|ABK22691.1| unknown [Picea sitchensis]
 gb|ABK26115.1| unknown [Picea sitchensis]
 gb|ABR17282.1| unknown [Picea sitchensis]
Length=278

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 158/191 (83%), Gaps = 9/191 (5%)
 Frame = +1

Query  34   SSSMASCGI-QQSAFAG--QSALKSQTDLLRKVGS-SGSARFTMRR-----TVKSAPQSI  186
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAIWA QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAIWACQVILM  181

Query  547  GFVEGYRVGGG  579
            G +EGYRV GG
Sbjct  182  GAIEGYRVAGG  192



>ref|XP_002960494.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ38033.1| light-harvesting complex [Selaginella moellendorffii]
Length=272

 Score =   275 bits (702),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 151/174 (87%), Gaps = 4/174 (2%)
 Frame = +1

Query  67   SAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQ---SIWYGPDRPKYLGPFSEQT  237
            S FAGQ+ LK Q + + +  S+GS R  MR+T K++     S WYGPDR KYLGPFS ++
Sbjct  14   STFAGQTGLKPQNEFVARNASNGS-RIAMRKTGKASSVGGGSPWYGPDRVKYLGPFSGES  72

Query  238  PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKF  417
            PSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LSKNG+KF
Sbjct  73   PSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSKNGIKF  132

Query  418  GEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GEAVWFKAG+QIF EGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYR+ GG
Sbjct  133  GEAVWFKAGSQIFKEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRIAGG  186



>ref|XP_001751359.1| predicted protein [Physcomitrella patens]
 gb|EDQ83676.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   275 bits (702),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 153/180 (85%), Gaps = 3/180 (2%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLG  219
            A+  +  +A AGQS  +   +L RKVG+  S R TMRRTV KSA   SIWYG DRPK+LG
Sbjct  3    AATAMHSTALAGQSLFQPVNELSRKVGNVDS-RVTMRRTVNKSAGSDSIWYGADRPKFLG  61

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  121

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GG
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGG  181



>gb|AAU89257.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus flexilis]
 gb|AAU89258.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus lambertiana]
 gb|AAU89259.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus monticola]
 gb|AAU89260.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus strobus]
Length=256

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 151/185 (82%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYGPDR  204
            CGI   AFAG   S LK  T+ L  VG+   G +R TMR++       SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGKISLLKPHTNQLLGVGAGVHGESRVTMRKSAAKKSFASASPSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L+KNGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLAKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|AAU89262.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus remota]
Length=256

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 152/185 (82%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAG--QSALKSQTDLLRKVGS--SGSARFTMRRT-----VKSAPQSIWYGPDR  204
            CGI   AFAG   S+LK  T+ L  VG+   G +R TMR++     V SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQLSSLKPHTNQLLGVGAGVHGESRVTMRKSATKKSVASASPSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|AAU89264.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus nelsonii]
Length=256

 Score =   273 bits (699),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 152/185 (82%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRT-----VKSAPQSIWYGPDR  204
            CGI   AFAG   S+LK  T+ L  VG+   G +R TMR++     V SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLVGVGAGVHGESRVTMRKSATKKSVVSASPSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|AIW07979.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07980.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07981.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07982.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07983.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07984.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07985.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07986.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07987.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07988.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07989.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07990.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07991.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07992.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07993.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07994.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07995.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07996.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07997.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07998.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW07999.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08000.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08001.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08002.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08003.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08004.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08005.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08006.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08007.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08008.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08009.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08010.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08011.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08012.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08013.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08014.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08015.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08016.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08017.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08018.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08019.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08020.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08021.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08022.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08023.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08024.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08025.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08026.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08027.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08028.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08029.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08030.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08031.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08032.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08033.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08034.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08035.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08036.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08037.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08038.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08039.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08040.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08041.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08042.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08043.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08044.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08045.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08046.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08047.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08048.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08049.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08050.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08051.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08052.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08053.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08055.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08056.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08057.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08058.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08059.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08060.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08061.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08062.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08063.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08064.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08065.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08066.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08068.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08069.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08070.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08071.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08072.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08073.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08074.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08075.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08076.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08077.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08078.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08079.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08080.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08081.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08082.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08083.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08084.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08085.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08086.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08087.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08088.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08089.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08090.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08091.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08092.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
Length=255

 Score =   273 bits (699),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 152/184 (83%), Gaps = 8/184 (4%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK----SAPQSIWYGPDRP  207
            CGI   AFAG   S+LK  ++ L  VG+   G +R TMR++      S   S WYGPDR 
Sbjct  1    CGIGSCAFAGGKISSLKPHSNQLLGVGAGVHGESRVTMRKSATKKFASESPSPWYGPDRV  60

Query  208  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  387
             YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP
Sbjct  61   LYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  120

Query  388  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR  567
            E+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWASQV+LMG VEGYR
Sbjct  121  ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYR  180

Query  568  VGGG  579
            + GG
Sbjct  181  IAGG  184



>gb|AAY81730.1| chloroplast putative light harvesting chlorophyll a/b binding 
protein, partial [Pinus krempfii]
Length=250

 Score =   273 bits (698),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 152/184 (83%), Gaps = 8/184 (4%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK----SAPQSIWYGPDRP  207
            CGI   AFAG   S+LK  ++ L  VG+   G +R TMR++      S   S WYGPDR 
Sbjct  1    CGIGSCAFAGGKISSLKPHSNQLLGVGAGVHGESRVTMRKSATKKFASESPSPWYGPDRV  60

