BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN045P11

Length=630
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006353173.1|  PREDICTED: uncharacterized protein At1g04910...    289   1e-91   Solanum tuberosum [potatoes]
ref|XP_006353172.1|  PREDICTED: uncharacterized protein At1g04910...    289   2e-91   
ref|XP_010312649.1|  PREDICTED: uncharacterized protein At1g04910...    286   5e-91   Solanum lycopersicum
gb|AAK84479.1|  putative auxin growth promotor protein                  286   5e-91   Solanum lycopersicum
ref|XP_010312647.1|  PREDICTED: uncharacterized protein At1g04910...    287   9e-91   
ref|XP_009797993.1|  PREDICTED: uncharacterized protein At1g04910...    287   1e-90   Nicotiana sylvestris
ref|XP_009797995.1|  PREDICTED: uncharacterized protein At1g04910...    286   1e-90   Nicotiana sylvestris
ref|XP_010312648.1|  PREDICTED: uncharacterized protein At1g04910...    286   1e-90   
ref|XP_011097478.1|  PREDICTED: uncharacterized protein At1g04910...    286   2e-90   Sesamum indicum [beniseed]
gb|KDP29763.1|  hypothetical protein JCGZ_18698                         285   4e-90   Jatropha curcas
ref|XP_007207425.1|  hypothetical protein PRUPE_ppa004921mg             280   2e-88   
ref|XP_003534239.1|  PREDICTED: uncharacterized protein At1g04910...    281   2e-88   Glycine max [soybeans]
ref|XP_006587571.1|  PREDICTED: uncharacterized protein At1g04910...    281   2e-88   Glycine max [soybeans]
emb|CDP01562.1|  unnamed protein product                                281   2e-88   Coffea canephora [robusta coffee]
ref|XP_002268599.2|  PREDICTED: uncharacterized protein At1g04910       281   2e-88   Vitis vinifera
ref|XP_002310868.1|  hypothetical protein POPTR_0007s14280g             281   2e-88   Populus trichocarpa [western balsam poplar]
ref|XP_007207426.1|  hypothetical protein PRUPE_ppa004921mg             280   2e-88   
ref|XP_011021848.1|  PREDICTED: uncharacterized protein At1g04910       280   3e-88   Populus euphratica
ref|XP_009350347.1|  PREDICTED: uncharacterized protein At1g04910...    280   7e-88   Pyrus x bretschneideri [bai li]
ref|XP_009350346.1|  PREDICTED: uncharacterized protein At1g04910...    280   9e-88   Pyrus x bretschneideri [bai li]
ref|XP_009623754.1|  PREDICTED: uncharacterized protein At1g04910...    279   9e-88   Nicotiana tomentosiformis
ref|XP_009623753.1|  PREDICTED: uncharacterized protein At1g04910...    279   1e-87   
gb|KCW54611.1|  hypothetical protein EUGRSUZ_I00557                     278   1e-87   Eucalyptus grandis [rose gum]
ref|XP_010027954.1|  PREDICTED: uncharacterized protein At1g04910       278   2e-87   Eucalyptus grandis [rose gum]
ref|XP_009364252.1|  PREDICTED: uncharacterized protein At1g04910...    278   2e-87   Pyrus x bretschneideri [bai li]
ref|XP_009364251.1|  PREDICTED: uncharacterized protein At1g04910...    278   3e-87   Pyrus x bretschneideri [bai li]
ref|XP_008236140.1|  PREDICTED: uncharacterized protein At1g04910...    278   3e-87   Prunus mume [ume]
ref|XP_008385667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    278   4e-87   Malus domestica [apple tree]
gb|KHN14510.1|  DUF246 domain-containing protein                        278   4e-87   Glycine soja [wild soybean]
ref|XP_006573005.1|  PREDICTED: uncharacterized protein At1g04910...    278   4e-87   Glycine max [soybeans]
ref|XP_008236135.1|  PREDICTED: uncharacterized protein At1g04910...    278   4e-87   Prunus mume [ume]
ref|XP_009783617.1|  PREDICTED: uncharacterized protein At1g04910...    278   4e-87   Nicotiana sylvestris
ref|XP_003517397.1|  PREDICTED: uncharacterized protein At1g04910...    278   4e-87   Glycine max [soybeans]
ref|XP_008347790.1|  PREDICTED: uncharacterized protein At1g04910...    278   5e-87   
ref|XP_008347789.1|  PREDICTED: uncharacterized protein At1g04910...    278   5e-87   
gb|KJB44061.1|  hypothetical protein B456_007G232700                    274   6e-87   Gossypium raimondii
gb|KJB18177.1|  hypothetical protein B456_003G038000                    273   6e-87   Gossypium raimondii
gb|KHG05570.1|  hypothetical protein F383_31127                         277   1e-86   Gossypium arboreum [tree cotton]
gb|KJB18178.1|  hypothetical protein B456_003G038000                    273   1e-86   Gossypium raimondii
ref|XP_011099984.1|  PREDICTED: uncharacterized protein At1g04910...    276   2e-86   Sesamum indicum [beniseed]
ref|XP_011099981.1|  PREDICTED: uncharacterized protein At1g04910...    276   2e-86   Sesamum indicum [beniseed]
ref|XP_007158370.1|  hypothetical protein PHAVU_002G147300g             276   2e-86   Phaseolus vulgaris [French bean]
ref|XP_002533683.1|  conserved hypothetical protein                     276   2e-86   Ricinus communis
gb|AGV54211.1|  O-fucosyltransferase family protein                     275   4e-86   Phaseolus vulgaris [French bean]
gb|KHG27420.1|  hypothetical protein F383_15612                         274   6e-86   Gossypium arboreum [tree cotton]
gb|KDO60569.1|  hypothetical protein CISIN_1g009234mg                   273   8e-86   Citrus sinensis [apfelsine]
gb|KCW54609.1|  hypothetical protein EUGRSUZ_I00557                     274   1e-85   Eucalyptus grandis [rose gum]
gb|KJB44059.1|  hypothetical protein B456_007G232700                    273   4e-85   Gossypium raimondii
gb|KJB18179.1|  hypothetical protein B456_003G038000                    273   4e-85   Gossypium raimondii
gb|KJB18182.1|  hypothetical protein B456_003G038000                    273   4e-85   Gossypium raimondii
ref|XP_007047791.1|  O-fucosyltransferase family protein isoform 1      273   5e-85   
ref|XP_006426272.1|  hypothetical protein CICLE_v10025329mg             273   5e-85   Citrus clementina [clementine]
ref|XP_006466306.1|  PREDICTED: uncharacterized protein At1g04910...    273   6e-85   Citrus sinensis [apfelsine]
ref|XP_010523310.1|  PREDICTED: uncharacterized protein At1g04910...    270   1e-84   
ref|XP_010113429.1|  hypothetical protein L484_026763                   272   1e-84   
ref|XP_004288516.2|  PREDICTED: uncharacterized protein At1g04910       271   3e-84   Fragaria vesca subsp. vesca
gb|EYU39303.1|  hypothetical protein MIMGU_mgv1a004838mg                270   3e-84   Erythranthe guttata [common monkey flower]
gb|EYU30936.1|  hypothetical protein MIMGU_mgv1a004530mg                270   3e-84   Erythranthe guttata [common monkey flower]
gb|EYU30935.1|  hypothetical protein MIMGU_mgv1a004530mg                270   4e-84   Erythranthe guttata [common monkey flower]
ref|XP_006394027.1|  hypothetical protein EUTSA_v10004041mg             270   5e-84   Eutrema salsugineum [saltwater cress]
ref|XP_006394028.1|  hypothetical protein EUTSA_v10004041mg             270   5e-84   
ref|XP_009130513.1|  PREDICTED: uncharacterized protein At1g04910...    270   5e-84   Brassica rapa
ref|XP_009130514.1|  PREDICTED: uncharacterized protein At1g04910...    270   5e-84   Brassica rapa
emb|CDY37829.1|  BnaAnng04900D                                          269   6e-84   Brassica napus [oilseed rape]
ref|XP_008440542.1|  PREDICTED: uncharacterized protein At1g04910       270   6e-84   Cucumis melo [Oriental melon]
ref|XP_010523312.1|  PREDICTED: uncharacterized protein At1g04910...    269   8e-84   Tarenaya hassleriana [spider flower]
emb|CDY33958.1|  BnaC02g43790D                                          269   8e-84   Brassica napus [oilseed rape]
ref|XP_006280335.1|  hypothetical protein CARUB_v10026260mg             269   1e-83   
ref|XP_010444520.1|  PREDICTED: uncharacterized protein At1g04910...    268   1e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010547595.1|  PREDICTED: uncharacterized protein At1g04910...    269   1e-83   Tarenaya hassleriana [spider flower]
ref|XP_010523308.1|  PREDICTED: uncharacterized protein At1g04910...    269   1e-83   Tarenaya hassleriana [spider flower]
ref|XP_002864958.1|  hypothetical protein ARALYDRAFT_496780             268   2e-83   
ref|XP_010484355.1|  PREDICTED: uncharacterized protein At1g04910...    268   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010463027.1|  PREDICTED: uncharacterized protein At1g04910...    268   2e-83   Camelina sativa [gold-of-pleasure]
ref|NP_201350.2|  O-fucosyltransferase family protein                   268   2e-83   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11569.1|  unnamed protein product                                268   2e-83   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13166.1|  unknown protein                                         268   2e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150636.1|  PREDICTED: uncharacterized protein At1g04910       267   5e-83   Brassica rapa
emb|CDY14569.1|  BnaC03g48900D                                          267   5e-83   Brassica napus [oilseed rape]
ref|XP_004509777.1|  PREDICTED: uncharacterized protein At1g04910...    266   1e-82   Cicer arietinum [garbanzo]
gb|AFK40388.1|  unknown                                                 266   1e-82   Lotus japonicus
ref|XP_004143441.1|  PREDICTED: DUF246 domain-containing protein ...    265   3e-82   Cucumis sativus [cucumbers]
dbj|BAE71212.1|  hypothetical protein                                   261   5e-82   Trifolium pratense [peavine clover]
ref|XP_003613050.1|  DUF246 domain-containing protein                   257   7e-82   
ref|XP_010254530.1|  PREDICTED: uncharacterized protein At1g04910...    265   7e-82   Nelumbo nucifera [Indian lotus]
ref|XP_010519195.1|  PREDICTED: uncharacterized protein At1g04910...    262   5e-81   Tarenaya hassleriana [spider flower]
gb|EPS72903.1|  hypothetical protein M569_01846                         259   4e-80   Genlisea aurea
ref|XP_010680342.1|  PREDICTED: uncharacterized protein At1g04910       259   5e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010107675.1|  hypothetical protein L484_007693                   259   7e-80   
ref|XP_003613049.1|  DUF246 domain-containing protein                   258   2e-79   Medicago truncatula
gb|ABJ96379.1|  expressed protein                                       257   3e-79   Prunus persica
ref|XP_007222858.1|  hypothetical protein PRUPE_ppa004255mg             257   3e-79   Prunus persica
gb|KCW68511.1|  hypothetical protein EUGRSUZ_F02148                     256   4e-79   Eucalyptus grandis [rose gum]
ref|XP_010692399.1|  PREDICTED: uncharacterized protein At1g04910       256   4e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010061545.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    256   7e-79   Eucalyptus grandis [rose gum]
ref|XP_006852943.1|  hypothetical protein AMTR_s00033p00238220          253   3e-78   
ref|XP_008219267.1|  PREDICTED: uncharacterized protein At1g04910...    255   3e-78   Prunus mume [ume]
emb|CAN78778.1|  hypothetical protein VITISV_029752                     254   3e-78   Vitis vinifera
ref|XP_004237994.1|  PREDICTED: uncharacterized protein At1g04910       254   4e-78   Solanum lycopersicum
ref|XP_006338062.1|  PREDICTED: uncharacterized protein At1g04910...    254   4e-78   Solanum tuberosum [potatoes]
ref|XP_002283844.1|  PREDICTED: uncharacterized protein At1g04910...    254   4e-78   Vitis vinifera
ref|XP_010937178.1|  PREDICTED: uncharacterized protein At1g04910...    255   5e-78   Elaeis guineensis
ref|XP_009401410.1|  PREDICTED: uncharacterized protein At1g04910...    253   9e-78   
ref|XP_010523344.1|  PREDICTED: uncharacterized protein At1g04910       253   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_010277497.1|  PREDICTED: uncharacterized protein At1g04910...    253   1e-77   Nelumbo nucifera [Indian lotus]
emb|CDP11502.1|  unnamed protein product                                253   2e-77   Coffea canephora [robusta coffee]
ref|XP_007018221.1|  O-fucosyltransferase family protein                253   2e-77   
ref|XP_004301363.1|  PREDICTED: uncharacterized protein At1g04910       252   3e-77   Fragaria vesca subsp. vesca
ref|XP_010939815.1|  PREDICTED: uncharacterized protein At1g04910...    253   6e-77   
ref|XP_009624657.1|  PREDICTED: uncharacterized protein At1g04910...    251   8e-77   Nicotiana tomentosiformis
ref|XP_009785662.1|  PREDICTED: uncharacterized protein At1g04910...    250   2e-76   Nicotiana sylvestris
gb|EPS73888.1|  hypothetical protein M569_00867                         249   4e-76   Genlisea aurea
gb|KHN09000.1|  DUF246 domain-containing protein                        249   6e-76   Glycine soja [wild soybean]
ref|XP_009376221.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    248   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_008368388.1|  PREDICTED: uncharacterized protein At1g04910...    248   1e-75   
emb|CAA23010.1|  PsRT17-1 like protein                                  245   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867661.1|  predicted protein                                  248   2e-75   Arabidopsis lyrata subsp. lyrata
gb|KJB58883.1|  hypothetical protein B456_009G229500                    246   3e-75   Gossypium raimondii
gb|KFK28724.1|  hypothetical protein AALP_AA7G039000                    247   3e-75   Arabis alpina [alpine rockcress]
ref|XP_004501643.1|  PREDICTED: uncharacterized protein At1g04910...    246   4e-75   Cicer arietinum [garbanzo]
ref|XP_008651492.1|  PREDICTED: LOC100283829 isoform X1                 245   4e-75   Zea mays [maize]
ref|XP_003526543.1|  PREDICTED: uncharacterized protein At1g04910...    246   4e-75   Glycine max [soybeans]
ref|XP_006661225.1|  PREDICTED: uncharacterized protein At1g04910...    246   5e-75   
gb|KJB58881.1|  hypothetical protein B456_009G229500                    246   5e-75   Gossypium raimondii
ref|XP_002514041.1|  conserved hypothetical protein                     246   6e-75   Ricinus communis
gb|AGV54860.1|  O-fucosyltransferase family protein                     246   7e-75   Phaseolus vulgaris [French bean]
ref|XP_009138156.1|  PREDICTED: uncharacterized protein At1g04910       246   8e-75   Brassica rapa
ref|XP_006472463.1|  PREDICTED: uncharacterized protein At1g04910...    246   1e-74   
ref|XP_006472461.1|  PREDICTED: uncharacterized protein At1g04910...    246   1e-74   Citrus sinensis [apfelsine]
ref|XP_003602912.1|  PsRT17-1 like protein                              246   1e-74   Medicago truncatula
ref|XP_011016934.1|  PREDICTED: uncharacterized protein At1g04910...    245   1e-74   Populus euphratica
ref|XP_011016933.1|  PREDICTED: uncharacterized protein At1g04910...    245   1e-74   Populus euphratica
ref|NP_001063155.1|  Os09g0412200                                       245   1e-74   
ref|XP_004956798.1|  PREDICTED: uncharacterized protein At1g04910...    245   2e-74   Setaria italica
ref|XP_003523785.1|  PREDICTED: uncharacterized protein At1g04910...    245   2e-74   Glycine max [soybeans]
ref|NP_194184.2|  O-fucosyltransferase family protein                   245   2e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KHN08263.1|  DUF246 domain-containing protein                        244   2e-74   Glycine soja [wild soybean]
ref|XP_010439017.1|  PREDICTED: uncharacterized protein At1g04910...    244   3e-74   
ref|XP_002301095.2|  hypothetical protein POPTR_0002s10600g             244   3e-74   
ref|NP_001150199.1|  LOC100283829                                       244   3e-74   Zea mays [maize]
ref|XP_010448552.1|  PREDICTED: uncharacterized protein At1g04910...    244   4e-74   Camelina sativa [gold-of-pleasure]
emb|CDY03446.1|  BnaC01g16360D                                          246   4e-74   
ref|XP_010433755.1|  PREDICTED: uncharacterized protein At1g04910...    244   5e-74   Camelina sativa [gold-of-pleasure]
gb|KDP41479.1|  hypothetical protein JCGZ_15886                         244   6e-74   Jatropha curcas
ref|XP_006433826.1|  hypothetical protein CICLE_v10000880mg             243   1e-73   
ref|XP_006433827.1|  hypothetical protein CICLE_v10000880mg             243   1e-73   Citrus clementina [clementine]
emb|CDY34289.1|  BnaA01g13920D                                          248   3e-73   Brassica napus [oilseed rape]
ref|XP_002462371.1|  hypothetical protein SORBIDRAFT_02g024540          241   5e-73   Sorghum bicolor [broomcorn]
ref|XP_006285210.1|  hypothetical protein CARUB_v10006569mg             241   5e-73   Capsella rubella
ref|XP_008444924.1|  PREDICTED: uncharacterized protein At1g04910...    241   8e-73   Cucumis melo [Oriental melon]
gb|EMT16885.1|  hypothetical protein F775_06176                         239   2e-72   
gb|KJB48896.1|  hypothetical protein B456_008G092600                    239   3e-72   Gossypium raimondii
dbj|BAK06980.1|  predicted protein                                      239   3e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006413418.1|  hypothetical protein EUTSA_v10024936mg             238   6e-72   Eutrema salsugineum [saltwater cress]
gb|EEC84568.1|  hypothetical protein OsI_31345                          238   8e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_004152738.1|  PREDICTED: DUF246 domain-containing protein ...    238   1e-71   Cucumis sativus [cucumbers]
gb|EMS64135.1|  hypothetical protein TRIUR3_23110                       237   1e-71   Triticum urartu
ref|XP_003578106.1|  PREDICTED: uncharacterized protein At1g04910...    236   7e-71   Brachypodium distachyon [annual false brome]
tpg|DAA61415.1|  TPA: hypothetical protein ZEAMMB73_640362              235   8e-71   
gb|EEE69695.1|  hypothetical protein OsJ_29339                          237   1e-69   Oryza sativa Japonica Group [Japonica rice]
gb|KGN62755.1|  hypothetical protein Csa_2G370540                       238   2e-68   Cucumis sativus [cucumbers]
ref|XP_002967262.1|  hypothetical protein SELMODRAFT_87093              205   1e-59   
ref|XP_002960458.1|  hypothetical protein SELMODRAFT_75338              204   2e-59   
ref|XP_001777077.1|  predicted protein                                  199   1e-57   
ref|XP_010312650.1|  PREDICTED: uncharacterized protein At1g04910...    196   3e-56   Solanum lycopersicum
gb|AAB72114.1|  PsRT17-1                                                193   9e-56   Pisum sativum [garden pea]
tpg|DAA61413.1|  TPA: hypothetical protein ZEAMMB73_640362              182   5e-55   
ref|XP_008802622.1|  PREDICTED: uncharacterized protein At1g04910...    162   4e-43   Phoenix dactylifera
emb|CDX92640.1|  BnaC07g38980D                                          155   1e-42   
ref|XP_007047792.1|  O-fucosyltransferase family protein isoform 2      156   1e-41   
gb|KHG22139.1|  hypothetical protein F383_05782                         155   5e-41   Gossypium arboreum [tree cotton]
emb|CDY11018.1|  BnaA03g46770D                                          144   2e-40   Brassica napus [oilseed rape]
gb|KJB18181.1|  hypothetical protein B456_003G038000                    149   6e-39   Gossypium raimondii
ref|XP_010664406.1|  PREDICTED: uncharacterized protein At1g04910...    148   2e-38   Vitis vinifera
ref|XP_007136338.1|  hypothetical protein PHAVU_009G0371000g            143   1e-36   Phaseolus vulgaris [French bean]
gb|EMT10519.1|  hypothetical protein F775_32922                         132   9e-35   
ref|XP_010104478.1|  hypothetical protein L484_025447                   133   3e-34   
emb|CDP10650.1|  unnamed protein product                                136   8e-34   Coffea canephora [robusta coffee]
ref|NP_001132122.1|  uncharacterized protein LOC100193539               132   4e-33   
ref|XP_006826849.1|  hypothetical protein AMTR_s00010p00112560          134   4e-33   Amborella trichopoda
ref|XP_010538926.1|  PREDICTED: uncharacterized protein At1g04910...    133   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_006473173.1|  PREDICTED: uncharacterized protein At1g04910...    132   1e-32   Citrus sinensis [apfelsine]
ref|XP_006434582.1|  hypothetical protein CICLE_v10000533mg             132   1e-32   Citrus clementina [clementine]
ref|XP_008669808.1|  PREDICTED: uncharacterized protein At1g04910...    132   1e-32   Zea mays [maize]
ref|XP_001765982.1|  predicted protein                                  132   2e-32   
gb|EMT24938.1|  hypothetical protein F775_20364                         131   2e-32   
gb|AFW56213.1|  hypothetical protein ZEAMMB73_697257                    132   2e-32   
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...    132   3e-32   
ref|XP_009390064.1|  PREDICTED: uncharacterized protein At1g04910...    132   3e-32   
emb|CBI18521.3|  unnamed protein product                                131   3e-32   Vitis vinifera
ref|XP_008669806.1|  PREDICTED: uncharacterized protein At1g04910...    132   3e-32   Zea mays [maize]
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg             132   3e-32   
ref|XP_009390063.1|  PREDICTED: uncharacterized protein At1g04910...    132   3e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008669805.1|  PREDICTED: uncharacterized protein At1g04910...    132   3e-32   Zea mays [maize]
ref|XP_008661414.1|  PREDICTED: uncharacterized protein LOC100193...    132   3e-32   Zea mays [maize]
ref|XP_010274715.1|  PREDICTED: uncharacterized protein At1g04910...    132   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_009362464.1|  PREDICTED: uncharacterized protein At1g04910...    131   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_006434581.1|  hypothetical protein CICLE_v10000533mg             132   4e-32   
ref|XP_010246043.1|  PREDICTED: uncharacterized protein At1g04910...    130   5e-32   Nelumbo nucifera [Indian lotus]
ref|XP_002272758.2|  PREDICTED: uncharacterized protein At1g04910       131   5e-32   Vitis vinifera
gb|EMT33054.1|  hypothetical protein F775_09106                         130   5e-32   
ref|XP_010246042.1|  PREDICTED: uncharacterized protein At1g04910...    130   7e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010246041.1|  PREDICTED: uncharacterized protein At1g04910...    130   8e-32   Nelumbo nucifera [Indian lotus]
ref|XP_011096470.1|  PREDICTED: uncharacterized protein At1g04910       131   8e-32   Sesamum indicum [beniseed]
ref|XP_003578848.1|  PREDICTED: uncharacterized protein At1g04910...    130   8e-32   Brachypodium distachyon [annual false brome]
ref|XP_010246040.1|  PREDICTED: uncharacterized protein At1g04910...    130   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_009362462.1|  PREDICTED: uncharacterized protein At1g04910...    130   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_004299893.1|  PREDICTED: uncharacterized protein At1g04910       130   1e-31   Fragaria vesca subsp. vesca
ref|XP_006349651.1|  PREDICTED: uncharacterized protein At1g04910...    130   1e-31   Solanum tuberosum [potatoes]
ref|XP_006383813.1|  hypothetical protein POPTR_0005s28420g             122   2e-31   
gb|KJB30799.1|  hypothetical protein B456_005G161000                    129   4e-31   Gossypium raimondii
ref|XP_008776785.1|  PREDICTED: uncharacterized protein At1g04910...    129   4e-31   
ref|XP_010262622.1|  PREDICTED: uncharacterized protein At1g04910...    128   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006304663.1|  hypothetical protein CARUB_v10011867mg             128   6e-31   Capsella rubella
ref|XP_004237568.1|  PREDICTED: uncharacterized protein At1g04910...    128   6e-31   Solanum lycopersicum
ref|XP_007222464.1|  hypothetical protein PRUPE_ppa003505mg             128   6e-31   
ref|XP_010319880.1|  PREDICTED: uncharacterized protein At1g04910...    128   6e-31   Solanum lycopersicum
ref|XP_008378761.1|  PREDICTED: uncharacterized protein At1g04910       127   6e-31   
ref|XP_009594772.1|  PREDICTED: uncharacterized protein At1g04910       128   7e-31   Nicotiana tomentosiformis
gb|EYU22809.1|  hypothetical protein MIMGU_mgv1a003510mg                128   7e-31   Erythranthe guttata [common monkey flower]
ref|XP_009420104.1|  PREDICTED: uncharacterized protein At1g04910...    128   7e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010695805.1|  PREDICTED: uncharacterized protein At1g04910...    128   8e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002441904.1|  hypothetical protein SORBIDRAFT_08g004650          127   9e-31   
ref|XP_006397450.1|  hypothetical protein EUTSA_v10001813mg             127   1e-30   Eutrema salsugineum [saltwater cress]
gb|EPS61269.1|  hypothetical protein M569_13528                         122   1e-30   Genlisea aurea
ref|XP_010461317.1|  PREDICTED: uncharacterized protein At1g04910...    127   1e-30   Camelina sativa [gold-of-pleasure]
gb|EMS55867.1|  hypothetical protein TRIUR3_34733                       127   1e-30   Triticum urartu
ref|XP_002284457.1|  PREDICTED: uncharacterized protein At1g04910       127   1e-30   Vitis vinifera