Query  208  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  387
             YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP
Sbjct  61   LYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  120

Query  388  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR  567
            E+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWASQV+LMG VEGYR
Sbjct  121  ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWASQVILMGAVEGYR  180

Query  568  VGGG  579
            + GG
Sbjct  181  IAGG  184



>gb|AAU89250.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus echinata]
Length=253

 Score =   273 bits (698),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 150/185 (81%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYGPDR  204
            CGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSVSASTSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|AAU89254.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus merkusii]
Length=256

 Score =   273 bits (698),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 150/185 (81%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYGPDR  204
            CGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSASASTSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|AIW08054.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
 gb|AIW08067.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus krempfii]
Length=255

 Score =   273 bits (698),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 152/184 (83%), Gaps = 8/184 (4%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK----SAPQSIWYGPDRP  207
            CGI   AFAG   S+LK  ++ L  VG+   G +R TMR++      S   S WYGPDR 
Sbjct  1    CGIGSCAFAGGKISSLKPHSNQLLGVGAGVHGESRVTMRKSATKKFASESPSPWYGPDRV  60

Query  208  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  387
             YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP
Sbjct  61   LYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  120

Query  388  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR  567
            E+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYR
Sbjct  121  ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYR  180

Query  568  VGGG  579
            + GG
Sbjct  181  IAGG  184



>ref|XP_002967230.1| light-harvesting complex [Selaginella moellendorffii]
 gb|EFJ31829.1| light-harvesting complex [Selaginella moellendorffii]
Length=263

 Score =   273 bits (699),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 151/174 (87%), Gaps = 4/174 (2%)
 Frame = +1

Query  67   SAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQ---SIWYGPDRPKYLGPFSEQT  237
            S FAGQ+ LK Q + + +  S+GS R  MR+T +++     S WYGPDR KYLGPFS ++
Sbjct  5    STFAGQTGLKPQNEFVARNASNGS-RVAMRKTGRASSVGGGSPWYGPDRVKYLGPFSGES  63

Query  238  PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKF  417
            PSYLTGE+PGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LSKNG+KF
Sbjct  64   PSYLTGEYPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSKNGIKF  123

Query  418  GEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GEAVWFKAG+QIF EGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYR+ GG
Sbjct  124  GEAVWFKAGSQIFKEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRIAGG  177



>gb|AAU89255.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus roxburghii]
Length=256

 Score =   273 bits (698),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 150/185 (81%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYGPDR  204
            CGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKAATKKVSVSASTSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|AAU89251.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus ponderosa]
Length=256

 Score =   273 bits (698),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 150/185 (81%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYGPDR  204
            CGI   AFAG   S+LK  T+ L  VG+   G AR TMR+        SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSVSASTSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|AAU89253.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus contorta]
Length=256

 Score =   273 bits (698),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 150/185 (81%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVKS-----APQSIWYGPDR  204
            CGI   AFAG   S+LK  T+ L  VG+   G AR TMR+         A  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVTMRKATTKKVSVPASTSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|AAU89265.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Picea sitchensis]
Length=253

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 151/185 (82%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYGPDR  204
            CGI   AFAG   S+LK   + L  VG+   G AR TMR++       SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHNNQLVGVGAGVHGEARVTMRKSSTKKVSASASTSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|AAY81729.1| chloroplast putative light harvesting chlorophyll a/b binding 
protein, partial [Pinus gerardiana]
Length=253

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 151/185 (82%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAG--QSALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYGPDR  204
            CGI   AFAG   S+LK  T+ L  VG+   G +R TMR++       SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQLSSLKPHTNQLLGVGAGIHGESRVTMRKSATKKSFASASPSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|AAU89256.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus chiapensis]
Length=256

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 151/185 (82%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYGPDR  204
            CGI   AFAG   S LK  T+ L  VG+   G +R TMR++       SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGKISLLKPHTNQLLGVGAGVHGESRVTMRKSAAKKSFASASPSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L+KNGVKFGEAVWFKAGAQIFSEGGLD+LGNP+LIHAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLAKNGVKFGEAVWFKAGAQIFSEGGLDHLGNPSLIHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>gb|ABF97414.1| Chlorophyll a-b binding protein, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
Length=219

 Score =   271 bits (692),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/130 (98%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  190  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  369
            YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA
Sbjct  4    YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  63

Query  370  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG  549
            LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG
Sbjct  64   LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMG  123

Query  550  FVEGYRVGGG  579
            FVEGYRVGGG
Sbjct  124  FVEGYRVGGG  133



>gb|AAU89252.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus radiata]
Length=256

 Score =   271 bits (693),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 149/185 (81%), Gaps = 9/185 (5%)
 Frame = +1

Query  52   CGIQQSAFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRTVK-----SAPQSIWYGPDR  204
            CGI   AFAG   S+LK  T+ L  VG+   G AR  MR+        SA  S WYGPDR
Sbjct  1    CGIGSCAFAGGQISSLKPHTNQLLGVGAGVHGEARVMMRKATTKKVSVSASTSPWYGPDR  60

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
              YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  61   VLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  120

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGY
Sbjct  121  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGY  180

Query  565  RVGGG  579
            R+ GG
Sbjct  181  RIAGG  185



>ref|XP_001751602.1| predicted protein [Physcomitrella patens]
 gb|EDQ83919.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   271 bits (694),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 152/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSA-PQSIWYGPDRPKYLG  219
            A+  +  +  AGQS LK   +L R+VG+   AR TMRRTV KSA   SIWYG DRPK+LG
Sbjct  3    AAIAMHSTGLAGQSLLKPVNELSRRVGNV-DARVTMRRTVSKSARSDSIWYGADRPKFLG  61

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS +TPSYL GEF GDYGWDTAGLS+D ETFARNRELEVIH+RWAMLGALGC+ PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDLETFARNRELEVIHARWAMLGALGCLTPELLA  121

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYRV GG
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGG  181



>gb|ACN40044.1| unknown [Picea sitchensis]
Length=278

 Score =   271 bits (693),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 157/191 (82%), Gaps = 9/191 (5%)
 Frame = +1

Query  34   SSSMASCGI-QQSAFAG--QSALKSQTDLLRKVGS-SGSARFTMRR-----TVKSAPQSI  186
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEG LDYLG+PNL+HAQSILAIWA QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGWLDYLGSPNLVHAQSILAIWACQVILM  181

Query  547  GFVEGYRVGGG  579
            G +EGYRV GG
Sbjct  182  GAIEGYRVAGG  192



>ref|XP_001754234.1| predicted protein [Physcomitrella patens]
 dbj|BAD08518.1| light-harvesting chlorophyll a/b-binding protein 1 [Physcomitrella 
patens]
 gb|EDQ81135.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   271 bits (692),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 148/169 (88%), Gaps = 3/169 (2%)
 Frame = +1

Query  79   GQSALKSQTDLLRKVGSSGSARFTMRRTVK--SAPQSIWYGPDRPKYLGPFSEQTPSYLT  252
            GQ+ L+   +L+RKVG+S  AR TMR+TV   S   SIWYG DRPK+LGPFS +TPSYL 
Sbjct  14   GQALLQPANELVRKVGTS-QARVTMRKTVSKSSGSDSIWYGADRPKFLGPFSGETPSYLN  72

Query  253  GEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVW  432
            GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+K+GVKFGEAVW
Sbjct  73   GEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVW  132

Query  433  FKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            FKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYRV GG
Sbjct  133  FKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGG  181



>dbj|BAJ87356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/130 (96%), Positives = 129/130 (99%), Gaps = 0/130 (0%)
 Frame = +1

Query  190  YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGA  369
            YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGA
Sbjct  4    YGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGA  63

Query  370  LGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMG  549
            LGCVFPEILSKNG+KFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG
Sbjct  64   LGCVFPEILSKNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMG  123

Query  550  FVEGYRVGGG  579
            F+EGYRVGGG
Sbjct  124  FIEGYRVGGG  133



>sp|P12329.1|CB21_MAIZE RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor 
[Zea mays]
 emb|CAA32900.1| unnamed protein product [Zea mays]
 gb|ACF83754.1| unknown [Zea mays]
 gb|ACG25538.1| chlorophyll a-b binding protein 2 [Zea mays]
 gb|ACG28560.1| chlorophyll a-b binding protein 2 [Zea mays]
 tpg|DAA62636.1| TPA: light harvesting chlorophyll a/b binding protein2 [Zea mays]
Length=262

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = +1

Query  118  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  285
            KVGS G  R TMR+TV     +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  19   KVGSFGEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  78

Query  286  AGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  465
            AGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEG
Sbjct  79   AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEG  138

Query  466  GLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  139  GLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGG  176



>ref|XP_011045092.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus 
euphratica]
Length=263

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  309
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  28   GNGRISMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  310  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  489
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  147

Query  490  NLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +LIHAQSILAIWA+QVVLMG VEGYR+ GG
Sbjct  148  SLIHAQSILAIWATQVVLMGAVEGYRIAGG  177



>ref|XP_001754307.1| predicted protein [Physcomitrella patens]
 gb|EDQ80757.1| predicted protein [Physcomitrella patens]
Length=267

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 152/180 (84%), Gaps = 3/180 (2%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRPKYLG  219
            A+  +  +A AGQS LK   +L RKVG+   AR +MR++   +  S  IWYG DRPKYLG
Sbjct  3    AATAMHSTALAGQSLLKPVNELSRKVGNV-EARVSMRKSASKSAASDSIWYGADRPKYLG  61

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGCV PE+L+
Sbjct  62   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCVTPELLA  121

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYRV GG
Sbjct  122  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRVAGG  181



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  309
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  29   GNGRVSMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  310  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  489
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  490  NLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +LIHAQSILAIWA+QVVLMG VEGYR+ GG
Sbjct  149  SLIHAQSILAIWATQVVLMGAVEGYRIAGG  178



>ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK94788.1| unknown [Populus trichocarpa]
 gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  309
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  29   GNGRVSMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  310  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  489
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  490  NLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +LIHAQSILAIWA+QVVLMG VEGYR+ GG
Sbjct  149  SLIHAQSILAIWATQVVLMGAVEGYRIAGG  178



>ref|XP_011045093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=263

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  309
            G+ R +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  28   GNGRISMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  310  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  489
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  147

Query  490  NLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +LIHAQSILAIWA+QVVLMG VEGYR+ GG
Sbjct  148  SLIHAQSILAIWATQVVLMGAVEGYRIAGG  177



>gb|AAA80591.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 150/180 (83%), Gaps = 6/180 (3%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  219
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+LS
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLS  119