ref|XP_010500036.1|  PREDICTED: uncharacterized protein At1g04910...    127   1e-30   Camelina sativa [gold-of-pleasure]
emb|CDY03127.1|  BnaC06g08460D                                          127   2e-30   
ref|XP_009407491.1|  PREDICTED: uncharacterized protein At1g04910...    127   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004238827.1|  PREDICTED: uncharacterized protein At1g04910       127   2e-30   Solanum lycopersicum
emb|CDY66921.1|  BnaAnng23210D                                          127   2e-30   Brassica napus [oilseed rape]
ref|XP_009114709.1|  PREDICTED: uncharacterized protein At1g04910       127   2e-30   Brassica rapa
ref|XP_009781764.1|  PREDICTED: uncharacterized protein At1g04910       127   2e-30   Nicotiana sylvestris
ref|XP_007045152.1|  O-fucosyltransferase family protein                127   2e-30   Theobroma cacao [chocolate]
gb|AFK46212.1|  unknown                                                 125   2e-30   Medicago truncatula
ref|XP_002450409.1|  hypothetical protein SORBIDRAFT_05g004890          126   3e-30   
ref|XP_008389203.1|  PREDICTED: uncharacterized protein At1g04910...    122   3e-30   
dbj|BAJ97328.1|  predicted protein                                      126   3e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009379518.1|  PREDICTED: uncharacterized protein At1g04910...    126   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_008219032.1|  PREDICTED: uncharacterized protein At1g04910       125   4e-30   Prunus mume [ume]
ref|XP_006355100.1|  PREDICTED: uncharacterized protein At1g04910...    125   6e-30   Solanum tuberosum [potatoes]
ref|XP_003598018.1|  DUF246 domain-containing protein                   125   6e-30   
gb|AES59903.2|  O-fucosyltransferase family protein                     125   7e-30   Medicago truncatula
ref|XP_008784225.1|  PREDICTED: uncharacterized protein At1g04910...    125   7e-30   Phoenix dactylifera
ref|XP_006469184.1|  PREDICTED: uncharacterized protein At1g04910...    125   8e-30   Citrus sinensis [apfelsine]
ref|XP_006448248.1|  hypothetical protein CICLE_v10014776mg             125   8e-30   Citrus clementina [clementine]
gb|KDO64642.1|  hypothetical protein CISIN_1g008637mg                   125   8e-30   Citrus sinensis [apfelsine]
ref|XP_010931259.1|  PREDICTED: uncharacterized protein At1g04910...    124   9e-30   
gb|KHG19963.1|  hypothetical protein F383_04918                         125   9e-30   Gossypium arboreum [tree cotton]
ref|XP_010093364.1|  hypothetical protein L484_022926                   125   9e-30   Morus notabilis
gb|KDP34835.1|  hypothetical protein JCGZ_11197                         125   1e-29   Jatropha curcas
ref|XP_003589652.1|  hypothetical protein MTR_1g031590                  125   1e-29   
gb|AAK93632.1|  putative growth regulator protein                       125   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564461.1|  O-fucosyltransferase-like protein                     125   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002891187.1|  hypothetical protein ARALYDRAFT_473680             124   1e-29   
gb|KFK27807.1|  hypothetical protein AALP_AA8G431600                    124   1e-29   Arabis alpina [alpine rockcress]
ref|XP_006841300.1|  hypothetical protein AMTR_s00134p00086190          124   1e-29   
ref|XP_010931258.1|  PREDICTED: uncharacterized protein At1g04910...    124   1e-29   Elaeis guineensis
ref|XP_010478945.1|  PREDICTED: uncharacterized protein At1g04910...    124   1e-29   Camelina sativa [gold-of-pleasure]
gb|KJB15424.1|  hypothetical protein B456_002G178200                    124   2e-29   Gossypium raimondii
gb|KJB28879.1|  hypothetical protein B456_005G074200                    124   2e-29   Gossypium raimondii
ref|XP_004498294.1|  PREDICTED: uncharacterized protein At1g04910...    124   2e-29   Cicer arietinum [garbanzo]
ref|XP_004150597.1|  PREDICTED: DUF246 domain-containing protein ...    124   2e-29   
ref|XP_006579000.1|  PREDICTED: uncharacterized protein At1g04910...    123   2e-29   
ref|XP_007148603.1|  hypothetical protein PHAVU_005G000400g             124   2e-29   Phaseolus vulgaris [French bean]
ref|XP_004977274.1|  PREDICTED: uncharacterized protein At1g04910...    123   2e-29   
gb|KJB28877.1|  hypothetical protein B456_005G074200                    124   2e-29   Gossypium raimondii
ref|XP_004498293.1|  PREDICTED: uncharacterized protein At1g04910...    124   2e-29   Cicer arietinum [garbanzo]
ref|XP_006582446.1|  PREDICTED: uncharacterized protein At1g04910...    123   3e-29   Glycine max [soybeans]
gb|KHG09805.1|  hypothetical protein F383_15167                         124   3e-29   Gossypium arboreum [tree cotton]
gb|AAF79365.1|AC007887_24  F15O4.45                                     124   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009339689.1|  PREDICTED: uncharacterized protein At1g04910...    124   3e-29   Pyrus x bretschneideri [bai li]
ref|XP_010922337.1|  PREDICTED: uncharacterized protein At1g04910...    123   3e-29   Elaeis guineensis
gb|KHN47089.1|  DUF246 domain-containing protein                        123   3e-29   Glycine soja [wild soybean]
ref|XP_006578999.1|  PREDICTED: uncharacterized protein At1g04910...    123   3e-29   Glycine max [soybeans]
ref|XP_003526401.1|  PREDICTED: uncharacterized protein At1g04910...    123   5e-29   Glycine max [soybeans]
ref|XP_008339538.1|  PREDICTED: uncharacterized protein At1g04910...    123   5e-29   Malus domestica [apple tree]
ref|XP_009351481.1|  PREDICTED: uncharacterized protein At1g04910...    123   5e-29   
ref|XP_008243446.1|  PREDICTED: uncharacterized protein At1g04910       122   5e-29   
ref|XP_010066619.1|  PREDICTED: uncharacterized protein At1g04910       122   6e-29   
gb|EEC68940.1|  hypothetical protein OsI_37646                          123   6e-29   
ref|XP_009351480.1|  PREDICTED: uncharacterized protein At1g04910...    123   6e-29   
ref|XP_009416135.1|  PREDICTED: uncharacterized protein At1g04910...    122   6e-29   
ref|XP_006664382.1|  PREDICTED: uncharacterized protein At1g04910...    122   6e-29   
ref|XP_009785418.1|  PREDICTED: uncharacterized protein At1g04910...    122   6e-29   
ref|NP_001066285.2|  Os12g0174100                                       122   7e-29   
ref|XP_010543575.1|  PREDICTED: uncharacterized protein At1g04910...    122   7e-29   
ref|XP_010543593.1|  PREDICTED: uncharacterized protein At1g04910...    122   7e-29   
gb|EEE51747.1|  hypothetical protein OsJ_33163                          122   8e-29   
ref|XP_004499553.1|  PREDICTED: uncharacterized protein At1g04910...    122   8e-29   
ref|XP_007225729.1|  hypothetical protein PRUPE_ppa003622mg             122   9e-29   
ref|XP_009598681.1|  PREDICTED: uncharacterized protein At1g04910       121   1e-28   
ref|XP_004141562.1|  PREDICTED: DUF246 domain-containing protein ...    122   1e-28   
ref|XP_002987806.1|  hypothetical protein SELMODRAFT_126689             120   1e-28   
gb|EEE52851.1|  hypothetical protein OsJ_35390                          122   1e-28   
emb|CAN77011.1|  hypothetical protein VITISV_036881                     122   1e-28   
ref|XP_004963730.1|  PREDICTED: uncharacterized protein At1g04910...    122   1e-28   
gb|EEC67779.1|  hypothetical protein OsI_35317                          122   1e-28   
gb|EYU30069.1|  hypothetical protein MIMGU_mgv1a003875mg                122   1e-28   
ref|XP_009379852.1|  PREDICTED: uncharacterized protein At1g04910...    121   1e-28   
dbj|BAD81763.1|  putative auxin-independent growth promoter             119   1e-28   
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...    121   2e-28   
ref|XP_011003993.1|  PREDICTED: uncharacterized protein At1g04910       122   2e-28   
ref|XP_010930789.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    121   2e-28   
ref|XP_003556095.1|  PREDICTED: uncharacterized protein At1g04910...    121   2e-28   
ref|NP_001044765.1|  Os01g0841200                                       119   2e-28   
ref|XP_008467134.1|  PREDICTED: uncharacterized protein At1g04910...    121   3e-28   
ref|XP_007157752.1|  hypothetical protein PHAVU_002G095600g             121   3e-28   
gb|KJB50369.1|  hypothetical protein B456_008G166900                    121   3e-28   
gb|KHN08072.1|  DUF246 domain-containing protein                        120   3e-28   
ref|XP_004505284.1|  PREDICTED: uncharacterized protein At1g04910...    120   3e-28   
ref|XP_002325978.2|  hypothetical protein POPTR_0019s11020g             121   3e-28   
gb|EEE55649.1|  hypothetical protein OsJ_04031                          119   3e-28   
gb|EEC71770.1|  hypothetical protein OsI_04380                          119   4e-28   
gb|KDO80742.1|  hypothetical protein CISIN_1g047008mg                   116   4e-28   
gb|KHG28222.1|  hypothetical protein F383_11890                         119   5e-28   
ref|XP_006644988.1|  PREDICTED: uncharacterized protein At1g04910...    119   6e-28   
ref|XP_008645342.1|  PREDICTED: uncharacterized protein At1g04910...    117   6e-28   
ref|XP_002533585.1|  conserved hypothetical protein                     120   7e-28   
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...    119   7e-28   
emb|CDP00784.1|  unnamed protein product                                119   8e-28   
ref|XP_010527785.1|  PREDICTED: uncharacterized protein At1g04910       119   8e-28   
ref|XP_002526030.1|  conserved hypothetical protein                     119   8e-28   
ref|XP_003564587.1|  PREDICTED: uncharacterized protein At1g04910...    119   9e-28   
ref|XP_008459666.1|  PREDICTED: uncharacterized protein At1g04910       119   1e-27   
ref|XP_004970534.1|  PREDICTED: uncharacterized protein At1g04910...    119   1e-27   
ref|XP_010553860.1|  PREDICTED: uncharacterized protein At1g04910...    119   1e-27   
emb|CDY36519.1|  BnaA06g09720D                                          119   1e-27   
ref|XP_009148881.1|  PREDICTED: uncharacterized protein At1g04910       119   1e-27   
ref|XP_006307153.1|  hypothetical protein CARUB_v10008744mg             119   1e-27   
ref|XP_002990403.1|  hypothetical protein SELMODRAFT_131659             117   2e-27   
gb|EMT14891.1|  hypothetical protein F775_28466                         117   3e-27   
ref|XP_008674838.1|  PREDICTED: uncharacterized protein At1g04910...    118   3e-27   
gb|KDP38063.1|  hypothetical protein JCGZ_04706                         118   3e-27   
gb|KHN43011.1|  DUF246 domain-containing protein                        117   3e-27   
gb|AFW82218.1|  hypothetical protein ZEAMMB73_014086                    118   4e-27   
ref|XP_007020035.1|  O-fucosyltransferase family protein isoform 1      118   4e-27   
gb|KEH30846.1|  O-fucosyltransferase family protein                     117   4e-27   
ref|XP_008656362.1|  PREDICTED: uncharacterized protein At1g04910...    118   4e-27   
ref|XP_004297377.1|  PREDICTED: uncharacterized protein At1g04910       117   4e-27   
ref|XP_010274355.1|  PREDICTED: uncharacterized protein At1g04910...    118   5e-27   
ref|XP_003568305.1|  PREDICTED: uncharacterized protein At1g04910...    117   5e-27   
gb|KJB59186.1|  hypothetical protein B456_009G243300                    116   6e-27   
gb|KFK43757.1|  hypothetical protein AALP_AA1G168900                    117   6e-27   
ref|XP_001753764.1|  predicted protein                                  116   6e-27   
ref|XP_011070621.1|  PREDICTED: uncharacterized protein At1g04910...    117   6e-27   
dbj|BAJ88036.1|  predicted protein                                      117   7e-27   
ref|XP_006472724.1|  PREDICTED: uncharacterized protein At1g04910...    116   9e-27   
ref|XP_011038632.1|  PREDICTED: uncharacterized protein At1g04910       117   9e-27   
ref|XP_002315879.1|  hypothetical protein POPTR_0010s12160g             117   9e-27   
ref|XP_010496702.1|  PREDICTED: uncharacterized protein At1g04910...    116   1e-26   
ref|XP_002458744.1|  hypothetical protein SORBIDRAFT_03g039450          116   1e-26   
gb|EMT11808.1|  hypothetical protein F775_16126                         116   1e-26   
ref|XP_003529417.1|  PREDICTED: uncharacterized protein At1g04910...    116   1e-26   
ref|XP_010496695.1|  PREDICTED: uncharacterized protein At1g04910...    116   1e-26   
ref|XP_010680244.1|  PREDICTED: uncharacterized protein At1g04910...    117   1e-26   
ref|XP_010680324.1|  PREDICTED: uncharacterized protein At1g04910...    117   1e-26   
ref|XP_007136337.1|  hypothetical protein PHAVU_009G0371001g            108   1e-26   
ref|XP_006472723.1|  PREDICTED: uncharacterized protein At1g04910...    116   2e-26   
emb|CDX81687.1|  BnaC08g39140D                                          116   2e-26   
gb|EMS47472.1|  hypothetical protein TRIUR3_14732                       115   2e-26   
emb|CDY33727.1|  BnaA09g45330D                                          115   2e-26   
ref|XP_009117860.1|  PREDICTED: uncharacterized protein At1g04910...    115   2e-26   
ref|XP_006398540.1|  hypothetical protein EUTSA_v10000838mg             115   2e-26   
ref|XP_010691586.1|  PREDICTED: uncharacterized protein At1g04910...    115   2e-26   
ref|XP_010476573.1|  PREDICTED: uncharacterized protein At1g04910...    115   2e-26   
ref|XP_010476572.1|  PREDICTED: uncharacterized protein At1g04910...    115   3e-26   
ref|XP_006434132.1|  hypothetical protein CICLE_v10000652mg             115   3e-26   
ref|XP_010513871.1|  PREDICTED: uncharacterized protein At1g04910...    115   3e-26   
gb|KJB59188.1|  hypothetical protein B456_009G243300                    115   3e-26   
gb|KJB59187.1|  hypothetical protein B456_009G243300                    115   3e-26   
ref|XP_006290827.1|  hypothetical protein CARUB_v10016938mg             115   3e-26   
ref|XP_010502128.1|  PREDICTED: uncharacterized protein At1g04910...    115   3e-26   
gb|AFW78262.1|  hypothetical protein ZEAMMB73_416738                    115   4e-26   
ref|XP_008649712.1|  PREDICTED: uncharacterized protein At1g04910...    115   4e-26   
ref|XP_009101345.1|  PREDICTED: uncharacterized protein At1g04910...    115   4e-26   
ref|XP_002984324.1|  hypothetical protein SELMODRAFT_268854             115   4e-26   
ref|XP_009101344.1|  PREDICTED: uncharacterized protein At1g04910...    115   5e-26   
ref|XP_006434133.1|  hypothetical protein CICLE_v10000652mg             115   5e-26   
emb|CDY65925.1|  BnaC07g48790D                                          114   5e-26   
ref|XP_010459016.1|  PREDICTED: uncharacterized protein At1g04910...    114   5e-26   
ref|XP_010459015.1|  PREDICTED: uncharacterized protein At1g04910...    114   6e-26   
ref|XP_002307421.1|  hypothetical protein POPTR_0005s16060g             114   6e-26   
ref|XP_001760728.1|  predicted protein                                  114   6e-26   
gb|KFK33363.1|  hypothetical protein AALP_AA5G004000                    114   7e-26   
ref|NP_178257.1|  O-fucosyltransferase family protein                   114   8e-26   
ref|XP_002301007.2|  hypothetical protein POPTR_0002s08790g             114   8e-26   
ref|XP_004235088.1|  PREDICTED: uncharacterized protein At1g04910...    114   9e-26   
ref|XP_002892842.1|  hypothetical protein ARALYDRAFT_471685             114   1e-25   
ref|XP_010272863.1|  PREDICTED: uncharacterized protein At1g04910...    114   1e-25   
ref|XP_002972493.1|  hypothetical protein SELMODRAFT_441812             115   1e-25   
ref|XP_001753325.1|  predicted protein                                  112   2e-25   
ref|XP_006416955.1|  hypothetical protein EUTSA_v10007261mg             112   2e-25   
ref|XP_009129233.1|  PREDICTED: uncharacterized protein At1g04910...    113   2e-25   
emb|CDY52384.1|  BnaCnng22220D                                          112   3e-25   
ref|XP_007018985.1|  O-fucosyltransferase family protein isoform 2      113   3e-25   
ref|XP_002311505.2|  hypothetical protein POPTR_0008s12960g             112   3e-25   
ref|XP_010327510.1|  PREDICTED: uncharacterized protein At1g04910...    110   4e-25   
ref|XP_006847061.1|  hypothetical protein AMTR_s00017p00201590          112   4e-25   
dbj|BAD46055.1|  putative axi 1                                         109   4e-25   
ref|XP_010664246.1|  PREDICTED: uncharacterized protein At1g04910...    112   5e-25   
ref|XP_002284399.1|  PREDICTED: uncharacterized protein At1g04910...    112   5e-25   
emb|CBI19065.3|  unnamed protein product                                112   5e-25   
tpg|DAA59674.1|  TPA: hypothetical protein ZEAMMB73_298098              107   5e-25   
gb|KDP32763.1|  hypothetical protein JCGZ_12055                         112   5e-25   
gb|ACF86391.1|  unknown                                                 112   6e-25   
ref|XP_011023536.1|  PREDICTED: uncharacterized protein At1g04910...    111   7e-25   
gb|EMT20301.1|  hypothetical protein F775_28818                         110   8e-25   
emb|CDP01105.1|  unnamed protein product                                111   8e-25   
ref|XP_004248822.1|  PREDICTED: uncharacterized protein At1g04910...    110   9e-25   
ref|XP_002980115.1|  hypothetical protein SELMODRAFT_111978             110   1e-24   
gb|EYU22927.1|  hypothetical protein MIMGU_mgv1a018388mg                110   1e-24   
ref|XP_009775860.1|  PREDICTED: uncharacterized protein At1g04910...    108   2e-24   
ref|XP_006342312.1|  PREDICTED: uncharacterized protein At1g04910...    109   2e-24   
gb|AFW75942.1|  LOW QUALITY PROTEIN: auxin-independent growth pro...    112   2e-24   
gb|EPS67731.1|  hypothetical protein M569_07044                         105   2e-24   
ref|XP_002973931.1|  hypothetical protein SELMODRAFT_100522             109   2e-24   
ref|XP_002969133.1|  hypothetical protein SELMODRAFT_90475              109   2e-24   
ref|XP_009604992.1|  PREDICTED: uncharacterized protein At1g04910...    110   2e-24   
gb|EMS46071.1|  hypothetical protein TRIUR3_08015                       108   2e-24   
ref|NP_001152550.1|  auxin-independent growth promoter-like protein     110   2e-24   
ref|XP_007221795.1|  hypothetical protein PRUPE_ppa003430mg             110   3e-24   
ref|XP_008233904.1|  PREDICTED: uncharacterized protein At1g04910       110   3e-24   
ref|XP_006342311.1|  PREDICTED: uncharacterized protein At1g04910...    110   3e-24   
gb|ACJ85641.1|  unknown                                                 105   3e-24   
ref|XP_011027599.1|  PREDICTED: uncharacterized protein At1g04910...    110   3e-24   
ref|XP_009782231.1|  PREDICTED: uncharacterized protein At1g04910...    109   3e-24   
ref|NP_001169204.1|  hypothetical protein                               108   3e-24   
ref|XP_008655749.1|  PREDICTED: uncharacterized protein At1g04910...    107   3e-24   
ref|XP_011027600.1|  PREDICTED: uncharacterized protein At1g04910...    110   3e-24   
ref|XP_008649711.1|  PREDICTED: uncharacterized protein At1g04910...    110   4e-24   
gb|AAF79229.1|AC006917_14  F10B6.36                                     108   4e-24   
ref|XP_002438900.1|  hypothetical protein SORBIDRAFT_10g027900          109   4e-24   
gb|EEC81207.1|  hypothetical protein OsI_24239                          109   4e-24   
ref|XP_011074208.1|  PREDICTED: uncharacterized protein At1g04910       109   4e-24   
gb|EEE66244.1|  hypothetical protein OsJ_22422                          109   4e-24   
gb|EEE52890.1|  hypothetical protein OsJ_35473                          108   5e-24   
ref|NP_001066339.1|  Os12g0190100                                       108   6e-24   
ref|XP_006657268.1|  PREDICTED: uncharacterized protein At1g04910...    108   6e-24   
dbj|BAJ98197.1|  predicted protein                                      108   6e-24   
ref|XP_009777243.1|  PREDICTED: uncharacterized protein At1g04910...    108   6e-24   
ref|XP_009777248.1|  PREDICTED: uncharacterized protein At1g04910...    108   6e-24   
ref|XP_006341331.1|  PREDICTED: uncharacterized protein At1g04910...    108   6e-24   
ref|XP_009390143.1|  PREDICTED: uncharacterized protein At1g04910...    108   7e-24   
ref|XP_006351922.1|  PREDICTED: uncharacterized protein At1g04910...    107   7e-24   
ref|XP_008219343.1|  PREDICTED: uncharacterized protein At1g04910...    108   7e-24   
ref|XP_007221810.1|  hypothetical protein PRUPE_ppa004094mg             108   7e-24   
ref|XP_002451572.1|  hypothetical protein SORBIDRAFT_04g004090          108   8e-24   
ref|NP_172950.1|  O-fucosyltransferase family protein                   108   8e-24   
gb|EEC68978.1|  hypothetical protein OsI_37727                          107   9e-24   
ref|XP_010267002.1|  PREDICTED: uncharacterized protein At1g04910...    108   9e-24   
dbj|BAK00215.1|  predicted protein                                      107   9e-24   
ref|XP_010682284.1|  PREDICTED: uncharacterized protein At1g04910       108   9e-24   
ref|XP_009599287.1|  PREDICTED: uncharacterized protein At1g04910...    108   1e-23   
ref|XP_004250340.1|  PREDICTED: uncharacterized protein At1g04910...    108   1e-23   
gb|EMS52186.1|  hypothetical protein TRIUR3_20101                       107   1e-23   
ref|XP_010091349.1|  hypothetical protein L484_020151                   109   1e-23   
gb|EMT33036.1|  hypothetical protein F775_09618                         107   1e-23   
ref|XP_009367298.1|  PREDICTED: uncharacterized protein At1g04910...    108   1e-23   
ref|XP_008338786.1|  PREDICTED: uncharacterized protein At1g04910       108   1e-23   
ref|XP_010535322.1|  PREDICTED: uncharacterized protein At1g04910...    106   1e-23   
ref|XP_006850060.1|  hypothetical protein AMTR_s00022p00204610          107   1e-23   
gb|AFW80351.1|  hypothetical protein ZEAMMB73_842533                    106   1e-23   
ref|XP_009341670.1|  PREDICTED: uncharacterized protein At1g04910...    107   2e-23   
ref|XP_002285492.1|  PREDICTED: uncharacterized protein At1g04910       107   2e-23   
ref|XP_010248690.1|  PREDICTED: uncharacterized protein At1g04910       107   2e-23   
ref|XP_010100364.1|  hypothetical protein L484_027673                   107   3e-23   
ref|XP_008372993.1|  PREDICTED: uncharacterized protein At1g04910...    107   3e-23   
ref|XP_010675873.1|  PREDICTED: uncharacterized protein At1g04910       106   3e-23   
ref|XP_009632008.1|  PREDICTED: uncharacterized protein At1g04910...    105   3e-23   
gb|KHN26036.1|  DUF246 domain-containing protein                        106   3e-23   
ref|XP_008372992.1|  PREDICTED: uncharacterized protein At1g04910...    106   3e-23   
ref|XP_008349183.1|  PREDICTED: uncharacterized protein At1g04910...    104   3e-23   
ref|XP_008446146.1|  PREDICTED: uncharacterized protein At1g04910       107   3e-23   
ref|XP_004135279.1|  PREDICTED: DUF246 domain-containing protein ...    106   4e-23   
ref|XP_008383543.1|  PREDICTED: uncharacterized protein At1g04910...    104   4e-23   
ref|XP_010535312.1|  PREDICTED: uncharacterized protein At1g04910...    107   4e-23   
ref|XP_010937209.1|  PREDICTED: uncharacterized protein At1g04910       106   4e-23   
ref|XP_008444126.1|  PREDICTED: uncharacterized protein At1g04910...    107   4e-23   
ref|XP_006648331.1|  PREDICTED: uncharacterized protein At1g04910...    106   4e-23   
ref|XP_008365206.1|  PREDICTED: uncharacterized protein At1g04910...    106   4e-23   
ref|XP_009366982.1|  PREDICTED: uncharacterized protein At1g04910...    106   4e-23   
ref|XP_009348039.1|  PREDICTED: uncharacterized protein At1g04910...    105   4e-23   
ref|XP_009398160.1|  PREDICTED: uncharacterized protein At1g04910...    106   5e-23   
ref|XP_010930931.1|  PREDICTED: uncharacterized protein At1g04910...    106   5e-23   
ref|XP_003560475.2|  PREDICTED: uncharacterized protein At1g04910...    106   5e-23   
ref|XP_006664407.1|  PREDICTED: uncharacterized protein At1g04910...    105   5e-23   
ref|XP_009373119.1|  PREDICTED: uncharacterized protein At1g04910...    106   5e-23   
ref|XP_010530190.1|  PREDICTED: uncharacterized protein At1g04910...    106   5e-23   
ref|XP_006306299.1|  hypothetical protein CARUB_v10012165mg             106   6e-23   
ref|XP_004951839.1|  PREDICTED: uncharacterized protein At1g04910...    106   6e-23   
ref|XP_008340083.1|  PREDICTED: uncharacterized protein At1g04910       106   6e-23   
emb|CDX73383.1|  BnaC05g27230D                                          106   6e-23   
ref|XP_004229593.1|  PREDICTED: uncharacterized protein At1g04910...    106   6e-23   
ref|XP_004239143.1|  PREDICTED: uncharacterized protein At1g04910       106   6e-23   
ref|XP_006363293.1|  PREDICTED: uncharacterized protein At1g04910...    105   6e-23   
ref|XP_006357586.1|  PREDICTED: uncharacterized protein At1g04910...    106   6e-23   
ref|XP_009345471.1|  PREDICTED: uncharacterized protein At1g04910...    106   6e-23   



>ref|XP_006353173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=505

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  352  LLAALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLA  411

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ+
Sbjct  412  AVDYYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQE  471

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +VIEGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  472  SVIEGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  505



>ref|XP_006353172.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=506

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  353  LLAALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLA  412

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ+
Sbjct  413  AVDYYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQE  472

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +VIEGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  473  SVIEGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  506



>ref|XP_010312649.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Solanum 
lycopersicum]
Length=470

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  317  LLAALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLA  376

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ+
Sbjct  377  AVDYYVGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQE  436

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +VIEGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  437  SVIEGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  470



>gb|AAK84479.1| putative auxin growth promotor protein [Solanum lycopersicum]
Length=478

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  325  LLAALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLA  384

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ+
Sbjct  385  AVDYYVGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQE  444

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +VIEGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  445  SVIEGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  478



>ref|XP_010312647.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=506

 Score =   287 bits (734),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  353  LLAALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLA  412

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ+
Sbjct  413  AVDYYVGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQE  472

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +VIEGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  473  SVIEGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  506



>ref|XP_009797993.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797994.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
Length=504

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  351  LLAALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEERALIKGKASLLA  410

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ+
Sbjct  411  AVDYYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQE  470

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  471  SVVEGHKNRQGQIRLRKPKQSLYTYPAPDCMCQA  504



>ref|XP_009797995.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana sylvestris]
Length=503

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  350  LLAALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEERALIKGKASLLA  409

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ+
Sbjct  410  AVDYYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQE  469

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  470  SVVEGHKNRQGQIRLRKPKQSLYTYPAPDCMCQA  503



>ref|XP_010312648.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=505

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  352  LLAALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLA  411

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ+
Sbjct  412  AVDYYVGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQE  471

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +VIEGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  472  SVIEGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  505



>ref|XP_011097478.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=516

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLASSEER +IKGKASLLA
Sbjct  363  LLAALGFDNSTRLYLASHKVYGGEARISTLRSLFPHMEDKKSLASSEERAQIKGKASLLA  422

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRTY N KTIRP+M LLGQLFLNKNLTWPEFQD
Sbjct  423  AVDYYVSMHSDIFISASPGNMHNAVVGHRTYENKKTIRPSMTLLGQLFLNKNLTWPEFQD  482

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMCNA
Sbjct  483  AVVEGHKNRQGQLRLRKPQQSIYTYPAPDCMCNA  516



>gb|KDP29763.1| hypothetical protein JCGZ_18698 [Jatropha curcas]
Length=509

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  356  LLAALGFDNSTRLYLASHKVYGGEARISTLRTLFPLMEDKKSLASSEERAQIKGKASLLA  415

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNKN++W +FQ 
Sbjct  416  AVDYYVGLHSDIFISASPGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKNISWSDFQQ  475

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQGEIRLRKP KS+YTYPAPDCMC A
Sbjct  476  AVLEGHENRQGEIRLRKPKKSIYTYPAPDCMCQA  509



>ref|XP_007207425.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08624.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=474

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEER +IKGKASLLA
Sbjct  321  LLAALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEERAQIKGKASLLA  380

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A DYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ 
Sbjct  381  AADYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQ  440

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  441  SVVEGHQNRQGQIRLRKPKQSIYTYPAPDCMCQA  474



>ref|XP_003534239.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN38876.1| DUF246 domain-containing protein [Glycine soja]
Length=515

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA+GFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  362  LLAAMGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSEERSQIKGKASLLA  421

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQD
Sbjct  422  ALDYYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQD  481

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQGE+RLRKP +S+YTYPAPDCMC A
Sbjct  482  AVVEGHQNRQGELRLRKPKQSIYTYPAPDCMCQA  515



>ref|XP_006587571.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=516

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA+GFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  363  LLAAMGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSEERSQIKGKASLLA  422

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQD
Sbjct  423  ALDYYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQD  482

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQGE+RLRKP +S+YTYPAPDCMC A
Sbjct  483  AVVEGHQNRQGELRLRKPKQSIYTYPAPDCMCQA  516



>emb|CDP01562.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +LAALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  361  VLAALGFDNNTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLASSEERVKIKGKASLLA  420

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIF+SASPGNMHNAMVGHRTY N+KTIRPNM LLG LFLNKNLTWPEFQ+
Sbjct  421  AVDYYVSMHSDIFVSASPGNMHNAMVGHRTYINMKTIRPNMALLGPLFLNKNLTWPEFQE  480

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+IEGH NRQG IRLRK  +SLYTYPAPDCMC A
Sbjct  481  AIIEGHKNRQGIIRLRKKEQSLYTYPAPDCMCQA  514



>ref|XP_002268599.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI38269.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN TRLYLASHKVYGGAARIS LR LFPLME+KKSLASS+ER +IKGKASLLA
Sbjct  357  LLAALGFDNTTRLYLASHKVYGGAARISTLRELFPLMEDKKSLASSDERAQIKGKASLLA  416

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK++ W EFQ 
Sbjct  417  AVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPNMALLGQLFLNKSIGWSEFQQ  476

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG+IRLRK  +SLYTYPAPDCMCNA
Sbjct  477  AVVEGHENRQGQIRLRKSEQSLYTYPAPDCMCNA  510



>ref|XP_002310868.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
 gb|ABK95421.1| unknown [Populus trichocarpa]
 gb|EEE91318.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
Length=506

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR+LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  353  LLAALGFDNSTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASSEERSQIKGKASLLA  412

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVG+HSDIF+SASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK ++W +FQ 
Sbjct  413  AVDYYVGLHSDIFVSASPGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKTISWTDFQQ  472

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  473  AVVEGHENRQGQIRLRKPKQSIYTYPAPDCMCYA  506



>ref|XP_007207426.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08625.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=485

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEER +IKGKASLLA
Sbjct  332  LLAALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEERAQIKGKASLLA  391

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A DYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ 
Sbjct  392  AADYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQ  451

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  452  SVVEGHQNRQGQIRLRKPKQSIYTYPAPDCMCQA  485



>ref|XP_011021848.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=506

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR+LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  353  LLAALGFDNSTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASSEERSQIKGKASLLA  412

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVG+HSDIF+SASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK ++W +FQ 
Sbjct  413  AVDYYVGLHSDIFVSASPGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKTISWTDFQQ  472

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  473  AVVEGHENRQGQIRLRKPKQSIYTYPAPDCMCYA  506



>ref|XP_009350347.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=513

 Score =   280 bits (715),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  360  LLAALGFDNNTRLYLASHKVYGGEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ 
Sbjct  420  AVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQ  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V++GH +RQG+IR+RKP KS+YTYPAPDCMC A
Sbjct  480  SVVKGHESRQGQIRIRKPKKSIYTYPAPDCMCEA  513



>ref|XP_009350346.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=524

 Score =   280 bits (715),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  371  LLAALGFDNNTRLYLASHKVYGGEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLA  430

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ 
Sbjct  431  AVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQ  490

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V++GH +RQG+IR+RKP KS+YTYPAPDCMC A
Sbjct  491  SVVKGHESRQGQIRIRKPKKSIYTYPAPDCMCEA  524



>ref|XP_009623754.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana tomentosiformis]
Length=503

 Score =   279 bits (714),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  350  LLAALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEERALIKGKASLLA  409

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNAMVGHRTY+N+K IRPNM LLGQLFLNK L WPEFQ+
Sbjct  410  AVDYYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKIIRPNMALLGQLFLNKTLNWPEFQE  469