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179



>gb|ABK23816.1| unknown [Picea sitchensis]
Length=166

 Score =   266 bits (680),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 139/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  49   SCGIQQSAFAGQSALK-SQTDLLRKVGSSGSARFTMRRTVKSAPQSIWYGPDRPKYLGPF  225
            +  IQ S+ AGQ+ L+  Q +L++KVG+S  AR TMRRTV+SAP+SIWYGPDRPKYLGPF
Sbjct  4    ASAIQSSSLAGQTLLRPHQNELVKKVGAS-QARITMRRTVRSAPESIWYGPDRPKYLGPF  62

Query  226  SEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKN  405
            SEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+K 
Sbjct  63   SEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKT  122

Query  406  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIH  501
            GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIH
Sbjct  123  GVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIH  154



>gb|EPS64140.1| chlorophyll a-b binding protein 21, chloroplastic [Genlisea aurea]
Length=265

 Score =   269 bits (688),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 147/181 (81%), Gaps = 8/181 (4%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKSAP--QSIWYGPDRPKYL  216
            A+  +   +FAGQ+  L   T  L     SG  R +MRRTV   P   S WYGPDR KYL
Sbjct  4    ATMALSSPSFAGQAVKLSPSTPEL-----SGKGRISMRRTVTKTPASSSPWYGPDRVKYL  58

Query  217  GPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL  396
            GPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH+RWAMLGALG +FPE+L
Sbjct  59   GPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLGALGIIFPELL  118

Query  397  SKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGG  576
            +KNGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGYRV G
Sbjct  119  AKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWAVQVILMGAVEGYRVAG  178

Query  577  G  579
            G
Sbjct  179  G  179



>emb|CAA57407.1| light harvesting chlorophyll a /b-binding protein Lhcb1*1 [Picea 
abies]
Length=278

 Score =   270 bits (689),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 156/191 (82%), Gaps = 9/191 (5%)
 Frame = +1

Query  34   SSSMASCGI-QQSAFAG--QSALKSQTDLLRKVGS-SGSARFTMRR-----TVKSAPQSI  186
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNLIHAQSILAI A QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLIHAQSILAILACQVILM  181

Query  547  GFVEGYRVGGG  579
            G +EGYRV GG
Sbjct  182  GAIEGYRVAGG  192



>gb|ACN40027.1| unknown [Picea sitchensis]
Length=278

 Score =   269 bits (688),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 156/191 (82%), Gaps = 9/191 (5%)
 Frame = +1

Query  34   SSSMASCGI-QQSAFAG--QSALKSQTDLLRKVGS-SGSARFTMRR-----TVKSAPQSI  186
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEQPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILACQVILM  181

Query  547  GFVEGYRVGGG  579
            G +EGYRV GG
Sbjct  182  GAIEGYRVAGG  192



>gb|ABK26071.1| unknown [Picea sitchensis]
 gb|ABR17429.1| unknown [Picea sitchensis]
Length=278

 Score =   269 bits (688),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 156/191 (82%), Gaps = 9/191 (5%)
 Frame = +1

Query  34   SSSMASCGI-QQSAFAG--QSALKSQTDLLRKVGS-SGSARFTMRR-----TVKSAPQSI  186
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILACQVILM  181

Query  547  GFVEGYRVGGG  579
            G +EGYRV GG
Sbjct  182  GAIEGYRVAGG  192



>ref|XP_004233096.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233099.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233100.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316910.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316913.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 sp|P07370.1|CB2B_SOLLC RecName: Full=Chlorophyll a-b binding protein 1B, chloroplastic; 
AltName: Full=LHCII type I CAB-1B; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34147.1| chlorophyll a/b-binding protein Cab-1B [Solanum lycopersicum]
Length=265

 Score =   268 bits (686),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 150/180 (83%), Gaps = 6/180 (3%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  219
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179



>ref|NP_001147639.1| chlorophyll a-b binding protein 1, chloroplastic precursor [Zea 
mays]
 gb|ACG28217.1| chlorophyll a-b binding protein 2 [Zea mays]
Length=262

 Score =   268 bits (686),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = +1

Query  118  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  285
            KVGS G  R TMR+TV     +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  19   KVGSFGEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  78

Query  286  AGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  465
            AGLSADP+TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEG
Sbjct  79   AGLSADPKTFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEG  138

Query  466  GLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  139  GLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGG  176



>ref|XP_008229463.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Prunus mume]
Length=215

 Score =   267 bits (682),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 151/191 (79%), Gaps = 21/191 (11%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQ----SI  186
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T   +      S 
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRVTMRKTASKSKNVSSGSP  50

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  547  GFVEGYRVGGG  579
            G VEGYRV GG
Sbjct  171  GAVEGYRVAGG  181



>gb|ABK22330.1| unknown [Picea sitchensis]
Length=278

 Score =   269 bits (687),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 156/191 (82%), Gaps = 9/191 (5%)
 Frame = +1

Query  34   SSSMASCGI-QQSAFAG--QSALKSQTDLLRKVGS-SGSARFTMR-----RTVKSAPQSI  186
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR     ++V ++  S 
Sbjct  2    AATMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMREATGKKSVAASSDSP  61

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILACQVILM  181

Query  547  GFVEGYRVGGG  579
            G +EGYRV GG
Sbjct  182  GAIEGYRVAGG  192



>ref|XP_001765456.1| predicted protein [Physcomitrella patens]
 gb|EDQ69717.1| predicted protein [Physcomitrella patens]
Length=266

 Score =   268 bits (686),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 151/180 (84%), Gaps = 4/180 (2%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVK--SAPQSIWYGPDRPKYLG  219
            A+  +  +  AGQS  +   +L  KVGSS  AR +MR+TV   S   SIWYG DRPK+LG
Sbjct  3    AATAMHSTTLAGQSLFRFN-ELSSKVGSS-QARVSMRKTVSKSSGSDSIWYGADRPKWLG  60

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS +TPSYL GEF GDYGWDTAGLS+DPETFARNRELEVIH+RWAMLGALGC+ PE+L+
Sbjct  61   PFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNRELEVIHARWAMLGALGCLTPELLA  120

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            K+GVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWASQV+LMG VEGYRV GG
Sbjct  121  KSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILMGAVEGYRVAGG  180



>ref|XP_006368026.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   268 bits (686),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 150/180 (83%), Gaps = 6/180 (3%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  219
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVSKSAPSSSPWYGPDRVKYLG  59

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   268 bits (686),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 149/181 (82%), Gaps = 9/181 (5%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSAL--KSQTDLLRKVGSSGSARFTMRRTVKSAPQ-SIWYGPDRPKYL  216
            A+  +   AFAG++     S  +L+      G+ R +MR+T K     S WYGPDR KYL
Sbjct  4    ATMALSSPAFAGKAVKLSPSSPELM------GNGRVSMRKTTKPVSSGSPWYGPDRVKYL  57

Query  217  GPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEIL  396
            GPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L
Sbjct  58   GPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELL  117

Query  397  SKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGG  576
            S+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ G
Sbjct  118  SRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAG  177

Query  577  G  579
            G
Sbjct  178  G  178



>gb|ABK23849.1| unknown [Picea sitchensis]
Length=278

 Score =   269 bits (687),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 156/191 (82%), Gaps = 9/191 (5%)
 Frame = +1

Query  34   SSSMASCGI-QQSAFAG--QSALKSQTDLLRKVGS-SGSARFTMRR-----TVKSAPQSI  186
            +++MASCGI  + AF G   S++K Q + L  VG   G AR TMR+     +V ++  S 
Sbjct  2    AAAMASCGIGSRCAFTGGQLSSVKPQNNQLLGVGGGHGEARLTMRKATGKKSVAASSDSP  61

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR  YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHGRWAMLG  121

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLG+PNL+HAQSILAI A QV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAILACQVILM  181

Query  547  GFVEGYRVGGG  579
            G +EGYRV GG
Sbjct  182  GAIEGYRVAGG  192



>ref|XP_006365572.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
 gb|AAA80589.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   268 bits (686),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 150/180 (83%), Gaps = 6/180 (3%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  219
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179



>ref|NP_565786.1| photosystem II light harvesting complex protein B1B2 [Arabidopsis 
thaliana]
 gb|AAK49602.1|AF372886_1 At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAL16165.1|AF428397_1 At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAL31882.1|AF419548_1 At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAL31919.1|AF419587_1 At2g34420/T31E10.24 [Arabidopsis thaliana]
 emb|CAA45790.1| photosystem II type I chlorophyll a /b binding protein [Arabidopsis 
thaliana]
 gb|AAC26710.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 gb|AAK62616.1| At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAK76480.1| putative photosystem II type I chlorophyll a/b binding protein 
[Arabidopsis thaliana]
 gb|AAL38301.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 gb|AAL84985.1| At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAL84994.1| At2g34420/T31E10.24 [Arabidopsis thaliana]
 gb|AAM10149.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 gb|AAM14954.1| photosystem II type I chlorophyll a b binding protein [Arabidopsis 
thaliana]
 gb|AAN13114.1| putative photosystem II type I chlorophyll a/b binding protein 
[Arabidopsis thaliana]
 dbj|BAF01472.1| photosystem II type I chlorophyll a/b binding protein [Arabidopsis 
thaliana]
 gb|AEC08972.1| photosystem II light harvesting complex protein B1B2 [Arabidopsis 
thaliana]
Length=265

 Score =   268 bits (686),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 152/184 (83%), Gaps = 12/184 (7%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV---KSAPQSIWYGPDR  204
            SS+MA   +   AFAG++   + +D+L      GS R TMR+TV   K    S WYG DR
Sbjct  3    SSTMA---LSSPAFAGKAVKPAASDVL------GSGRVTMRKTVAKPKGPSGSPWYGSDR  53

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF
Sbjct  54   VKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  113

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGY
Sbjct  114  PELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGY  173

Query  565  RVGG  576
            RV G
Sbjct  174  RVAG  177



>ref|XP_004957570.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +1

Query  118  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  285
            KVGS G  R TMR+T      +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  18   KVGSFGEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  77

Query  286  AGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  465
            AGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEG
Sbjct  78   AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEG  137

Query  466  GLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  138  GLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGG  175



>ref|XP_002460622.1| hypothetical protein SORBIDRAFT_02g032040 [Sorghum bicolor]
 gb|EER97143.1| hypothetical protein SORBIDRAFT_02g032040 [Sorghum bicolor]
Length=262

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +1

Query  118  KVGSSGSARFTMRRTVK----SAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDT  285
            KVGS G  R TMR+T      +A  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDT
Sbjct  19   KVGSFGEGRITMRKTAAKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDT  78

Query  286  AGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEG  465
            AGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEG
Sbjct  79   AGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEG  138

Query  466  GLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GLDYLGNP+LIHAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  139  GLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGG  176