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH NRQG+IRLRK  +SLYTYPAPDCMC A
Sbjct  470  SVVEGHKNRQGQIRLRKAKQSLYTYPAPDCMCQA  503



>ref|XP_009623753.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana tomentosiformis]
Length=504

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  351  LLAALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEERALIKGKASLLA  410

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNAMVGHRTY+N+K IRPNM LLGQLFLNK L WPEFQ+
Sbjct  411  AVDYYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKIIRPNMALLGQLFLNKTLNWPEFQE  470

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH NRQG+IRLRK  +SLYTYPAPDCMC A
Sbjct  471  SVVEGHKNRQGQIRLRKAKQSLYTYPAPDCMCQA  504



>gb|KCW54611.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=484

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN TRLYLASHKVYGG ARIS LR++FPLME+KKSLAS++ER +IKGKASLLA
Sbjct  331  LLAALGFDNTTRLYLASHKVYGGEARISMLRKMFPLMEDKKSLASADERAQIKGKASLLA  390

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA+VGHRTY N+KTIRP+M LLGQLFLNKN++W EFQ+
Sbjct  391  ALDYYISMHSDIFISASPGNMHNALVGHRTYENMKTIRPSMALLGQLFLNKNISWSEFQE  450

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+IEGH NRQG+IRLRKP +SLYTYPAPDCMC+A
Sbjct  451  AIIEGHKNRQGQIRLRKPKQSLYTYPAPDCMCSA  484



>ref|XP_010027954.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW54610.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=505

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN TRLYLASHKVYGG ARIS LR++FPLME+KKSLAS++ER +IKGKASLLA
Sbjct  352  LLAALGFDNTTRLYLASHKVYGGEARISMLRKMFPLMEDKKSLASADERAQIKGKASLLA  411

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA+VGHRTY N+KTIRP+M LLGQLFLNKN++W EFQ+
Sbjct  412  ALDYYISMHSDIFISASPGNMHNALVGHRTYENMKTIRPSMALLGQLFLNKNISWSEFQE  471

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+IEGH NRQG+IRLRKP +SLYTYPAPDCMC+A
Sbjct  472  AIIEGHKNRQGQIRLRKPKQSLYTYPAPDCMCSA  505



>ref|XP_009364252.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Pyrus 
x bretschneideri]
Length=513

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARI+ LR++FPLME+KKSLASSEER +IKGKASLLA
Sbjct  360  LLAALGFDNNTRLYLASHKVYGGEARIATLRKVFPLMEDKKSLASSEERAQIKGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ 
Sbjct  420  AVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMPLLGQLFLNKTLSWSEFQQ  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V++GH NRQG+IR+RKP +S+YTYPAPDCMC A
Sbjct  480  SVVKGHENRQGQIRIRKPKQSIYTYPAPDCMCQA  513



>ref|XP_009364251.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Pyrus 
x bretschneideri]
Length=524

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARI+ LR++FPLME+KKSLASSEER +IKGKASLLA
Sbjct  371  LLAALGFDNNTRLYLASHKVYGGEARIATLRKVFPLMEDKKSLASSEERAQIKGKASLLA  430

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ 
Sbjct  431  AVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMPLLGQLFLNKTLSWSEFQQ  490

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V++GH NRQG+IR+RKP +S+YTYPAPDCMC A
Sbjct  491  SVVKGHENRQGQIRIRKPKQSIYTYPAPDCMCQA  524



>ref|XP_008236140.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Prunus 
mume]
Length=518

 Score =   278 bits (711),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEER +IKGKASLLA
Sbjct  365  LLAALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEERAQIKGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ 
Sbjct  425  AVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQ  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH NR G+IRLRKP +S+YTYPAPDCMC A
Sbjct  485  SVVEGHQNRHGQIRLRKPKQSIYTYPAPDCMCQA  518



>ref|XP_008385667.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Malus domestica]
Length=524

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARI+ LR++FPLME+KKSLASSEER +IKGKASLLA
Sbjct  371  LLAALGFDNNTRLYLASHKVYGGEARIATLRKVFPLMEDKKSLASSEERAQIKGKASLLA  430

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ 
Sbjct  431  AVDYYVSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMPLLGQLFLNKTLSWSEFQQ  490

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V++GH NRQG+IR+RKP +S+YTYPAPDCMC A
Sbjct  491  SVVKGHENRQGQIRIRKPKQSIYTYPAPDCMCQA  524



>gb|KHN14510.1| DUF246 domain-containing protein [Glycine soja]
Length=516

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA+GFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLASSEER EIKGKASLLA
Sbjct  363  LLAAMGFDNSTRLYLASHKVYGGEARISTLRELFPRMEDKKSLASSEERSEIKGKASLLA  422

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQD
Sbjct  423  ALDYYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQD  482

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQGE RLRKP +S+YTYPAPDCMC A
Sbjct  483  AVVEGHQNRQGEPRLRKPKQSIYTYPAPDCMCQA  516



>ref|XP_006573005.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=515

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA+GFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLASSEER EIKGKASLLA
Sbjct  362  LLAAMGFDNSTRLYLASHKVYGGEARISTLRELFPRMEDKKSLASSEERSEIKGKASLLA  421

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQD
Sbjct  422  ALDYYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQD  481

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQGE RLRKP +S+YTYPAPDCMC A
Sbjct  482  AVVEGHQNRQGEPRLRKPKQSIYTYPAPDCMCQA  515



>ref|XP_008236135.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Prunus 
mume]
Length=529

 Score =   278 bits (711),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEER +IKGKASLLA
Sbjct  376  LLAALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEERAQIKGKASLLA  435

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ 
Sbjct  436  AVDYYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQ  495

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH NR G+IRLRKP +S+YTYPAPDCMC A
Sbjct  496  SVVEGHQNRHGQIRLRKPKQSIYTYPAPDCMCQA  529



>ref|XP_009783617.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=512

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASS+ER  IKGKASLLA
Sbjct  359  LLAALGFDNSTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLASSDERALIKGKASLLA  418

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNAMVGHRTY+NLKTIRP M LLGQLFLNK L+WPEF++
Sbjct  419  AVDYYVSMHSDIFISASPGNMHNAMVGHRTYYNLKTIRPKMALLGQLFLNKTLSWPEFKE  478

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV+EGH NR+G+IRLRKP +SLYTYPAPDCMC 
Sbjct  479  AVVEGHKNRKGQIRLRKPNQSLYTYPAPDCMCQ  511



>ref|XP_003517397.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=516

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA+GFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLASSEER EIKGKASLLA
Sbjct  363  LLAAMGFDNSTRLYLASHKVYGGEARISTLRELFPRMEDKKSLASSEERSEIKGKASLLA  422

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQD
Sbjct  423  ALDYYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQD  482

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQGE RLRKP +S+YTYPAPDCMC A
Sbjct  483  AVVEGHQNRQGEPRLRKPKQSIYTYPAPDCMCQA  516



>ref|XP_008347790.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Malus domestica]
Length=513

 Score =   278 bits (710),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  360  LLAALGFDNNTRLYLASHKVYGGEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ 
Sbjct  420  AVDYYVSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQ  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            +V++GH NRQG+IR+RKP +S+YTYPAPDCMC 
Sbjct  480  SVVKGHENRQGQIRIRKPKQSIYTYPAPDCMCE  512



>ref|XP_008347789.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Malus domestica]
Length=524

 Score =   278 bits (710),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  371  LLAALGFDNNTRLYLASHKVYGGEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLA  430

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ 
Sbjct  431  AVDYYVSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQ  490

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            +V++GH NRQG+IR+RKP +S+YTYPAPDCMC 
Sbjct  491  SVVKGHENRQGQIRIRKPKQSIYTYPAPDCMCE  523



>gb|KJB44061.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=401

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSLASS ER  IKGKASLLA
Sbjct  248  LLAALGFDNNTRLYLASHKVYGGEARISTLRNLFPLMEDKKSLASSAERVHIKGKASLLA  307

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDY+VGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F+ 
Sbjct  308  AVDYHVGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQ  367

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMC+A
Sbjct  368  AVVEGHQNRQGQLRLRKPKQSIYTYPAPDCMCHA  401



>gb|KJB18177.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=367

 Score =   273 bits (697),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR  FP ME+KKSLASSEER  IKGKASLLA
Sbjct  214  LLAALGFDNSTRLYLASHKVYGGEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLA  273

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ 
Sbjct  274  AVDYYVGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQ  333

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  334  AVVEGHQNRQGQLRLRKPKQSIYTYPAPDCMCQA  367



>gb|KHG05570.1| hypothetical protein F383_31127 [Gossypium arboreum]
Length=518

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR LFPLMENKKSLASSEER  IKGKASLLA
Sbjct  365  LLAALGFDNSTRLYLASHKVYGGEARISTLRELFPLMENKKSLASSEERARIKGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFL+KN+TW EF+ 
Sbjct  425  AVDYYVGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMALLGQLFLDKNITWLEFRQ  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV EGH NRQG+++LRKP +S+YTYPAPDCMC A
Sbjct  485  AVAEGHQNRQGQLKLRKPKQSIYTYPAPDCMCRA  518



>gb|KJB18178.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=401

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR  FP ME+KKSLASSEER  IKGKASLLA
Sbjct  248  LLAALGFDNSTRLYLASHKVYGGEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLA  307

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ 
Sbjct  308  AVDYYVGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQ  367

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  368  AVVEGHQNRQGQLRLRKPKQSIYTYPAPDCMCQA  401



>ref|XP_011099984.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Sesamum indicum]
Length=517

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGGAARIS LR +FP ME+KKSLAS+EER +IKGKASLLA
Sbjct  364  LLAALGFDNSTRLYLASHKVYGGAARISTLRSIFPFMEDKKSLASTEERAQIKGKASLLA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK+LTW EFQ+
Sbjct  424  AVDYYVSMHSDIFISASPGNMHNAVVGHRTYENLKTIRPNMALLGQLFLNKSLTWLEFQE  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV++GH +RQG +RLRKP +S+YTYPAPDCMC+A
Sbjct  484  AVVKGHKSRQGLLRLRKPEQSIYTYPAPDCMCSA  517



>ref|XP_011099981.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099982.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099983.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
Length=518

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGGAARIS LR +FP ME+KKSLAS+EER +IKGKASLLA
Sbjct  365  LLAALGFDNSTRLYLASHKVYGGAARISTLRSIFPFMEDKKSLASTEERAQIKGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK+LTW EFQ+
Sbjct  425  AVDYYVSMHSDIFISASPGNMHNAVVGHRTYENLKTIRPNMALLGQLFLNKSLTWLEFQE  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV++GH +RQG +RLRKP +S+YTYPAPDCMC+A
Sbjct  485  AVVKGHKSRQGLLRLRKPEQSIYTYPAPDCMCSA  518



>ref|XP_007158370.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
 gb|ESW30364.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
Length=514

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASS++R +IKGKASLLA
Sbjct  361  LLAALGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSDQRAQIKGKASLLA  420

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF D
Sbjct  421  ALDYYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFHD  480

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  481  AVVEGHQNRQGQVRLRKPKQSIYTYPAPDCMCQA  514



>ref|XP_002533683.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28699.1| conserved hypothetical protein [Ricinus communis]
Length=509

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
             LAALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  356  FLAALGFDNSTRLYLASHKVYGGEARISVLRELFPLMEDKKSLASSEERAQIKGKASLLA  415

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIF+SAS GNMHNA+VGHRTY NLKTIRPNM LLGQLFLNKN++W EFQ 
Sbjct  416  AVDYYVAMHSDIFLSASRGNMHNALVGHRTYENLKTIRPNMPLLGQLFLNKNISWSEFQQ  475

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH +RQGEIR+R+P +SLYTYPAPDCMC A
Sbjct  476  SVLEGHEDRQGEIRVRRPKQSLYTYPAPDCMCQA  509



>gb|AGV54211.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=511

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASS++R +IKGKASLLA
Sbjct  358  LLAALGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSDQRAQIKGKASLLA  417

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF D
Sbjct  418  ALDYYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFHD  477

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  478  AVVEGHQNRQGQVRLRKPKQSIYTYPAPDCMCQA  511



>gb|KHG27420.1| hypothetical protein F383_15612 [Gossypium arboreum]
Length=498

 Score =   274 bits (701),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARIS LR++FPLME+KKSLASS ER  IKGKASLLA
Sbjct  345  LLAALGFDNNTRLYLASHKVYGGEARISTLRKIFPLMEDKKSLASSAERVHIKGKASLLA  404

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F+ 
Sbjct  405  AVDYYVGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQ  464

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A++EGH NRQG++RLRKP +S+YTYPAPDCMC+A
Sbjct  465  AMVEGHQNRQGQLRLRKPKQSIYTYPAPDCMCHA  498



>gb|KDO60569.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=473

 Score =   273 bits (698),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD +TRLYLASHKVYGG ARISALRRLFPLME+KKSLASSEER  +KGKASLLA
Sbjct  320  LLAALGFDKSTRLYLASHKVYGGEARISALRRLFPLMEDKKSLASSEERAGVKGKASLLA  379

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHS+IFISASPGNMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EFQ 
Sbjct  380  ALDYYVSMHSNIFISASPGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQ  439

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV+EGH NRQG+IR+RKP +S+YTYPAPDCMC+
Sbjct  440  AVVEGHENRQGQIRIRKPKQSIYTYPAPDCMCH  472



>gb|KCW54609.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=506

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKV-YGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLL  179
            LLAALGFDN TRLYLASHKV YGG ARIS LR++FPLME+KKSLAS++ER +IKGKASLL
Sbjct  352  LLAALGFDNTTRLYLASHKVVYGGEARISMLRKMFPLMEDKKSLASADERAQIKGKASLL  411

Query  180  AAVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQ  359
            AA+DYY+ MHSDIFISASPGNMHNA+VGHRTY N+KTIRP+M LLGQLFLNKN++W EFQ
Sbjct  412  AALDYYISMHSDIFISASPGNMHNALVGHRTYENMKTIRPSMALLGQLFLNKNISWSEFQ  471

Query  360  DAVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +A+IEGH NRQG+IRLRKP +SLYTYPAPDCMC+A
Sbjct  472  EAIIEGHKNRQGQIRLRKPKQSLYTYPAPDCMCSA  506



>gb|KJB44059.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=518

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSLASS ER  IKGKASLLA
Sbjct  365  LLAALGFDNNTRLYLASHKVYGGEARISTLRNLFPLMEDKKSLASSAERVHIKGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDY+VGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F+ 
Sbjct  425  AVDYHVGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQ  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMC+A
Sbjct  485  AVVEGHQNRQGQLRLRKPKQSIYTYPAPDCMCHA  518



>gb|KJB18179.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18180.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18183.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18184.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=518

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR  FP ME+KKSLASSEER  IKGKASLLA
Sbjct  365  LLAALGFDNSTRLYLASHKVYGGEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ 
Sbjct  425  AVDYYVGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQ  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  485  AVVEGHQNRQGQLRLRKPKQSIYTYPAPDCMCQA  518



>gb|KJB18182.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=519

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR  FP ME+KKSLASSEER  IKGKASLLA
Sbjct  366  LLAALGFDNSTRLYLASHKVYGGEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLA  425

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ 
Sbjct  426  AVDYYVGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQ  485

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  486  AVVEGHQNRQGQLRLRKPKQSIYTYPAPDCMCQA  519



>ref|XP_007047791.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOX91948.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=518

 Score =   273 bits (697),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  365  LLAALGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSEERVHIKGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGMHSDIF+SASPGNMHNA++GHRT+ NLKTI+PNM LLGQLFLNK+++W EF+ 
Sbjct  425  AVDYYVGMHSDIFVSASPGNMHNALMGHRTFENLKTIKPNMALLGQLFLNKSISWSEFRQ  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG+++LRKP +S+YTYPAPDCMC A
Sbjct  485  AVVEGHQNRQGQLKLRKPKQSIYTYPAPDCMCQA  518



>ref|XP_006426272.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|ESR39512.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|KDO60568.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=539

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD +TRLYLASHKVYGG ARISALRRLFPLME+KKSLASSEER  +KGKASLLA
Sbjct  386  LLAALGFDKSTRLYLASHKVYGGEARISALRRLFPLMEDKKSLASSEERAGVKGKASLLA  445

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHS+IFISASPGNMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EFQ 
Sbjct  446  ALDYYVSMHSNIFISASPGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQ  505

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV+EGH NRQG+IR+RKP +S+YTYPAPDCMC+
Sbjct  506  AVVEGHENRQGQIRIRKPKQSIYTYPAPDCMCH  538



>ref|XP_006466306.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=539

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD +TRLYLASHKVYGG ARISALRRLFPLME+KKSLASSEER  +KGKASLLA
Sbjct  386  LLAALGFDKSTRLYLASHKVYGGEARISALRRLFPLMEDKKSLASSEERAGVKGKASLLA  445

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHS+IFISASPGNMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EFQ 
Sbjct  446  ALDYYVSMHSNIFISASPGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQ  505

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV+EGH NRQG+IR+RKP +S+YTYPAPDCMC+
Sbjct  506  AVVEGHENRQGQIRIRKPKQSIYTYPAPDCMCH  538



>ref|XP_010523310.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Tarenaya hassleriana]
Length=445

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG AR+SALR++FP ME+K+SLASS ER  IKGKASLLA
Sbjct  292  LLAALGFDNNTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSGERARIKGKASLLA  351

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EFQ 
Sbjct  352  AVDYYVSMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQ  411

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
             V EGH NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  412  KVGEGHVNRQGQIRLRKPKQSLYTYPAPDCMCHV  445



>ref|XP_010113429.1| hypothetical protein L484_026763 [Morus notabilis]
 gb|EXC35456.1| hypothetical protein L484_026763 [Morus notabilis]
Length=553

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR+LFP ME+KKSLASSEER +I GKASLLA
Sbjct  400  LLAALGFDNSTRLYLASHKVYGGEARISTLRQLFPFMEDKKSLASSEERSQITGKASLLA  459

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNAMVGHRTY+NLKTIRPNM L+GQLFLNK+++W +FQ 
Sbjct  460  AVDYYVSMHSDIFISASPGNMHNAMVGHRTYNNLKTIRPNMALMGQLFLNKSISWSDFQQ  519

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH +RQG+IRLR P +S+YTYP+PDCMC A
Sbjct  520  SVMEGHQSRQGQIRLRNPKQSIYTYPSPDCMCEA  553



>ref|XP_004288516.2| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARI  LR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  376  LLAALGFDNSTRLYLASHKVYGGEARIENLRHLFPLMEDKKSLASSEERALIKGKASLLA  435

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK++TW +FQ 
Sbjct  436  ALDYYVSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMGLLGQLFLNKSITWSDFQQ  495

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+EGH NRQG+IR RKP +S+YTYPAPDCMC A
Sbjct  496  SVVEGHENRQGQIRFRKPKQSIYTYPAPDCMCQA  529



>gb|EYU39303.1| hypothetical protein MIMGU_mgv1a004838mg [Erythranthe guttata]
Length=507

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR +FPLME+KKSLASSEER +I+GKASLLA
Sbjct  353  LLAALGFDNSTRLYLASHKVYGGEARISTLRSMFPLMEDKKSLASSEERAQIQGKASLLA  412

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRTY N+KTIRPNM LLGQLFLNK+L W EF++
Sbjct  413  ALDYYVSMHSDIFISASPGNMHNAVVGHRTYENMKTIRPNMGLLGQLFLNKSLIWTEFEE  472

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV++GH +RQG++RLRKP +S+YTYPAPDCMC+
Sbjct  473  AVMQGHKSRQGQLRLRKPRQSIYTYPAPDCMCS  505



>gb|EYU30936.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
 gb|EYU30937.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=511

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN TRLYLASHKVYGG ARISALR LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  357  LLAALGFDNTTRLYLASHKVYGGEARISALRSLFPLMEDKKSLASSEERAQIKGKASLLA  416