>ref|XP_010316911.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 152/182 (84%), Gaps = 10/182 (5%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSA--LKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKY  213
            A+  +   +FAGQ+   L S +++      +G+ R TMR+ V KSAP S  WYGPDR KY
Sbjct  4    ATMALSSPSFAGQAVKLLPSASEI------TGNGRITMRKAVAKSAPSSSPWYGPDRVKY  57

Query  214  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI  393
            LGPFS ++PSYL GEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+
Sbjct  58   LGPFSGESPSYLNGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL  117

Query  394  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVG  573
            L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ 
Sbjct  118  LARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIA  177

Query  574  GG  579
            GG
Sbjct  178  GG  179



>ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Fragaria 
vesca subsp. vesca]
Length=263

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 152/184 (83%), Gaps = 11/184 (6%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRP  207
            +S+MA   +    FAG++   + T++       G+ R +MR+TV  A  S   WYGPDR 
Sbjct  3    ASTMA---LSSPTFAGKAVQLAPTEVF------GTGRISMRKTVGKAVSSGSPWYGPDRV  53

Query  208  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  387
            KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFP
Sbjct  54   KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFP  113

Query  388  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR  567
            E+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR
Sbjct  114  ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYR  173

Query  568  VGGG  579
            + GG
Sbjct  174  IAGG  177



>ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004169747.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46826.1| hypothetical protein Csa_6G139750 [Cucumis sativus]
Length=267

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 152/188 (81%), Gaps = 15/188 (8%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQT--DLLRKVGSSGSARFTMRRTV-KSAPQS---IWYG  195
            +SSMA   +   +FAGQ+   S T  DLL      G  R TMR+T  K  P S    WYG
Sbjct  3    ASSMA---LSSPSFAGQAVKLSPTASDLL------GEGRITMRKTAGKPKPVSSGSPWYG  53

Query  196  PDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALG  375
            PDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALG
Sbjct  54   PDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALG  113

Query  376  CVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFV  555
            CVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG V
Sbjct  114  CVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAV  173

Query  556  EGYRVGGG  579
            EGYR+ GG
Sbjct  174  EGYRIAGG  181



>ref|XP_006365573.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006365574.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=265

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 150/180 (83%), Gaps = 6/180 (3%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  219
            A+  +   +FAGQ+   S +        +G+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEITGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179



>gb|AAU89263.1| chloroplast light harvesting chlorophyll a/b binding protein, 
partial [Pinus longaeva]
Length=253

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 149/179 (83%), Gaps = 9/179 (5%)
 Frame = +1

Query  70   AFAGQ--SALKSQTDLLRKVGS--SGSARFTMRRT-----VKSAPQSIWYGPDRPKYLGP  222
            AFAG   S+LK  T+ L  VG+   G +R TMR++     V SA  S WYGPDR  YLGP
Sbjct  4    AFAGGQISSLKPHTNQLLGVGAGVHGESRVTMRKSATKKSVVSASPSPWYGPDRVLYLGP  63

Query  223  FSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSK  402
            FS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++
Sbjct  64   FSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR  123

Query  403  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGYR+ GG
Sbjct  124  NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGYRIAGG  182



>gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   268 bits (684),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 154/185 (83%), Gaps = 11/185 (6%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDR  204
            +S+MA   +   +FAGQ+  L   T  +     +G+ R TMR+ V KSAP S  WYGPDR
Sbjct  3    ASTMA---LSSPSFAGQAVKLSPSTSEI-----TGNGRITMRKAVAKSAPSSSPWYGPDR  54

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
             KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  55   VKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  114

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGY
Sbjct  115  PELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGY  174

Query  565  RVGGG  579
            R+ GG
Sbjct  175  RIAGG  179



>ref|XP_006365560.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 150/180 (83%), Gaps = 6/180 (3%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  219
            A+  +   +FAGQ+   S +        +G+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEITGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179



>ref|XP_006295385.1| hypothetical protein CARUB_v10024479mg [Capsella rubella]
 ref|XP_010516588.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Camelina sativa]
 gb|EOA28283.1| hypothetical protein CARUB_v10024479mg [Capsella rubella]
Length=265

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 152/184 (83%), Gaps = 12/184 (7%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV---KSAPQSIWYGPDR  204
            SS+MA   +   AFAG++   + +D+L      G+ R TMR+TV   K    S WYG DR
Sbjct  3    SSTMA---LSSPAFAGKAVKPAASDVL------GTGRVTMRKTVAKPKGPSGSPWYGSDR  53

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF
Sbjct  54   VKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  113

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGY
Sbjct  114  PELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGY  173

Query  565  RVGG  576
            RV G
Sbjct  174  RVAG  177



>ref|XP_002515206.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47190.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=267

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 149/175 (85%), Gaps = 5/175 (3%)
 Frame = +1

Query  67   SAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTV---KSAPQSIWYGPDRPKYLGPFSEQ  234
            S F G++  L +QT+L   V SS + R TMR+T     ++  S WYGPDR KYLGPFS +
Sbjct  8    STFTGKAVPLSAQTELPATVRSS-NGRVTMRKTAGKPAASSGSPWYGPDRVKYLGPFSGE  66

Query  235  TPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVK  414
             PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVK
Sbjct  67   PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVK  126

Query  415  FGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            FGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA+QVVLMG VEGYR+ GG
Sbjct  127  FGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLMGAVEGYRIAGG  181