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVD+YV +HSDIF+SASPGNMHNA+VGHRTY N KTIRPNM LLGQLFLNK+L W EF+ 
Sbjct  417  AVDHYVSIHSDIFVSASPGNMHNAVVGHRTYRNTKTIRPNMALLGQLFLNKSLDWAEFEK  476

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH +RQG +RLRK  +S+YTYPAPDCMCNA
Sbjct  477  AVVEGHKSRQGMLRLRKSEQSIYTYPAPDCMCNA  510



>gb|EYU30935.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=522

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN TRLYLASHKVYGG ARISALR LFPLME+KKSLASSEER +IKGKASLLA
Sbjct  368  LLAALGFDNTTRLYLASHKVYGGEARISALRSLFPLMEDKKSLASSEERAQIKGKASLLA  427

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVD+YV +HSDIF+SASPGNMHNA+VGHRTY N KTIRPNM LLGQLFLNK+L W EF+ 
Sbjct  428  AVDHYVSIHSDIFVSASPGNMHNAVVGHRTYRNTKTIRPNMALLGQLFLNKSLDWAEFEK  487

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH +RQG +RLRK  +S+YTYPAPDCMCNA
Sbjct  488  AVVEGHKSRQGMLRLRKSEQSIYTYPAPDCMCNA  521



>ref|XP_006394027.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31313.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=506

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  353  LLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLA  412

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  413  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  472

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  473  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  506



>ref|XP_006394028.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31314.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=507

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  354  LLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLA  413

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  414  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  473

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  474  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  507



>ref|XP_009130513.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=506

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  353  LLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLA  412

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  413  ALDYYVSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  472

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  473  AIGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  506



>ref|XP_009130514.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
Length=505

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  352  LLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLA  411

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  412  ALDYYVSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  471

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  472  AIGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  505



>emb|CDY37829.1| BnaAnng04900D [Brassica napus]
Length=505

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  352  LLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLA  411

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  412  ALDYYVSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  471

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  472  AIGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  505



>ref|XP_008440542.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=513

 Score =   270 bits (689),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            L+AALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSL S  E  +IKGKASLLA
Sbjct  360  LMAALGFDNNTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLTSGSELAQIKGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNAMVGHRTY NLKTIRPNM LLGQLF+NK++ W +FQ 
Sbjct  420  AVDYYVSMHSDIFISASPGNMHNAMVGHRTYENLKTIRPNMALLGQLFMNKSIIWSDFQQ  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A +EGH NRQG+IRLRKP +S+YTYPAPDC+C+A
Sbjct  480  ATVEGHKNRQGQIRLRKPKQSIYTYPAPDCVCHA  513



>ref|XP_010523312.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=517

 Score =   269 bits (688),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG AR+SALR++FP ME+K+SLASS ER  IKGKASLLA
Sbjct  364  LLAALGFDNNTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSGERARIKGKASLLA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EFQ 
Sbjct  424  AVDYYVSMHSDIFISASPGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQ  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
             V EGH NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  484  KVGEGHVNRQGQIRLRKPKQSLYTYPAPDCMCHV  517



>emb|CDY33958.1| BnaC02g43790D [Brassica napus]
Length=505

 Score =   269 bits (687),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  352  LLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLA  411

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  412  ALDYYVSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  471

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  472  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  505



>ref|XP_006280335.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
 gb|EOA13233.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
Length=508

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  355  LLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLA  414

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  415  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWADFQQ  474

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  475  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  508



>ref|XP_010444520.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=507

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  354  LLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLA  413

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  414  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  473

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  474  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  507



>ref|XP_010547595.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=513

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG AR+SALR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  360  LLAALGFDNSTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSEERARIKGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRT+ N+KT+RPNM L+ QLFL KN+TW EFQ 
Sbjct  420  AVDYYVSMHSDIFISASPGNMHNALVGHRTFENMKTVRPNMALIEQLFLRKNITWMEFQQ  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV EGH NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  480  AVGEGHVNRQGQIRLRKPKQSLYTYPAPDCMCHV  513



>ref|XP_010523308.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010523309.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
Length=517

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG AR+SALR++FP ME+K+SLASS ER  IKGKASLLA
Sbjct  364  LLAALGFDNNTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSGERARIKGKASLLA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EFQ 
Sbjct  424  AVDYYVSMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQ  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
             V EGH NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  484  KVGEGHVNRQGQIRLRKPKQSLYTYPAPDCMCHV  517



>ref|XP_002864958.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41217.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  351  LLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLA  410

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  411  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  470

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  471  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  504



>ref|XP_010484355.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  355  LLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLA  414

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  415  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  474

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  475  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  508



>ref|XP_010463027.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  355  LLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLA  414

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  415  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  474

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  475  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  508



>ref|NP_201350.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAE99053.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED98060.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  351  LLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLA  410

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  411  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  470

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  471  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  504



>dbj|BAB11569.1| unnamed protein product [Arabidopsis thaliana]
Length=523

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  370  LLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLA  429

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  430  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  489

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  490  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  523



>gb|AAM13166.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91219.1| unknown protein [Arabidopsis thaliana]
Length=504

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLA
Sbjct  351  LLAAFGFDNNTRLYLASHKVYGGEARISTLRQVFPKMEDKRSLASSEERARIKGKASLLA  410

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  411  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  470

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  471  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  504



>ref|XP_009150636.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 emb|CDY08790.1| BnaA06g24340D [Brassica napus]
Length=503

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASS ER  IKGKASLLA
Sbjct  350  LLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSAERARIKGKASLLA  409

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  410  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  469

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  470  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  503



>emb|CDY14569.1| BnaC03g48900D [Brassica napus]
Length=503

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASS ER  IKGKASLLA
Sbjct  350  LLAAFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSAERARIKGKASLLA  409

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ 
Sbjct  410  ALDYYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQ  469

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+ EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  470  ALGEGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  503



>ref|XP_004509777.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=501

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAA+GFDN+T LYLASHKVYGG ARIS LR+LFPLME+KK+LASS ER +IKGKASLLA
Sbjct  348  LLAAMGFDNSTHLYLASHKVYGGGARISTLRQLFPLMEDKKTLASSFERAQIKGKASLLA  407

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF+ 
Sbjct  408  ALDYYISVHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTMEWSEFEH  467

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  468  AVVEGHENRQGQLRLRKPKQSIYTYPAPDCMCQA  501



>gb|AFK40388.1| unknown [Lotus japonicus]
Length=502

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+ RLYLASHKVYGG ARIS LR+LFPLME+KKSLASS ER +IKGKASLL 
Sbjct  349  LLAALGFDNSARLYLASHKVYGGEARISTLRQLFPLMEDKKSLASSYERFQIKGKASLLT  408

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPN+ L+GQLFLNK + W EF+ 
Sbjct  409  ALDYYVGLHSDIFISASPGNMHNAVVGHRTYLNLKTIRPNLVLMGQLFLNKTMEWSEFEH  468

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  469  AVVEGHQNRQGQLRLRKPKQSIYTYPAPDCMCQA  502



>ref|XP_004143441.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004160919.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN48703.1| hypothetical protein Csa_6G498990 [Cucumis sativus]
Length=513

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            L+AALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSL S  E  +IKGKASLLA
Sbjct  360  LMAALGFDNNTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLTSGSELAQIKGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M+SDIFISASPGNMHNAMVGHRTY NLKTIRPNM LLGQLF+NK++ W +F  
Sbjct  420  AVDYYVSMYSDIFISASPGNMHNAMVGHRTYENLKTIRPNMALLGQLFMNKSIIWSDFHQ  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A +EGH NRQG+IRLRKP +S+YTYPAPDC+C+A
Sbjct  480  ATVEGHKNRQGQIRLRKPKQSIYTYPAPDCVCHA  513



>dbj|BAE71212.1| hypothetical protein [Trifolium pratense]
Length=404

 Score =   261 bits (668),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARI+ L+ LFPLME+KKSL S  ER  IKGKASLLA
Sbjct  251  LLAALGFDNSTRLYLASHKVYGGGARIATLKELFPLMEDKKSLTSPFERTLIKGKASLLA  310

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA+VGHR+Y NLKTIRPNMQL+GQLFLNK + W EF+ 
Sbjct  311  ALDYYISMHSDIFISASPGNMHNALVGHRSYLNLKTIRPNMQLMGQLFLNKTMEWSEFEH  370

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH  RQG++RLRKP +S+YTYPAPDCMC A
Sbjct  371  AVVEGHETRQGQLRLRKPKQSIYTYPAPDCMCQA  404



>ref|XP_003613050.1| DUF246 domain-containing protein [Medicago truncatula]
Length=282

 Score =   257 bits (656),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGGAARIS L++LFPLME+KKSL    ER  IKGKASLLA
Sbjct  129  LLAALGFDNSTRLYLASHKVYGGAARISTLKQLFPLMEDKKSLTLPFERALIKGKASLLA  188

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF+ 
Sbjct  189  ALDYYISIHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTMEWSEFEH  248

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH +RQG++RLRKP +S+YTYP PDCMC  
Sbjct  249  AVVEGHESRQGQLRLRKPKQSIYTYPVPDCMCQG  282



>ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=522

 Score =   265 bits (676),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+T LYLASHKVYGG ARIS+LR+LFPLME+KKSLAS EER +I+GKASLLA
Sbjct  360  LLAALGFDNSTHLYLASHKVYGGEARISSLRKLFPLMEDKKSLASEEERVKIEGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W +FQ 
Sbjct  420  AVDYYVSMHSDIFISASPGNMHNALVGHRAYQNLKTIRPNMALLGQLFLNKSMGWSDFQR  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH +RQG+IRL+K  +S+YTYPAPDCMC A
Sbjct  480  AVLEGHKDRQGQIRLKKEKQSIYTYPAPDCMCRA  513



>ref|XP_010519195.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=518

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +LAALGFDN+TRLYLASHKVYGG AR+S LR++FP ME+K+SLASS +R  IKGKASLLA
Sbjct  365  VLAALGFDNSTRLYLASHKVYGGEARVSTLRQVFPRMEDKRSLASSSDRARIKGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHRT+ N KTIRPNM L+GQLFLNKN+TW EFQ 
Sbjct  425  AVDYYVSMHSDIFISASPGNMHNALVGHRTFENRKTIRPNMALIGQLFLNKNITWTEFQQ  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV EGH NR G+IRLRK  +SLYTYPAPDCMC+ 
Sbjct  485  AVGEGHVNRHGQIRLRKTKQSLYTYPAPDCMCHV  518



>gb|EPS72903.1| hypothetical protein M569_01846, partial [Genlisea aurea]
Length=497

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN TRLYLASHKVYGG ARIS LR LFPLME+KKSL + EE   IKGKASLLA
Sbjct  345  LLAALGFDNTTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLTTEEELSRIKGKASLLA  404

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+VGHRT  N KTIRPNM LLGQLFLNK+LTW EF+D
Sbjct  405  AVDYYVSMQSDIFISASPGNMHNALVGHRTLENKKTIRPNMPLLGQLFLNKSLTWSEFRD  464

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            +V  GH +RQG++R RKP +SLYTYPAPDCMC+
Sbjct  465  SVFVGHKSRQGQLRFRKPQQSLYTYPAPDCMCS  497



>ref|XP_010680342.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=506

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG AR++ L++LFPLME+KKSLAS++ER  IKGKASLLA
Sbjct  353  LLAALGFDNSTRLYLASHKVYGGRARLATLKKLFPLMEDKKSLASADERARIKGKASLLA  412

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV MHSDIFISASPGNMHNA+VGHRT+ +LKTIRPNM LLGQLFL+KN++W +F+ 
Sbjct  413  ALDYYVSMHSDIFISASPGNMHNALVGHRTFESLKTIRPNMGLLGQLFLDKNMSWVDFRQ  472

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+EGH  R G++RLRKP +S+YTYPAPDCMC A
Sbjct  473  AVVEGHHYRHGQLRLRKPKQSIYTYPAPDCMCRA  506



>ref|XP_010107675.1| hypothetical protein L484_007693 [Morus notabilis]
 gb|EXC16648.1| hypothetical protein L484_007693 [Morus notabilis]
Length=529

 Score =   259 bits (663),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N TRLYLASHKVYGG ARIS L +LFPLME+KKSL+S++ER +++GKASLLA
Sbjct  376  LLAALGFSNRTRLYLASHKVYGGEARISTLCKLFPLMEDKKSLSSADERSKVEGKASLLA  435

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHR   N+KTIRPNM LLGQLFLNK + WPEFQ 
Sbjct  436  AVDYYVSMHSDIFISASPGNMHNALVGHRALLNMKTIRPNMGLLGQLFLNKTMEWPEFQQ  495

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV++GH NRQG+IRLRK  +S+YTYPAPDCMC+A
Sbjct  496  AVVDGHKNRQGQIRLRKEKQSIYTYPAPDCMCSA  529



>ref|XP_003613049.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES96007.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=503

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGGAARIS L++LFPLME+KKSL    ER  IKGKASLLA
Sbjct  350  LLAALGFDNSTRLYLASHKVYGGAARISTLKQLFPLMEDKKSLTLPFERALIKGKASLLA  409

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF+ 
Sbjct  410  ALDYYISIHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTMEWSEFEH  469

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV+EGH +RQG++RLRKP +S+YTYP PDCMC 
Sbjct  470  AVVEGHESRQGQLRLRKPKQSIYTYPVPDCMCQ  502



>gb|ABJ96379.1| expressed protein [Prunus persica]
Length=517

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLAS+EER +++GKASLLA
Sbjct  364  LLAALGFNNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASAEERAKVEGKASLLA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EFQ 
Sbjct  424  AVDYYVSMQSDIFISASPGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQH  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV++GH +RQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  484  AVLDGHKSRQGQIRLRKEKQSIYTYPAPDCMCQA  517



>ref|XP_007222858.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
 gb|EMJ24057.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
Length=520

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLAS+EER +++GKASLLA
Sbjct  367  LLAALGFNNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASAEERAKVEGKASLLA  426

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EFQ 
Sbjct  427  AVDYYVSMQSDIFISASPGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQH  486

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV++GH +RQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  487  AVLDGHKSRQGQIRLRKEKQSIYTYPAPDCMCQA  520



>gb|KCW68511.1| hypothetical protein EUGRSUZ_F02148 [Eucalyptus grandis]
Length=491

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N+TRLYLASHKVYGG +RIS LR+LFPLME+KKSL S+EER ++KGKASLLA
Sbjct  338  LLAALGFSNSTRLYLASHKVYGGESRISTLRKLFPLMEDKKSLTSAEERAKVKGKASLLA  397

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SD+FISASPGNMHNA++GHR + NLKTIRPNM LLGQLFLNK++ W +FQ 
Sbjct  398  AVDYYVSMQSDVFISASPGNMHNAVLGHRAFLNLKTIRPNMALLGQLFLNKSMEWSDFQH  457

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AVIEGH  RQG IRLRK  +S+YTYPAPDCMC A
Sbjct  458  AVIEGHIKRQGHIRLRKEKQSIYTYPAPDCMCQA  491



>ref|XP_010692399.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=503

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF NNTRLYLASHKVYGG ARIS LR+LFP +E+K+SLA+++ER +++GKASLLA
Sbjct  350  LLAALGFSNNTRLYLASHKVYGGEARISTLRKLFPRIEDKRSLATADERKKVEGKASLLA  409

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNAM+GHR Y NLKTIRPNM LLGQLFLN+++ WP FQ+
Sbjct  410  AVDYYVSMHSDIFISASPGNMHNAMLGHRAYQNLKTIRPNMALLGQLFLNQSIDWPGFQN  469

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            AV+ GH NRQG+IR+RK  +S+YTYP PDCMC
Sbjct  470  AVVVGHKNRQGQIRVRKEKQSIYTYPVPDCMC  501



>ref|XP_010061545.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Eucalyptus grandis]
Length=517

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N+TRLYLASHKVYGG +RIS LR+LFPLME+KKSL S+EER ++KGKASLLA
Sbjct  364  LLAALGFSNSTRLYLASHKVYGGESRISTLRKLFPLMEDKKSLTSAEERAKVKGKASLLA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SD+FISASPGNMHNA++GHR + NLKTIRPNM LLGQLFLNK++ W +FQ 
Sbjct  424  AVDYYVSMQSDVFISASPGNMHNAVLGHRAFLNLKTIRPNMALLGQLFLNKSMEWSDFQH  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AVIEGH  RQG IRLRK  +S+YTYPAPDCMC A
Sbjct  484  AVIEGHIKRQGHIRLRKEKQSIYTYPAPDCMCQA  517



>ref|XP_006852943.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
 gb|ERN14410.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
Length=446

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSLAS EE   ++GKAS+LA
Sbjct  292  LLAALGFDNNTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASKEELAMVEGKASMLA  351

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV +HSD+FISASPGNMHNAMVGHRTY NLKTIRPNM LLGQL+LNK++ W +FQ 
Sbjct  352  ALDYYVSLHSDVFISASPGNMHNAMVGHRTYLNLKTIRPNMGLLGQLYLNKSMGWSDFQA  411

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV +GH  RQG++RLRK  +S+YTYPAPDCMC +
Sbjct  412  AVRKGHEQRQGKMRLRKAKQSIYTYPAPDCMCGS  445



>ref|XP_008219267.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=520

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N+TRLYLASH VYGG ARIS LRRLFPLME+KKSLAS+EER +++GKASLLA
Sbjct  367  LLAALGFNNSTRLYLASHMVYGGEARISTLRRLFPLMEDKKSLASAEERAKVEGKASLLA  426

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EFQ 
Sbjct  427  AVDYYVSMQSDIFISASPGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQH  486

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV++GH +RQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  487  AVLDGHKSRQGQIRLRKEKQSIYTYPAPDCMCRA  520



>emb|CAN78778.1| hypothetical protein VITISV_029752 [Vitis vinifera]
Length=507

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS+EE  +++GKASLLA
Sbjct  354  LLAALGFSNTTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASAEELAKVEGKASLLA  413

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W EFQ 
Sbjct  414  AVDYYVSMHSDIFISASPGNMHNALVGHRAYKNLKTIRPNMALLGQLFLNKSIEWSEFQQ  473

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH +RQG+IR RK  +S+YTYP  DCMC A
Sbjct  474  AVLNGHKSRQGQIRFRKENQSIYTYPITDCMCQA  507



>ref|XP_004237994.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=516

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF+N+TRLYLASHKVYGG ARISALR+LFP ME+KKSLASS E  E++GKASLLA
Sbjct  363  LLSALGFNNSTRLYLASHKVYGGEARISALRQLFPFMEDKKSLASSHELSEVEGKASLLA  422

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++GHR Y NLKT+RPNM LLG+LFLNK + W EFQ 
Sbjct  423  AVDYYVSMQSDIFISASPGNMHNALLGHRAYKNLKTVRPNMTLLGKLFLNKTIEWSEFQQ  482

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV +GH NRQG++R+RK  +S+YTYPAPDCMC A
Sbjct  483  AVQQGHKNRQGQMRIRKEKQSIYTYPAPDCMCKA  516



>ref|XP_006338062.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=516

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF+N+TRLYLASHKVYGG ARIS+LR+LFP ME+KKSLASS E  E++GKASLLA
Sbjct  363  LLSALGFNNSTRLYLASHKVYGGEARISSLRQLFPFMEDKKSLASSHELSEVEGKASLLA  422

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EFQ 
Sbjct  423  AVDYYVSMQSDIFISASPGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMQWSEFQQ  482

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV +GH NRQG++R+RK  +S+YTYPAPDCMC A
Sbjct  483  AVQQGHKNRQGQMRIRKEKQSIYTYPAPDCMCKA  516



>ref|XP_002283844.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Vitis 
vinifera]
 emb|CBI19265.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS+EE  +++GKASLLA
Sbjct  362  LLAALGFSNTTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASAEELAKVEGKASLLA  421

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W EFQ 
Sbjct  422  AVDYYVSMHSDIFISASPGNMHNALVGHRAYKNLKTIRPNMALLGQLFLNKSIEWSEFQQ  481

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH +RQG+IR RK  +S+YTYP  DCMC A
Sbjct  482  AVLNGHKSRQGQIRFRKENQSIYTYPITDCMCQA  515



>ref|XP_010937178.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=560

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD+ TRLYLASHKVYGG ARIS+LR+LFPLME+KKSLAS EE  +++GKASLLA
Sbjct  407  LLAALGFDSRTRLYLASHKVYGGEARISSLRKLFPLMEDKKSLASEEELAKVEGKASLLA  466

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SD+FISASPGNMHNA+VG RTY NLKTIRPNM LLGQLFLNK++ W EFQ 
Sbjct  467  AVDYYVSMQSDVFISASPGNMHNAVVGRRTYLNLKTIRPNMSLLGQLFLNKSMEWSEFQQ  526

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
             V  GH NRQG+IR RKP +S+YTYPAPDCMC 
Sbjct  527  VVQAGHKNRQGQIRPRKPKQSIYTYPAPDCMCQ  559



>ref|XP_009401410.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401411.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=518

 Score =   253 bits (647),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD++TRLYLASHKVYGG ARIS+LR LFPLM++KKSLAS EE  +++GKASLLA
Sbjct  365  LLAALGFDSSTRLYLASHKVYGGEARISSLRMLFPLMDDKKSLASEEELAKVEGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDY+V MHSDIFISASPGNMHNA++G+RTY NLKTIRPNM LLGQLFLNK + W EFQ 
Sbjct  425  AVDYHVSMHSDIFISASPGNMHNAVLGYRTYENLKTIRPNMGLLGQLFLNKTMDWSEFQR  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV  GH  RQG+IRLRKP +S+YTYPAPDCMC 
Sbjct  485  AVQAGHKARQGQIRLRKPKQSIYTYPAPDCMCQ  517



>ref|XP_010523344.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
 ref|XP_010523345.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=519

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+NNTRLYLASH+VYGG  RISALR+LFP MENKKSLAS EE  +++GKASLLA
Sbjct  364  LLAALGFNNNTRLYLASHQVYGGEQRISALRKLFPEMENKKSLASMEELADVEGKASLLA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQLFLNK++ WPEF+ 
Sbjct  424  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMVLLGQLFLNKSIGWPEFER  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+  H NRQG+IR+RK  +S+YTYPAPDCMC A
Sbjct  484  AVVNSHKNRQGQIRIRKEKQSIYTYPAPDCMCKA  517



>ref|XP_010277497.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=514

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +3

Query  24   DNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVG  203
            DN+TRLYLASHKVYGG ARI ALR LFPLME+KKSLAS EER +I+GKASLLAAVDYYV 
Sbjct  368  DNSTRLYLASHKVYGGEARIQALRNLFPLMEDKKSLASEEERAKIEGKASLLAAVDYYVS  427

Query  204  MHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEGHA  383
            MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQL LNK++ W +FQ AV+EGH 
Sbjct  428  MHSDIFISASPGNMHNALVGHRTYENLKTIRPSMALLGQLLLNKSIEWSKFQQAVLEGHK  487

Query  384  NRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            NRQG+IRLRK  +S+YTYPAPDCMC+ 
Sbjct  488  NRQGQIRLRKEKQSIYTYPAPDCMCHV  514



>emb|CDP11502.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N+T LYLASHKVYGG ARIS L++LFP ME+KKSL+S+EER ++ GK+SLLA
Sbjct  362  LLAALGFNNSTTLYLASHKVYGGEARISTLKKLFPYMEDKKSLSSAEERAKVDGKSSLLA  421

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYVGM SDIF+SASPGNMHNA+VGHRTY+NLKTIRPNM LLG+LFLNK L W +FQ 
Sbjct  422  AVDYYVGMQSDIFVSASPGNMHNALVGHRTYNNLKTIRPNMVLLGKLFLNKTLEWSDFQQ  481

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV  GH NRQG++RLRK  +S+YTYP PDCMC A
Sbjct  482  AVKNGHKNRQGQLRLRKEKQSIYTYPIPDCMCQA  515



>ref|XP_007018221.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY15446.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=540

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N+TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS +E  EI+GKASLLA
Sbjct  387  LLAALGFNNSTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASVKELAEIEGKASLLA  446

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG LFLNK++ W EFQ 
Sbjct  447  AVDYYVSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMLLLGPLFLNKSMEWSEFQH  506

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AVI  H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  507  AVINRHKNRQGQIRLRKEEQSIYTYPAPDCMCRA  540



>ref|XP_004301363.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=513

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N+TRLYLASHKVYGG ARIS LRRLFPLME+KKSL S++ER +++GKASL A
Sbjct  360  LLAALGFNNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLTSAKERAKVEGKASLSA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LL +LFLNK++ W EFQ 
Sbjct  420  AVDYYVSMQSDIFISASPGNMHNALVCHRAYMNLKTIRPSMTLLSKLFLNKSMQWSEFQQ  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV++GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  480  AVLDGHKNRQGQIRLRKEKQSIYTYPAPDCMCQA  513



>ref|XP_010939815.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=558

 Score =   253 bits (645),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD+ TRLYLASHKVYGG ARI++LR+LFPLME+KKSLAS EE  +++GKASLLA
Sbjct  405  LLAALGFDSKTRLYLASHKVYGGEARIASLRKLFPLMEDKKSLASEEELAKVEGKASLLA  464

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SD+FISASPGNMHNA+VG RTY NLKTIRPNM LLGQLFLNK++ W EFQ 
Sbjct  465  AVDYYVSMRSDVFISASPGNMHNAVVGRRTYLNLKTIRPNMALLGQLFLNKSMEWSEFQQ  524

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
             +  GH NRQG+IR RKP +S+YTYP+PDCMC 
Sbjct  525  VIQSGHKNRQGQIRQRKPKQSIYTYPSPDCMCQ  557



>ref|XP_009624657.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=516

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL ALGF+N+TRLYLASHKVYGG ARISALR+LFP ME+KKSLASS E  E++GKASLLA
Sbjct  363  LLTALGFNNSTRLYLASHKVYGGEARISALRQLFPFMEDKKSLASSHELSEVEGKASLLA  422

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV M SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EFQ 
Sbjct  423  ALDYYVSMQSDIFISASPGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMEWSEFQR  482

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            A+ +GH NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  483  AIQQGHKNRQGQMRLRKEKQSIYTYPAPDCMC  514



>ref|XP_009785662.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=516

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL ALGF+N+TRLYLASHKVYGG ARISAL +LFP ME+KKSLA+S E  E++GKASLLA
Sbjct  363  LLTALGFNNSTRLYLASHKVYGGEARISALHQLFPFMEDKKSLAASHELSEVEGKASLLA  422

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYYV M SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EFQ 
Sbjct  423  ALDYYVSMQSDIFISASPGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMEWSEFQR  482

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV +GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  483  AVQQGHKNRQGQMRLRKEKQSIYTYPAPDCMCKA  516



>gb|EPS73888.1| hypothetical protein M569_00867, partial [Genlisea aurea]
Length=498

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN TRLYLASHKVYGG ARISALR LFPLME+KKSL+S+EER  I GKASL+A
Sbjct  346  LLAALGFDNTTRLYLASHKVYGGEARISALRSLFPLMEDKKSLSSAEERRRINGKASLMA  405

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFL-NKNLTWPEFQ  359
            AVDY+VG+ SDIF+SASPGNMHN MVGHR+Y N KTIRPNM LLGQLFL  KNL+W EF+
Sbjct  406  AVDYHVGLRSDIFVSASPGNMHNLMVGHRSYENKKTIRPNMALLGQLFLTTKNLSWTEFE  465

Query  360  DAVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            + VI+GH +R+G ++LR+P +S+YTYPAPDCMC
Sbjct  466  NGVIDGHKDRRGILKLRRPKQSIYTYPAPDCMC  498



>gb|KHN09000.1| DUF246 domain-containing protein [Glycine soja]
Length=510

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLA
Sbjct  357  LLAALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKVKGKASLLA  416

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+  HR Y NLKTIRPNM+LLGQLF NK++ W EFQ 
Sbjct  417  AVDYYVSMQSDIFISASPGNMHNALEAHRAYMNLKTIRPNMRLLGQLFQNKSIGWSEFQL  476

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV++GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  477  AVLDGHKNRQGQIRLRKENQSIYTYPAPDCMCRA  510



>ref|XP_009376221.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Pyrus x bretschneideri]
Length=520

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLAS+KVYGG ARIS LRRLFP ME+KKSLAS+EER +++GKASLLA
Sbjct  367  LLAALGFNNTTRLYLASYKVYGGEARISTLRRLFPDMEDKKSLASAEERAKVEGKASLLA  426

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LF+NK++ W +FQ 
Sbjct  427  AVDYYVSMQSDIFISASPGNMHNALVGHRAYMNLKTIRPNMALLGKLFVNKSMEWSDFQR  486

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV +GH  R G++RLRK  +S+YTYPAPDCMC A
Sbjct  487  AVSDGHKTRXGQMRLRKEKQSIYTYPAPDCMCRA  520



>ref|XP_008368388.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=519

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG ARIS LRRLFP M++KK LAS+EER +++GKASLLA
Sbjct  366  LLAALGFNNTTRLYLASHKVYGGEARISTLRRLFPDMDDKKGLASAEERAKVEGKASLLA  425

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LF+NK+  W +FQ 
Sbjct  426  AVDYYVSMQSDIFISASPGNMHNALVGHRAYMNLKTIRPNMALLGKLFVNKSXEWSDFQR  485

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV +GH  RQG++RLRK  +S+YTYPAPDCMC +
Sbjct  486  AVSDGHKTRQGQMRLRKEKQSIYTYPAPDCMCQS  519



>emb|CAA23010.1| PsRT17-1 like protein [Arabidopsis thaliana]
 emb|CAB79363.1| PsRT17-1 like protein [Arabidopsis thaliana]
Length=431

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP +ENKKSLAS+EE  +++GKASL+A
Sbjct  277  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEELADVQGKASLMA  336

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+  HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ 
Sbjct  337  AVDYYVSMKSDIFISASPGNMHNALQAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEG  396

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            AV+ GH NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  397  AVMNGHKNRQGQLRLRKQKQSIYTYPAPDCMC  428



>ref|XP_002867661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP +ENKKSLAS+EE  +++GKASL+A
Sbjct  365  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEELADVQGKASLMA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ 
Sbjct  425  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLEWSEFEG  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  485  AVVNGHRNRQGQLRLRKQKQSIYTYPAPDCMCKA  518



>gb|KJB58883.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=489

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL ALGF+NNT LYLASHKVYGG ARIS LR +FPLME+KKSLAS+ E  E++GKASL+A
Sbjct  336  LLTALGFNNNTHLYLASHKVYGGEARISTLRTMFPLMEDKKSLASAIELAEVEGKASLMA  395

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV + SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG LFLNK + W EFQ 
Sbjct  396  AVDYYVSLKSDIFISASPGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKTIEWSEFQH  455

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AVI GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  456  AVINGHKNRQGQMRLRKEKQSIYTYPAPDCMCRA  489



>gb|KFK28724.1| hypothetical protein AALP_AA7G039000 [Arabis alpina]
Length=513

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP+MENKKSLAS EE  +++GKASL+A
Sbjct  358  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPVMENKKSLASVEELADVEGKASLMA  417

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+ +NK+L W EF+ 
Sbjct  418  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVLVNKSLDWSEFEG  477

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +V+ GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  478  SVLNGHKNRQGQLRLRKEKQSIYTYPAPDCMCKA  511



>ref|XP_004501643.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=513

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N+TRLYLASHKVYGG AR+  L +LFP ME+KKSL S+E+  +IKGKASLLA
Sbjct  360  LLAALGFNNSTRLYLASHKVYGGKARLETLSKLFPFMEDKKSLVSAEKLTKIKGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDY+V +HSDIFISASPGNMHNA+V HR Y NLKTIRPNM LLGQLF NK++ W EFQ 
Sbjct  420  AVDYHVSLHSDIFISASPGNMHNALVAHRAYRNLKTIRPNMALLGQLFQNKSIGWSEFQR  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
             V++GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  480  TVLDGHKNRQGQIRLRKEKQSIYTYPAPDCMCKA  513



>ref|XP_008651492.1| PREDICTED: LOC100283829 isoform X1 [Zea mays]
 gb|ACF82519.1| unknown [Zea mays]
 tpg|DAA61414.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=447

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL ALGFDN TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   ++GKAS+LA
Sbjct  294  LLVALGFDNRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELANVEGKASVLA  353

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEFQ 
Sbjct  354  ALDYYISMHSDIFISASPGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQ  413

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
             V  GH  R G+IRLRK  +S+YTYPAPDCMC 
Sbjct  414  VVQAGHKGRYGQIRLRKATQSIYTYPAPDCMCQ  446



>ref|XP_003526543.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAAL F+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLA
Sbjct  358  LLAALSFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKVKGKASLLA  417

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+  HR Y NLKTIRPNM+LLGQLF NK++ W EFQ 
Sbjct  418  AVDYYVSMQSDIFISASPGNMHNALEAHRAYMNLKTIRPNMRLLGQLFQNKSIGWSEFQL  477

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV++GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  478  AVLDGHKNRQGQIRLRKENQSIYTYPAPDCMCRA  511



>ref|XP_006661225.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Oryza 
brachyantha]
Length=492

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD+ TR+YLASHKVYGG ARI +LR+LFPLME+K+SLAS EE   ++GKASLLA
Sbjct  339  LLAALGFDSRTRIYLASHKVYGGEARILSLRKLFPLMEDKRSLASEEELANVEGKASLLA  398

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA++ HRT+ NLKTIRPNM LLG++F+NK++ W EFQ+
Sbjct  399  ALDYYISMHSDIFISASPGNMHNALMAHRTFENLKTIRPNMALLGRIFVNKSMEWSEFQE  458

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV  GH  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  459  AVQAGHKGRYGQIRLRKPKQSIYTYPAPDCMCQ  491



>gb|KJB58881.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
 gb|KJB58882.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=518

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL ALGF+NNT LYLASHKVYGG ARIS LR +FPLME+KKSLAS+ E  E++GKASL+A
Sbjct  365  LLTALGFNNNTHLYLASHKVYGGEARISTLRTMFPLMEDKKSLASAIELAEVEGKASLMA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV + SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG LFLNK + W EFQ 
Sbjct  425  AVDYYVSLKSDIFISASPGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKTIEWSEFQH  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AVI GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  485  AVINGHKNRQGQMRLRKEKQSIYTYPAPDCMCRA  518



>ref|XP_002514041.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48624.1| conserved hypothetical protein [Ricinus communis]
Length=519

 Score =   246 bits (629),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N+TRLYLASHKVYGG AR+S L++LFP ME+KKSLAS+EE   ++GKASLLA
Sbjct  359  LLAALGFSNSTRLYLASHKVYGGEARVSTLKQLFPSMEDKKSLASAEELALVEGKASLLA  418

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG LFLNK++ W EFQ 
Sbjct  419  AVDYYVSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVLLGPLFLNKSVEWSEFQT  478

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV++GH NRQG+IRLRK  +S+YTYP PDCMC 
Sbjct  479  AVVKGHKNRQGQIRLRKEKQSIYTYPIPDCMCQ  511



>gb|AGV54860.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=516

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLA
Sbjct  363  LLAALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEELAKVKGKASLLA  422

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            +VDYYV MHSDIFISASPGNMHNA+V HR Y NLKTIRP+M  LG LF NK+++W EFQ 
Sbjct  423  SVDYYVSMHSDIFISASPGNMHNALVAHRAYMNLKTIRPSMGSLGHLFQNKSVSWSEFQR  482

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
             V++GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  483  VVLDGHKNRQGQIRLRKEKQSIYTYPAPDCMCRA  516



>ref|XP_009138156.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=515

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP++ENKKSLAS+EE  E++GKASL+A
Sbjct  361  LLSALGFTNNTRLYLASHQVYGGEARISTLRKLFPVLENKKSLASAEELAEVEGKASLMA  420

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+ 
Sbjct  421  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEG  480

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  481  AVVNGHKNRQGQLRLRKQKQSIYTYPAPDCMCKA  514



>ref|XP_006472463.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
Length=514

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS+EE  +I+GKASL A
Sbjct  361  LLAALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIASAEELAKIEGKASLSA  420

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LFLNK++ W EFQ 
Sbjct  421  AVDYYVSMQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMTLLGKLFLNKSMGWTEFQH  480

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV  GH NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  481  AVRNGHKNRLGHIRLRKSKQSIYTYPAPDCMCQS  514



>ref|XP_006472461.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 ref|XP_006472462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=517

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS+EE  +I+GKASL A
Sbjct  364  LLAALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIASAEELAKIEGKASLSA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LFLNK++ W EFQ 
Sbjct  424  AVDYYVSMQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMTLLGKLFLNKSMGWTEFQH  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV  GH NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  484  AVRNGHKNRLGHIRLRKSKQSIYTYPAPDCMCQS  517



>ref|XP_003602912.1| PsRT17-1 like protein [Medicago truncatula]
 gb|AES73163.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=517

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG AR+  L  LFP ME+KKSL S+E   ++ GKASLLA
Sbjct  364  LLAALGFNNRTRLYLASHKVYGGKARLETLSTLFPFMEDKKSLVSAETMAKVNGKASLLA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV MHSDIFISASPGNMHNA+V HR Y NLKTIRPNM LLGQLF NK++ W +FQ 
Sbjct  424  AVDYYVSMHSDIFISASPGNMHNALVAHRAYKNLKTIRPNMALLGQLFQNKSIGWSDFQR  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV++GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  484  AVLDGHKNRQGQIRLRKEKQSIYTYPAPDCMCRA  517



>ref|XP_011016934.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Populus 
euphratica]
Length=495

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N+TRLYLASHKVYGG ARISAL++LFPL+++KKSLAS+EE  ++ GKASLLA
Sbjct  342  LLAALGFSNSTRLYLASHKVYGGEARISALKKLFPLVDHKKSLASAEELAKVDGKASLLA  401

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEFQ 
Sbjct  402  AVDYYVSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQH  461

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH +RQG+IRLRK  +S+YTYP PDC C +
Sbjct  462  AVLSGHKSRQGQIRLRKERQSIYTYPIPDCSCQS  495



>ref|XP_011016933.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Populus 
euphratica]
Length=513

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N+TRLYLASHKVYGG ARISAL++LFPL+++KKSLAS+EE  ++ GKASLLA
Sbjct  360  LLAALGFSNSTRLYLASHKVYGGEARISALKKLFPLVDHKKSLASAEELAKVDGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEFQ 
Sbjct  420  AVDYYVSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQH  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH +RQG+IRLRK  +S+YTYP PDC C +
Sbjct  480  AVLSGHKSRQGQIRLRKERQSIYTYPIPDCSCQS  513



>ref|NP_001063155.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAD28369.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAF25069.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAG90088.1| unnamed protein product [Oryza sativa Japonica Group]
Length=512

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD+ TR+YLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE   ++GKAS+LA
Sbjct  359  LLAALGFDSRTRIYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELTNVEGKASVLA  418

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EFQ+
Sbjct  419  ALDYYISMHSDIFISASPGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQE  478

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV  GH  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  479  AVQAGHKGRYGQIRLRKPKQSIYTYPAPDCMCQ  511



>ref|XP_004956798.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=512

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L ALGFD+ TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE  +++GKAS+LA
Sbjct  359  VLVALGFDSRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELADVEGKASVLA  418

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA++ HRTY NLKTIRPNM LLG++F+NK++ W +FQ 
Sbjct  419  ALDYYISMHSDIFISASPGNMHNALLAHRTYENLKTIRPNMALLGRIFVNKSMEWLDFQQ  478

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV  GH  R G+IRLRKP +S+YTYPAPDCMC+
Sbjct  479  AVQAGHKGRYGQIRLRKPKQSIYTYPAPDCMCH  511



>ref|XP_003523785.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLA
Sbjct  358  LLAALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKVKGKASLLA  417