>gb|AAT08668.1| chloroplast chlorophyll A-B binding protein 40 [Hyacinthus orientalis]
Length=237

 Score =   266 bits (680),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 6/157 (4%)
 Frame = +1

Query  124  GSSGSARFTMRRTVKSAPQSI-----WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTA  288
            G SG  RFTMR+TV + P+++     WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTA
Sbjct  11   GVSGDGRFTMRKTV-AKPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTA  69

Query  289  GLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGG  468
            GLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGG
Sbjct  70   GLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGG  129

Query  469  LDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            LDYLGNP+L+HAQSILAIWA+QVVLMG VEGYRV GG
Sbjct  130  LDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRVAGG  166



>ref|XP_010316912.1| PREDICTED: chlorophyll a-b binding protein 1A, chloroplastic 
[Solanum lycopersicum]
Length=265

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 149/176 (85%), Gaps = 6/176 (3%)
 Frame = +1

Query  58   IQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLGPFSE  231
            +   +FAGQ+   S +       +SG+ R TMR+ V KSAP S  WYGPDR KYLGPFS 
Sbjct  8    LSSPSFAGQAVKLSPS----ASENSGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSG  63

Query  232  QTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGV  411
            ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGV
Sbjct  64   ESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGV  123

Query  412  KFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            KFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  124  KFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   267 bits (683),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 154/192 (80%), Gaps = 23/192 (12%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQSI----  186
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T  S P+++    
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRVTMRKTA-SKPKNVSSGS  49

Query  187  -WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAML  363
             WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAML
Sbjct  50   PWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAML  109

Query  364  GALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVL  543
            GALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVL
Sbjct  110  GALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVL  169

Query  544  MGFVEGYRVGGG  579
            MG VEGYR+ GG
Sbjct  170  MGAVEGYRIAGG  181



>ref|XP_010509756.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Camelina sativa]
Length=265

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 152/184 (83%), Gaps = 12/184 (7%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV---KSAPQSIWYGPDR  204
            SS+MA   +   AFAG++   + +D+L      G+ R TMR+TV   K    S WYG DR
Sbjct  3    SSTMA---LSSPAFAGKAVKPAVSDVL------GTGRVTMRKTVAKPKGPSGSPWYGSDR  53

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF
Sbjct  54   VKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  113

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA+QV+LMG VEGY
Sbjct  114  PELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGY  173

Query  565  RVGG  576
            RV G
Sbjct  174  RVAG  177



>ref|XP_010052095.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
Length=264

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 151/185 (82%), Gaps = 12/185 (6%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQT--DLLRKVGSSGSARFTMRRTVKSAPQ-SIWYGPDR  204
            +S+MA   +   +FAG++   S    DLL      G+ R TMR+ VK A   S WYGPDR
Sbjct  3    ASTMA---LSSPSFAGKAVKLSPATPDLL------GNGRVTMRKAVKPASSGSPWYGPDR  53

Query  205  PKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVF  384
             KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVF
Sbjct  54   AKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVF  113

Query  385  PEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGY  564
            PE+L++NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGY
Sbjct  114  PELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILMGAVEGY  173

Query  565  RVGGG  579
            RV GG
Sbjct  174  RVAGG  178



>prf||1204205B protein 1B,chlorophyll binding
Length=265

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 150/180 (83%), Gaps = 6/180 (3%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRPKYLG  219
            A+  +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR KYLG
Sbjct  4    ATMALSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLG  59

Query  220  PFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILS  399
            PFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L+
Sbjct  60   PFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA  119

Query  400  KNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  120  RNGVKFGEAVWFKAGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179



>ref|XP_006844081.1| hypothetical protein AMTR_s00006p00251360 [Amborella trichopoda]
 gb|ERN05756.1| hypothetical protein AMTR_s00006p00251360 [Amborella trichopoda]
Length=266

 Score =   267 bits (682),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 150/182 (82%), Gaps = 5/182 (3%)
 Frame = +1

Query  43   MASCGIQQSAFAGQSA-LKSQTDLLRKVGSSGSARFTMRRTVKSAPQS--IWYGPDRPKY  213
            MA+  +   +FAG++  + ++++    V   G  R +MR++   AP S   WYGPDR KY
Sbjct  1    MATMSLSSPSFAGKAVPVATRSEFGSTV--RGDGRVSMRKSASRAPVSGSPWYGPDRVKY  58

Query  214  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI  393
            LGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+
Sbjct  59   LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL  118

Query  394  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVG  573
            LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA+QV+LM  VEGYRV 
Sbjct  119  LSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVILMSAVEGYRVA  178

Query  574  GG  579
            GG
Sbjct  179  GG  180



>ref|XP_004233101.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 2/152 (1%)
 Frame = +1

Query  130  SGSARFTMRRTV-KSAPQS-IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSAD  303
            SG+ R TMR+ V KSAP S  WYGPDR KYLGPFS ++PSYLTGEFPGDYGWDTAGLSAD
Sbjct  28   SGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSAD  87

Query  304  PETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLG  483
            PETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLG
Sbjct  88   PETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLG  147

Query  484  NPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            NP+L+HAQSILAIWA QVVLMG VEGYR+ GG
Sbjct  148  NPSLVHAQSILAIWACQVVLMGAVEGYRIAGG  179



>ref|XP_007217260.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
 gb|AAA50310.1| light-harvesting chlorophyll a/b-binding protein [Prunus persica]
 gb|EMJ18459.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
Length=267