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+  +R Y NLKTIRP+M LLGQLF NK++ W EFQ 
Sbjct  418  AVDYYVSMQSDIFISASPGNMHNALAANRAYMNLKTIRPSMGLLGQLFQNKSIGWSEFQR  477

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+++GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  478  AILDGHKNRQGQIRLRKEKQSIYTYPAPDCMCRA  511



>ref|NP_194184.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAP68214.1| At4g24530 [Arabidopsis thaliana]
 dbj|BAE99793.1| PsRT17-1 like protein [Arabidopsis thaliana]
 gb|AEE84921.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=519

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP +ENKKSLAS+EE  +++GKASL+A
Sbjct  365  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEELADVQGKASLMA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+  HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ 
Sbjct  425  AVDYYVSMKSDIFISASPGNMHNALQAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEG  484

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            AV+ GH NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  485  AVMNGHKNRQGQLRLRKQKQSIYTYPAPDCMC  516



>gb|KHN08263.1| DUF246 domain-containing protein [Glycine soja]
Length=511

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLA
Sbjct  358  LLAALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKVKGKASLLA  417

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+  +R Y NLKTIRP+M LLGQLF NK++ W EFQ 
Sbjct  418  AVDYYVSMQSDIFISASPGNMHNALAANRAYMNLKTIRPSMGLLGQLFQNKSIGWSEFQR  477

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            A+++GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  478  AILDGHKNRQGQIRLRKEKQSIYTYPAPDCMCRA  511



>ref|XP_010439017.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
 ref|XP_010439018.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
 ref|XP_010439019.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=518

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP MENKKSLAS+EE  +I+GKASL+A
Sbjct  364  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGMENKKSLASAEELADIEGKASLMA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ 
Sbjct  424  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEG  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            AV+ GH NR G++RLRK  +S+YTYP PDCMC
Sbjct  484  AVVNGHKNRHGQLRLRKQKQSIYTYPVPDCMC  515



>ref|XP_002301095.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
 gb|EEE80368.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
Length=513

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N+TRLYLASHKVYGG ARISAL++LFPL+++KKSLAS+EE  ++ GKASLLA
Sbjct  360  LLAALGFSNSTRLYLASHKVYGGEARISALKKLFPLVDHKKSLASAEELAKVDGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEFQ 
Sbjct  420  AVDYYVSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQY  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH +RQG+IRLRK  +S+YTYP PDC C +
Sbjct  480  AVLSGHKSRQGQIRLRKERQSIYTYPIPDCSCQS  513



>ref|NP_001150199.1| LOC100283829 [Zea mays]
 gb|ACG38224.1| psRT17-1 like protein [Zea mays]
 tpg|DAA61416.1| TPA: psRT17-1 like protein [Zea mays]
Length=511

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL ALGFDN TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   ++GKAS+LA
Sbjct  358  LLVALGFDNRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELANVEGKASVLA  417

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEFQ 
Sbjct  418  ALDYYISMHSDIFISASPGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQ  477

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
             V  GH  R G+IRLRK  +S+YTYPAPDCMC 
Sbjct  478  VVQAGHKGRYGQIRLRKATQSIYTYPAPDCMCQ  510



>ref|XP_010448552.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=518

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP MENKKSLAS+EE  +++GKASL+A
Sbjct  364  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGMENKKSLASAEELADVEGKASLMA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ 
Sbjct  424  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEG  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH NR G++RLRK  +S+YTYP PDCMC  
Sbjct  484  AVVNGHKNRHGQLRLRKQKQSIYTYPVPDCMCKV  517



>emb|CDY03446.1| BnaC01g16360D [Brassica napus]
Length=613

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP++ENKKSLAS+EE  E++GKASL+A
Sbjct  459  LLSALGFTNNTRLYLASHQVYGGEARISTLRKLFPVLENKKSLASAEELAEVEGKASLMA  518

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+ 
Sbjct  519  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEG  578

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  579  AVVNGHKNRQGQLRLRKQKQSIYTYPAPDCMCKA  612



>ref|XP_010433755.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=529

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP MENKKSLAS+EE  +++GKASL+A
Sbjct  375  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGMENKKSLASAEELADVEGKASLMA  434

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ 
Sbjct  435  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEG  494

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH NR G++R+RK  +S+YTYPAPDCMC  
Sbjct  495  AVVNGHKNRHGQLRIRKQNQSIYTYPAPDCMCKV  528



>gb|KDP41479.1| hypothetical protein JCGZ_15886 [Jatropha curcas]
Length=513

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N+TRLYLASHKVYGG ARIS L++LFP ME+KKSLAS EE  E++GKASLLA
Sbjct  360  LLAALGFSNSTRLYLASHKVYGGEARISTLKQLFPFMEDKKSLASEEELAEVEGKASLLA  419

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV + SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG LFLNK+L W  FQ 
Sbjct  420  AVDYYVSLQSDIFISASPGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKSLEWSAFQV  479

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV+ GH NRQG++R RK  +S+YTYP PDCMC 
Sbjct  480  AVVNGHKNRQGQVRSRKEKQSIYTYPIPDCMCQ  512



>ref|XP_006433826.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47066.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=514

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS+EE  +I+GKASL A
Sbjct  361  LLAALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIASAEELTKIEGKASLSA  420

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+VGHR Y  LKTIRPNM LLG+LFLNK++ W EFQ 
Sbjct  421  AVDYYVSMQSDIFISASPGNMHNALVGHRAYLKLKTIRPNMTLLGKLFLNKSMGWTEFQH  480

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV  GH NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  481  AVRNGHKNRLGHIRLRKTKQSIYTYPAPDCMCQS  514



>ref|XP_006433827.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47067.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=517

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS+EE  +I+GKASL A
Sbjct  364  LLAALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIASAEELTKIEGKASLSA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA+VGHR Y  LKTIRPNM LLG+LFLNK++ W EFQ 
Sbjct  424  AVDYYVSMQSDIFISASPGNMHNALVGHRAYLKLKTIRPNMTLLGKLFLNKSMGWTEFQH  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV  GH NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  484  AVRNGHKNRLGHIRLRKTKQSIYTYPAPDCMCQS  517



>emb|CDY34289.1| BnaA01g13920D [Brassica napus]
Length=792

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP++ENKKSLAS+EE  E++GKASL+A
Sbjct  638  LLSALGFTNNTRLYLASHQVYGGEARISTLRKLFPVLENKKSLASAEELAEVEGKASLMA  697

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+ 
Sbjct  698  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEG  757

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            AV+ GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  758  AVVNGHKNRQGQLRLRKQKQSIYTYPAPDCMCKA  791



>ref|XP_002462371.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
 gb|EER98892.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
Length=511

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL ALGFD+ TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   ++GKAS+LA
Sbjct  358  LLVALGFDSKTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELANVEGKASVLA  417

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA++ HRTY NLKTIRPNM LLG++F+NK++ W EFQ 
Sbjct  418  ALDYYISMHSDIFISASPGNMHNALMAHRTYENLKTIRPNMALLGRIFVNKSMEWQEFQQ  477

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
             V  GH  R G+IRLRK  +S+YTYPAPDCMC 
Sbjct  478  VVQAGHKGRYGQIRLRKATQSIYTYPAPDCMCQ  510



>ref|XP_006285210.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
 gb|EOA18108.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
Length=521

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTRLYLASH+VYGG ARIS LR+LFP +ENKKSLAS+EE  +++GKASL+A
Sbjct  367  LLSALGFSNNTRLYLASHQVYGGEARISTLRKLFPGVENKKSLASAEELADVEGKASLMA  426

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+ +NK+L W EF+ 
Sbjct  427  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVLVNKSLDWSEFEG  486

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            AV+ GH NR G++RLRK  +S+YTYPAPDCMC
Sbjct  487  AVVNGHKNRHGQLRLRKQKQSIYTYPAPDCMC  518



>ref|XP_008444924.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=515

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +LAALGF N TR+YLA H+VYGG ARIS LR++FPL+E+KKSL S  ER  + GKASL A
Sbjct  361  VLAALGFSNTTRVYLAIHEVYGGEARISTLRKVFPLLEDKKSLTSPMERAGVAGKASLSA  420

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV +HSD+FISASPGNMHNA+VGHR Y N+KTIRPNM LLGQLFLNK++ W EF+ 
Sbjct  421  AVDYYVSLHSDVFISASPGNMHNALVGHRAYLNMKTIRPNMVLLGQLFLNKSMEWSEFKK  480

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            AV+ GH NRQG+IRLRK  +S+YTYPAPDCMC
Sbjct  481  AVLTGHRNRQGQIRLRKEKQSIYTYPAPDCMC  512



>gb|EMT16885.1| hypothetical protein F775_06176 [Aegilops tauschii]
Length=511

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L ALGFD+ TR YLASHKVYGG ARIS+LR+LFPLME+K+SLAS++E   ++GKAS+LA
Sbjct  358  ILVALGFDSTTRFYLASHKVYGGEARISSLRKLFPLMEDKRSLASADELANVEGKASVLA  417

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DY++ MHSD+FISASPGNMHNA++ HR Y NLKTIRPNM LLG +F+NK++ W EFQ 
Sbjct  418  ALDYHISMHSDVFISASPGNMHNALLAHRAYRNLKTIRPNMTLLGHIFVNKSMEWSEFQQ  477

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV  GH  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  478  AVQAGHKGRYGQIRLRKPKQSIYTYPAPDCMCQ  510



>gb|KJB48896.1| hypothetical protein B456_008G092600, partial [Gossypium raimondii]
Length=495

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 135/188 (72%), Gaps = 34/188 (18%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR LFPLMENKKSLASSEER  IKGKASLLA
Sbjct  308  LLAALGFDNSTRLYLASHKVYGGEARISTLRELFPLMENKKSLASSEERARIKGKASLLA  367

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVG----HRTYHNLKTIRP-----------------  299
            AVDYYVGMHSDIF+SASPGNMHNA+ G    +R +H   T+                   
Sbjct  368  AVDYYVGMHSDIFVSASPGNMHNALPGITYRYRAFHFAATVPKVYMWKISNNYVQLQCFY  427

Query  300  -------------NMQLLGQLFLNKNLTWPEFQDAVIEGHANRQGEIRLRKPAKSLYTYP  440
                         +M LLGQLFLNKN+TW EF+ AV EGH NRQG+++LRKP +S+YTYP
Sbjct  428  NFFLFPSASVNEHDMALLGQLFLNKNITWLEFRQAVAEGHQNRQGQLKLRKPKQSIYTYP  487

Query  441  APDCMCNA  464
            APDCMC A
Sbjct  488  APDCMCRA  495



>dbj|BAK06980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L ALGFD+ TR YLASHKVYGG ARIS+LR+LFPLM +K+SLAS++E   I+GKAS+LA
Sbjct  359  ILVALGFDSKTRFYLASHKVYGGEARISSLRKLFPLMVDKRSLASADELASIEGKASVLA  418

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DY++ MHSD+FISASPGNMHNA++ HRTY NLKTIRPNM LLG +F+NK++ W EFQ 
Sbjct  419  ALDYHISMHSDVFISASPGNMHNALLAHRTYRNLKTIRPNMTLLGHIFVNKSMEWSEFQQ  478

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            AV  GH  R G+IRLRKP +S+YTYPAPDCMC
Sbjct  479  AVQAGHKGRYGQIRLRKPKQSIYTYPAPDCMC  510



>ref|XP_006413418.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
 gb|ESQ54871.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
Length=518

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ALGF NNTR+YLASH+VYGG ARIS LR+LFP+MENKKSLAS+EE   ++G+ASL+A
Sbjct  364  LLSALGFSNNTRIYLASHQVYGGEARISTLRKLFPVMENKKSLASAEELAGVEGRASLMA  423

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+ 
Sbjct  424  AVDYYVSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLEWSEFEG  483

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
             V+ GH NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  484  RVLNGHKNRQGQLRLRKQKQSIYTYPAPDCMC  515



>gb|EEC84568.1| hypothetical protein OsI_31345 [Oryza sativa Indica Group]
Length=519

 Score =   238 bits (608),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD+ TR+YLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE   ++GKAS+LA
Sbjct  331  LLAALGFDSRTRIYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELTNVEGKASVLA  390

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EFQ+
Sbjct  391  ALDYYISMHSDIFISASPGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQE  450

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            AV  GH  R G+IRLRKP +S+YTYPAPD  C
Sbjct  451  AVQAGHKGRYGQIRLRKPKQSIYTYPAPDFCC  482



>ref|XP_004152738.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004163454.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=515

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N TR+YLA H+VYGG ARIS LR++FPL+E+KKSL S  ER  + GKASL A
Sbjct  361  LLAALGFSNTTRVYLAIHEVYGGEARISTLRKVFPLLEDKKSLTSPMERAGVAGKASLSA  420

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            AVDYYV +HSD+FISASPGNMHNA++GHR Y N+KTIRPNM LLG LFLNK++ W EF+ 
Sbjct  421  AVDYYVSLHSDVFISASPGNMHNALLGHRAYLNMKTIRPNMVLLGPLFLNKSMEWSEFKK  480

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            AV+ GH NRQG+IRLRK  +S+YTYPAPDCMC
Sbjct  481  AVLTGHRNRQGQIRLRKETQSIYTYPAPDCMC  512



>gb|EMS64135.1| hypothetical protein TRIUR3_23110 [Triticum urartu]
Length=493

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L ALGFD+ TR YLASHKVYGG ARIS+LR+LFPLME+K+SLAS++E   ++GKAS+LA
Sbjct  340  ILVALGFDSTTRFYLASHKVYGGEARISSLRKLFPLMEDKRSLASADELANVEGKASVLA  399

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DY++ MHSD+FISASPGNMHNA++ HR Y N KTIRPNM LLG +F NK++ W EFQ 
Sbjct  400  ALDYHISMHSDVFISASPGNMHNALLAHRAYRNFKTIRPNMTLLGHIFANKSMEWSEFQQ  459

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV  GH  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  460  AVQAGHKGRYGQIRLRKPKQSIYTYPAPDCMCQ  492



>ref|XP_003578106.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=512

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            L+AALGFDN+TRLYLASHKVYGG ARIS+LR+LFPLM +K+SLAS EE   ++GKAS+LA
Sbjct  359  LMAALGFDNSTRLYLASHKVYGGEARISSLRKLFPLMVDKRSLASEEELANVQGKASVLA  418

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ +HSDIFISASPGNMHNA++  R Y+N+KTI+PNM LLG +F+NK+  W EFQ 
Sbjct  419  ALDYYISIHSDIFISASPGNMHNAVMAQRAYNNMKTIKPNMALLGHIFVNKSNEWSEFQQ  478

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            AV  GH  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  479  AVQAGHKGRYGQIRLRKPKQSIYTYPAPDCMCQ  511



>tpg|DAA61415.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=486

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL ALGFDN TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   ++GKAS+LA
Sbjct  323  LLVALGFDNRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELANVEGKASVLA  382

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEFQ 
Sbjct  383  ALDYYISMHSDIFISASPGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQ  442

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPD  449
             V  GH  R G+IRLRK  +S+YTYPAPD
Sbjct  443  VVQAGHKGRYGQIRLRKATQSIYTYPAPD  471



>gb|EEE69695.1| hypothetical protein OsJ_29339 [Oryza sativa Japonica Group]
Length=722

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD+ TR+YLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE   ++GKAS+LA
Sbjct  359  LLAALGFDSRTRIYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELTNVEGKASVLA  418

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
            A+DYY+ MHSDIFISASPGNMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EFQ+
Sbjct  419  ALDYYISMHSDIFISASPGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQE  478

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPD  449
            AV  GH  R G+IRLRKP +S+YTYPAPD
Sbjct  479  AVQAGHKGRYGQIRLRKPKQSIYTYPAPD  507



>gb|KGN62755.1| hypothetical protein Csa_2G370540 [Cucumis sativus]
Length=1445

 Score =   238 bits (608),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  3     LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
             LLAALGF N TR+YLA H+VYGG ARIS LR++FPL+E+KKSL S  ER  + GKASL A
Sbjct  1291  LLAALGFSNTTRVYLAIHEVYGGEARISTLRKVFPLLEDKKSLTSPMERAGVAGKASLSA  1350

Query  183   AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
             AVDYYV +HSD+FISASPGNMHNA++GHR Y N+KTIRPNM LLG LFLNK++ W EF+ 
Sbjct  1351  AVDYYVSLHSDVFISASPGNMHNALLGHRAYLNMKTIRPNMVLLGPLFLNKSMEWSEFKK  1410

Query  363   AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
             AV+ GH NRQG+IRLRK  +S+YTYPAPDCMC
Sbjct  1411  AVLTGHRNRQGQIRLRKETQSIYTYPAPDCMC  1442



>ref|XP_002967262.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
 gb|EFJ31861.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
Length=476

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 122/154 (79%), Gaps = 1/154 (1%)
 Frame = +3

Query  6    LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  185
            LAALGF  +TR+YLASH++YGG AR+S L+ +FPLM++K SLA   E    + KASL AA
Sbjct  316  LAALGFGPHTRVYLASHQIYGGEARLSFLKNIFPLMQDKASLAIDAELRPFERKASLSAA  375

Query  186  VDYYVGMHSDIFISASPGNMHNAMVGHRTYHNL-KTIRPNMQLLGQLFLNKNLTWPEFQD  362
            +DYYV + SD F+SASPGNMHNA++GHRTY N+ KT+RP+M LL +LF N ++ WPEFQ+
Sbjct  376  LDYYVCLKSDFFLSASPGNMHNAVIGHRTYQNVQKTLRPDMVLLSRLFSNSSMEWPEFQN  435

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
             V  GH NR G++RLR+P +S+YTYPAPDCMC +
Sbjct  436  RVYNGHRNRLGQVRLRQPKQSIYTYPAPDCMCKS  469



>ref|XP_002960458.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
 gb|EFJ37997.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
Length=464

 Score =   204 bits (519),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = +3

Query  6    LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  185
            LAALGF  +TR+YLASH++YGG AR+S L+ +FPLM++K S+A  +E    + KASL AA
Sbjct  304  LAALGFGPHTRVYLASHQIYGGEARLSFLKNIFPLMQDKASVAIDDELRPFERKASLSAA  363

Query  186  VDYYVGMHSDIFISASPGNMHNAMVGHRTYHNL-KTIRPNMQLLGQLFLNKNLTWPEFQD  362
            +DYYV + SD F+SASPGNMHNA++GHRTY N+ KT+RP+M LL +LF N ++ WPEFQ+
Sbjct  364  LDYYVCLKSDFFLSASPGNMHNAVIGHRTYQNVQKTLRPDMVLLSRLFSNSSMEWPEFQN  423

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
             V  GH NR G++RLR+P +S+YTYPAPDCMC
Sbjct  424  RVYNGHRNRLGQVRLRQPKQSIYTYPAPDCMC  455



>ref|XP_001777077.1| predicted protein [Physcomitrella patens]
 gb|EDQ58070.1| predicted protein, partial [Physcomitrella patens]
Length=437

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L ALGF   T +YLAS+ VYGG+AR+  L  LFP M  K +LA++EE     GKAS LA
Sbjct  265  MLVALGFSPKTHVYLASYTVYGGSARMDFLHNLFPNMVTKYTLATAEELAPFAGKASQLA  324

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNL-KTIRPNMQLLGQLFLNKNLTWPEFQ  359
            A+DY V +HSDIF+SAS GNMHN++  HRTY N+ KTI+P+M L+ +LF +KNLTWPEF+
Sbjct  325  AIDYLVSLHSDIFLSASRGNMHNSLAAHRTYLNVRKTIKPDMNLMARLFAHKNLTWPEFR  384

Query  360  DAVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
             +V+EGH NR G++ LR+P +S+YTYPAPDCMC +
Sbjct  385  RSVVEGHKNRMGQVALRQPTQSIYTYPAPDCMCTS  419



>ref|XP_010312650.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Solanum 
lycopersicum]
Length=468

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 107/154 (69%), Gaps = 38/154 (25%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSE             
Sbjct  353  LLAALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSE-------------  399

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQD  362
                                     VG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ+
Sbjct  400  -------------------------VGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQE  434