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 151/191 (79%), Gaps = 21/191 (11%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQ----SI  186
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T   +      S 
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRITMRKTASKSKNVSSGSP  50

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  547  GFVEGYRVGGG  579
            G VEGYRV GG
Sbjct  171  GAVEGYRVAGG  181



>ref|XP_008358195.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 151/183 (83%), Gaps = 8/183 (4%)
 Frame = +1

Query  43   MASCGIQQSAFAGQS-ALKSQTDLLRKVGSSGSARFTMRRTVKS---APQSIWYGPDRPK  210
            MA+  +  S F G++  L +QT+        G+ R +MR+T K    +  S WYGPDR K
Sbjct  1    MATMALS-SPFTGKAIPLNTQTEF---SAVQGNGRVSMRKTAKKPAVSSGSPWYGPDRVK  56

Query  211  YLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPE  390
            YLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE
Sbjct  57   YLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE  116

Query  391  ILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRV  570
            +LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+
Sbjct  117  LLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRI  176

Query  571  GGG  579
             GG
Sbjct  177  AGG  179



>gb|ABW70800.1| chloroplast light harvesting chlorophyll a/b binding protein 
[Populus euphratica]
Length=263

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  309
            G+   +MR+T K  P  S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  28   GNGCISMRKTTKPVPSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  87

Query  310  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  489
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  88   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  147

Query  490  NLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +LIHAQSILAIWA+QVVLMG VEGYR+ GG
Sbjct  148  SLIHAQSILAIWATQVVLMGAVEGYRIAGG  177



>ref|XP_008364191.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_009360860.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Pyrus 
x bretschneideri]
Length=264

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 149/182 (82%), Gaps = 10/182 (5%)
 Frame = +1

Query  46   ASCGIQQSAFAGQSALKS--QTDLLRKVGSSGSARFTMRRTV--KSAPQSIWYGPDRPKY  213
            AS  +    FAG++   S   T+L       G+ R +MR+T   K +  S WYGPDR KY
Sbjct  3    ASMALSSPTFAGKAVQLSPGATELF------GNGRVSMRKTATKKVSSGSPWYGPDRVKY  56

Query  214  LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEI  393
            LGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+
Sbjct  57   LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEL  116

Query  394  LSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVG  573
            LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QVVLMG VEGYR+ 
Sbjct  117  LSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLMGAVEGYRIA  176

Query  574  GG  579
            GG
Sbjct  177  GG  178



>ref|XP_008229429.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   266 bits (681),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 151/191 (79%), Gaps = 21/191 (11%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSS-----GSARFTMRRTVKSAPQ----SI  186
            SS+MA   +   + AGQ+          K+GSS     G  R TMR+T   +      S 
Sbjct  3    SSTMA---LSSPSLAGQAV---------KLGSSVSNIVGEGRVTMRKTASKSKNVSSGSP  50

Query  187  WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  366
            WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  367  ALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLM  546
            ALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA+QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  547  GFVEGYRVGGG  579
            G VEGYRV GG
Sbjct  171  GAVEGYRVAGG  181



>gb|AHB24929.1| chloroplast light-harvesting complex II chlorophyll a/b binding 
protein 1 [Sedum alfredii]
Length=267

 Score =   266 bits (681),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 4/153 (3%)
 Frame = +1

Query  133  GSARFTMRRTV-KSAP---QSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSA  300
            G+++ TMR+T  KS P    S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSA
Sbjct  29   GNSKVTMRKTAAKSKPTVSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSA  88

Query  301  DPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYL  480
            DPETFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYL
Sbjct  89   DPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYL  148

Query  481  GNPNLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            GNP+L+HAQSILAIWA+QV+LMG VEGYR+ GG
Sbjct  149  GNPSLVHAQSILAIWATQVILMGAVEGYRIAGG  181



>gb|AAA80594.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   266 bits (680),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 152/184 (83%), Gaps = 9/184 (5%)
 Frame = +1

Query  34   SSSMASCGIQQSAFAGQSALKSQTDLLRKVGSSGSARFTMRRTV-KSAPQS-IWYGPDRP  207
            +S+MA   +   +FAGQ+   S +        SG+ R TMR+ V KSAP S  WYGPDR 
Sbjct  3    ASTMA---LSSPSFAGQAVKLSPS----ASEISGNGRITMRKAVAKSAPSSSPWYGPDRV  55

Query  208  KYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFP  387
            KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFP
Sbjct  56   KYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFP  115

Query  388  EILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYR  567
            E+L++NGVKFGE VWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QVVLMG VEGYR
Sbjct  116  ELLARNGVKFGEVVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYR  175

Query  568  VGGG  579
            + GG
Sbjct  176  IAGG  179



>ref|XP_011011531.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
 ref|XP_011016419.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=264

 Score =   266 bits (680),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 1/150 (1%)
 Frame = +1

Query  133  GSARFTMRRTVKSAPQ-SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPE  309
            G+ R +MR+T K     S WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPE
Sbjct  29   GNGRVSMRKTTKPVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE  88

Query  310  TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  489
            TFA+NRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAGAQIFSEGGLDYLGNP
Sbjct  89   TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP  148

Query  490  NLIHAQSILAIWASQVVLMGFVEGYRVGGG  579
            +LIHAQSILAIWA+QVVLMG VEGYR+ GG
Sbjct  149  SLIHAQSILAIWATQVVLMGAVEGYRIAGG  178



Lambda      K        H        a         alpha
   0.317    0.134    0.409    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220