Query  363  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            +VIEGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  435  SVIEGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  468



>gb|AAB72114.1| PsRT17-1 [Pisum sativum]
Length=406

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARI+ L++LFPLME+KKSL S  ER +IKGKASLLA
Sbjct  289  LLAALGFDNSTRLYLASHKVYGGGARIATLKQLFPLMEDKKSLTSPFERAQIKGKASLLA  348

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNL  341
            A+DYY+ +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK +
Sbjct  349  ALDYYISIHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTM  401



>tpg|DAA61413.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=118

 Score =   182 bits (463),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = +3

Query  111  MENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKT  290
            ME+K+SLAS +E   ++GKAS+LAA+DYY+ MHSDIFISASPGNMHNA+V HR+Y NLKT
Sbjct  1    MEDKRSLASEDELANVEGKASVLAALDYYISMHSDIFISASPGNMHNALVAHRSYENLKT  60

Query  291  IRPNMQLLGQLFLNKNLTWPEFQDAVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            IRPNM LLG+ F NK++ WPEFQ  V  GH  R G+IRLRK  +S+YTYPAPDCMC 
Sbjct  61   IRPNMALLGRTFANKSMEWPEFQQVVQAGHKGRYGQIRLRKATQSIYTYPAPDCMCQ  117



>ref|XP_008802622.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Phoenix 
dactylifera]
Length=495

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/94 (81%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFD+ TRLYLASHKVYGG ARIS+LR+LFPLME+KKSL S EE  +++GKASLLA
Sbjct  402  LLAALGFDSKTRLYLASHKVYGGEARISSLRKLFPLMEDKKSLTSEEELAKVEGKASLLA  461

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNL  284
            AVDYYV MHSD+FISASPGNMHNA+VGHRTY N+
Sbjct  462  AVDYYVSMHSDVFISASPGNMHNAVVGHRTYLNM  495



>emb|CDX92640.1| BnaC07g38980D [Brassica napus]
Length=261

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 90/111 (81%), Gaps = 3/111 (3%)
 Frame = +3

Query  126  SLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNM  305
            +LAS+EE  E++GKAS++AAVDYYV M SDIFISASPGNMHNA++ H  Y NL T+ PN 
Sbjct  151  ALASAEELAEVEGKASVMAAVDYYVSMKSDIFISASPGNMHNALLAHGAYLNLMTVNPNT  210

Query  306  QLLGQLFLNKNLTWPEFQDAVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
             LLGQ+ +N+++ W EF+ AV++GH N QG++RLR   KS+YTYPAPDCMC
Sbjct  211  ILLGQVLVNRSIGWSEFEGAVLKGHKNSQGQLRLR---KSIYTYPAPDCMC  258



>ref|XP_007047792.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX91949.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
Length=403

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER  IKGKASLLA
Sbjct  319  LLAALGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSEERVHIKGKASLLA  378

Query  183  AVDYYVGMHSDIFISASPGNMHNAM  257
            AVDYYVGMHSDIF+SASPGNMHNA+
Sbjct  379  AVDYYVGMHSDIFVSASPGNMHNAL  403



>gb|KHG22139.1| hypothetical protein F383_05782 [Gossypium arboreum]
Length=467

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 83/90 (92%), Gaps = 1/90 (1%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR LFP MENKKSLASSEER  IKGKASLLA
Sbjct  365  LLAALGFDNSTRLYLASHKVYGGEARISTLRELFPKMENKKSLASSEERVLIKGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRT  272
            AVDYYVGMHSDIF+SASPGNMHNA++ HR+
Sbjct  425  AVDYYVGMHSDIFVSASPGNMHNALL-HRS  453



>emb|CDY11018.1| BnaA03g46770D [Brassica napus]
Length=95

 Score =   144 bits (364),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 80/95 (84%), Gaps = 0/95 (0%)
 Frame = +3

Query  111  MENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKT  290
            MENKKSLAS+EE  E++GKASL+AAVDYYV + SDIF+SASPGNMHNA++ HR Y NLKT
Sbjct  1    MENKKSLASAEELAEVEGKASLMAAVDYYVSVKSDIFVSASPGNMHNALLPHRAYLNLKT  60

Query  291  IRPNMQLLGQLFLNKNLTWPEFQDAVIEGHANRQG  395
            + PNM LLGQ+ +NK+L W EF+ AV+ GH NRQG
Sbjct  61   VNPNMILLGQVLVNKSLGWSEFEGAVLNGHKNRQG  95



>gb|KJB18181.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=451

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGFDN+TRLYLASHKVYGG ARIS LR  FP ME+KKSLASSEER  IKGKASLLA
Sbjct  365  LLAALGFDNSTRLYLASHKVYGGEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAM  257
            AVDYYVGMHSDIF+SASPGNMHNA+
Sbjct  425  AVDYYVGMHSDIFVSASPGNMHNAL  449



>ref|XP_010664406.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Vitis 
vinifera]
Length=446

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF N TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS+EE  +++GKASLLA
Sbjct  362  LLAALGFSNTTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASAEELAKVEGKASLLA  421

Query  183  AVDYYVGMHSDIFISASPGNMHNAM  257
            AVDYYV MHSDIFISASPGNMHNA+
Sbjct  422  AVDYYVSMHSDIFISASPGNMHNAL  446



>ref|XP_007136338.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
 gb|ESW08332.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
Length=449

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 77/85 (91%), Gaps = 0/85 (0%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LLAALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLA
Sbjct  365  LLAALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEELAKVKGKASLLA  424

Query  183  AVDYYVGMHSDIFISASPGNMHNAM  257
            +VDYYV MHSDIFISASPGNMHNA+
Sbjct  425  SVDYYVSMHSDIFISASPGNMHNAL  449



>gb|EMT10519.1| hypothetical protein F775_32922 [Aegilops tauschii]
Length=157

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 99/154 (64%), Gaps = 6/154 (4%)
 Frame = +3

Query  15   LGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDY  194
            +GFDN T LY+AS K+Y  A  +  LRR+FPL++ K +LA SEE  E +G +S LAA+DY
Sbjct  1    MGFDNTTFLYVASGKIYNAAKYMGPLRRMFPLLQTKDTLALSEELAEFEGYSSRLAALDY  60

Query  195  YVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDA  365
             V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W  F+  
Sbjct  61   TVCVQSEVFVTTQGGNFPHFLMGHRRYLLGGNAKTIKPDKRKLVLSFDDPNIRWSRFKHH  120

Query  366  VIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            ++E   H++ +G I  RKP  S+YT+P PDCMC 
Sbjct  121  MLEILHHSDIRG-IAFRKPNDSIYTFPMPDCMCQ  153



>ref|XP_010104478.1| hypothetical protein L484_025447 [Morus notabilis]
 gb|EXC01079.1| hypothetical protein L484_025447 [Morus notabilis]
Length=256

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 103/158 (65%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ L+++FP +E K +LA+ EE    KG +S LA
Sbjct  85   MLRGMGFDNTTSVYVAAGKIYKAEKYMAPLKQMFPRLETKDTLATPEELSPFKGHSSRLA  144

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N  + W +
Sbjct  145  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLAVLFDNPKIRWED  204

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  + +   H++++G I LRKP+ SLYT+P PDCMC 
Sbjct  205  FKRQMRDMLRHSDQKG-IELRKPSGSLYTFPMPDCMCK  241



>emb|CDP10650.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDNNT +Y+A+ K+Y     ++ L+++FP +E K +LAS EE    KG +S LA
Sbjct  402  MLRGMGFDNNTFIYVAAGKIYQAEKYMAPLKQMFPHLETKDTLASPEELAPFKGHSSRLA  461

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F+S   GN  + +VGHR Y    + KTI+P+ + L  LF N N+ W +
Sbjct  462  ALDYTVCLHSEVFVSTQGGNFPHFLVGHRRYLYEGHAKTIKPDKRKLALLFDNPNIRWKD  521

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G +  RKP+ SLYTYP PDCMC
Sbjct  522  FKRQLQDMLRHSDVKG-VETRKPSGSLYTYPMPDCMC  557



>ref|NP_001132122.1| uncharacterized protein LOC100193539 [Zea mays]
 gb|ACF80826.1| unknown [Zea mays]
Length=313

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 100/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  EE  + KG +S LA
Sbjct  152  MLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALPEELAQFKGHSSQLA  211

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W +
Sbjct  212  ALDYTVCVHSEVFVTTQGGNFPHFLMGHRRYMFGGNAKTIKPDKRKLVLSFDDPNIRWDQ  271

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + E   H++ +  I LRKP  S+YT+P PDCMC
Sbjct  272  FKQNMQEILQHSDMRS-IALRKPNDSVYTFPMPDCMC  307



>ref|XP_006826849.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
 gb|ERM94086.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
Length=554

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 104/159 (65%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDNNT ++LAS ++Y     ++ L ++FPL++ K++LAS EE    K  +S +A
Sbjct  385  MLRGMGFDNNTAIFLASGRIYKAENTMAPLLQMFPLLQTKETLASDEELAPFKNYSSRMA  444

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR +    + KTIRP+ + L Q+F N N+ W  
Sbjct  445  AIDYTVCLHSEVFVTTQGGNFPHFLMGHRRFLYGGHSKTIRPDKRKLVQIFGNPNIGWKN  504

Query  354  F--QDAVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            F  Q  V+  H++ +G + +R+P  S+YT+P PDCMC A
Sbjct  505  FKRQMLVMRSHSDAKG-MEIRRPNDSIYTFPCPDCMCRA  542



>ref|XP_010538926.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=571

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+  +Y     ++ L+++FPL++ K +LA+ EE    KG +S LA
Sbjct  407  MLRGMGFDNTTLVYVAAGNIYKAEKYMAPLKQMFPLLQTKDTLATPEELAPFKGHSSRLA  466

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F+S   GN  + ++GHR Y    + KTI+P+ + L QLF N N+ W  
Sbjct  467  ALDYTVCLHSEVFVSTQGGNFPHFLMGHRRYLYKGHAKTIKPDKRKLVQLFDNPNIRWDY  526

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  527  FKKQMQDMLRHNDAKG-VELRKPASSLYTFPMPDCMC  562



>ref|XP_006473173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
 gb|KDO83869.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=445

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LA+ EE    KG +S LA
Sbjct  273  MLRGMGFDNTTSVYVAAGKIYKAEKYVAPLRQMFPRLETKDTLATPEELAAFKGHSSRLA  332

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +
Sbjct  333  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDD  392

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  393  FKRQMKDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  428



>ref|XP_006434582.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47822.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=445

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LA+ EE    KG +S LA
Sbjct  273  MLRGMGFDNTTSVYVAAGKIYKAEKYVAPLRQMFPRLETKDTLATPEELAAFKGHSSRLA  332

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +
Sbjct  333  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDD  392

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  393  FKRQMKDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  428



>ref|XP_008669808.1| PREDICTED: uncharacterized protein At1g04910-like isoform X4 
[Zea mays]
Length=488

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y     ++ LRRLFP ++ K +L + EE  + KG +S LA
Sbjct  320  MLRGMGFDNTTSLYVASGKIYNAEKYMTPLRRLFPFLQTKHALVTPEELAQFKGHSSRLA  379

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY + +HS++F+     N  + ++GHR Y    + KTI+P+ + L QLF N N+ W  
Sbjct  380  ALDYTICLHSEVFVMTQGSNFPHFLMGHRRYMYGGHAKTIKPDKRKLVQLFDNPNIRWDR  439

Query  354  FQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  +  +  H+  +G   LRKP +S+YT P PDCMC 
Sbjct  440  FKHHMQDMRRHSEMKG-FALRKPQESIYTLPMPDCMCQ  476



>ref|XP_001765982.1| predicted protein [Physcomitrella patens]
 gb|EDQ69303.1| predicted protein, partial [Physcomitrella patens]
Length=451

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 98/154 (64%), Gaps = 1/154 (1%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            LL+ LGF  +T +Y+AS  +YGG ARI  L+ +FP++E+K +LAS++E       +  LA
Sbjct  291  LLSGLGFPISTPVYMASKNLYGGVARIKPLKEIFPILESKYTLASTKELRPFLPYSHKLA  350

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHN-LKTIRPNMQLLGQLFLNKNLTWPEFQ  359
            A+D+ V ++SD+F+S + GN  N + G RT++   K+I  + +LL  LF   +++W EF 
Sbjct  351  ALDFLVLLNSDVFMSNAAGNFPNVLSGQRTFYGPRKSIHADKRLLAHLFSKSSISWLEFS  410

Query  360  DAVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
              V EGH +R G    R P  S++ YPAPDCMC 
Sbjct  411  SQVTEGHLSRLGSPVRRMPKYSIFRYPAPDCMCQ  444



>gb|EMT24938.1| hypothetical protein F775_20364 [Aegilops tauschii]
Length=404

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 100/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y  A  +  LR++FPL++ K +LA SEE  E +G +S LA
Sbjct  244  MLRGMGFDNTTFLYVASGKIYNAAKYMGPLRQMFPLLQTKDTLALSEELAEFEGYSSRLA  303

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY + + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W  
Sbjct  304  ALDYTICVQSEVFVTTQGGNFPHFLMGHRCYLLGGNAKTIKPDKRKLVLSFDDPNIRWNR  363

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F   ++E   H++ +G I  RKP  S+YT+P PDCMC
Sbjct  364  FNHHMLEILHHSDIRG-ITFRKPNDSIYTFPMPDCMC  399



>gb|AFW56213.1| hypothetical protein ZEAMMB73_697257 [Zea mays]
Length=518

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 100/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  EE  + KG +S LA
Sbjct  357  MLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALPEELAQFKGHSSQLA  416

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W +
Sbjct  417  ALDYTVCVHSEVFVTTQGGNFPHFLMGHRRYMFGGNAKTIKPDKRKLVLSFDDPNIRWDQ  476

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + E   H++ +  I LRKP  S+YT+P PDCMC
Sbjct  477  FKQNMQEILQHSDMRS-IALRKPNDSVYTFPMPDCMC  512



>ref|XP_006473171.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 gb|KDO83865.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
 gb|KDO83866.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=570

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LA+ EE    KG +S LA
Sbjct  398  MLRGMGFDNTTSVYVAAGKIYKAEKYVAPLRQMFPRLETKDTLATPEELAAFKGHSSRLA  457

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +
Sbjct  458  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDD  517

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  518  FKRQMKDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  553



>ref|XP_009390064.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=521

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF N T +Y+AS K+Y     ++ LR+LFPL+E K++LAS++E    KG +S LA
Sbjct  361  MLRGMGFGNTTSVYVASGKIYNAEKYMAPLRQLFPLLETKETLASADELAPFKGHSSQLA  420

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHN---LKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V  HS++F++   GN  + ++GHR Y N    KTI P+ + L   F N N+ W +
Sbjct  421  ALDYTVCAHSEVFVTTQGGNFPHFLMGHRRYLNEGHSKTINPDKKKLVLSFDNPNIRWDK  480

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  + E   H++ +G I LRKP  SLYT+P PDCMC 
Sbjct  481  FKRNMQEVLHHSDLKG-ITLRKPDASLYTFPMPDCMCQ  517



>emb|CBI18521.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LAS EE    KG +S LA
Sbjct  321  MLRGMGFDNTTSVYVAAGKIYKAERYMAPLRQMFPRLETKDTLASPEELAPFKGHSSRLA  380

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + +++W  
Sbjct  381  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDSPDISWDN  440

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  441  FKSQMQDMLRHSDSKGS-ELRKPSSSLYTFPMPDCMC  476



>ref|XP_008669806.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=497

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y     ++ LRRLFP ++ K +L + EE  + KG +S LA
Sbjct  329  MLRGMGFDNTTSLYVASGKIYNAEKYMTPLRRLFPFLQTKHALVTPEELAQFKGHSSRLA  388

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY + +HS++F+     N  + ++GHR Y    + KTI+P+ + L QLF N N+ W  
Sbjct  389  ALDYTICLHSEVFVMTQGSNFPHFLMGHRRYMYGGHAKTIKPDKRKLVQLFDNPNIRWDR  448

Query  354  FQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  +  +  H+  +G   LRKP +S+YT P PDCMC 
Sbjct  449  FKHHMQDMRRHSEMKG-FALRKPQESIYTLPMPDCMCQ  485



>ref|XP_006434583.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 ref|XP_006434584.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47823.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47824.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=570

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LA+ EE    KG +S LA
Sbjct  398  MLRGMGFDNTTSVYVAAGKIYKAEKYVAPLRQMFPRLETKDTLATPEELAAFKGHSSRLA  457

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +
Sbjct  458  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDD  517

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  518  FKRQMKDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  553



>ref|XP_009390063.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=541

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF N T +Y+AS K+Y     ++ LR+LFPL+E K++LAS++E    KG +S LA
Sbjct  381  MLRGMGFGNTTSVYVASGKIYNAEKYMAPLRQLFPLLETKETLASADELAPFKGHSSQLA  440

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHN---LKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V  HS++F++   GN  + ++GHR Y N    KTI P+ + L   F N N+ W +
Sbjct  441  ALDYTVCAHSEVFVTTQGGNFPHFLMGHRRYLNEGHSKTINPDKKKLVLSFDNPNIRWDK  500

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  + E   H++ +G I LRKP  SLYT+P PDCMC 
Sbjct  501  FKRNMQEVLHHSDLKG-ITLRKPDASLYTFPMPDCMCQ  537



>ref|XP_008669805.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=544

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 98/158 (62%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y     ++ LRRLFP ++ K +L + EE  + KG +S LA
Sbjct  376  MLRGMGFDNTTSLYVASGKIYNAEKYMTPLRRLFPFLQTKHALVTPEELAQFKGHSSRLA  435

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY + +HS++F+     N  + ++GHR Y    + KTI+P+ + L QLF N N+ W  
Sbjct  436  ALDYTICLHSEVFVMTQGSNFPHFLMGHRRYMYGGHAKTIKPDKRKLVQLFDNPNIRWDR  495

Query  354  FQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  +  +  H+  +G   LRKP +S+YT P PDCMC 
Sbjct  496  FKHHMQDMRRHSEMKG-FALRKPQESIYTLPMPDCMCQ  532



>ref|XP_008661414.1| PREDICTED: uncharacterized protein LOC100193539 isoform X1 [Zea 
mays]
Length=564

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 100/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  EE  + KG +S LA
Sbjct  403  MLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALPEELAQFKGHSSQLA  462

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W +
Sbjct  463  ALDYTVCVHSEVFVTTQGGNFPHFLMGHRRYMFGGNAKTIKPDKRKLVLSFDDPNIRWDQ  522

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + E   H++ +  I LRKP  S+YT+P PDCMC
Sbjct  523  FKQNMQEILQHSDMRS-IALRKPNDSVYTFPMPDCMC  558



>ref|XP_010274715.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=558

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 100/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN+T +YLAS K+Y     ++ L  +FPL++ K +LAS EE    K  +S +A
Sbjct  389  MLRGMGFDNSTSIYLASGKIYKAEKTMAPLLEMFPLLQTKDTLASMEELAPFKNFSSRMA  448

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  
Sbjct  449  AIDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKT  508

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  V+    H++ +G I L++P  S+YT+P PDCMC
Sbjct  509  FKRHVLNMRSHSDAKG-IELKRPNDSIYTFPCPDCMC  544



>ref|XP_009362464.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=442

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 104/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ L+++FP +E K +LA++EE    KG  S LA
Sbjct  276  MLRGMGFDNTTSVYVAAGKIYKAEKYMAPLKQMFPHLEMKDTLATAEELAPFKGHLSRLA  335

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W +
Sbjct  336  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIKPDKRKLALLFDNPNIRWED  395

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++++G + L+KP+ SLYT+P PDCMC
Sbjct  396  FKRQMQDMLRHSDQKG-VELKKPSASLYTFPMPDCMC  431



>ref|XP_006434581.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47821.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=656

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LA+ EE    KG +S LA
Sbjct  484  MLRGMGFDNTTSVYVAAGKIYKAEKYVAPLRQMFPRLETKDTLATPEELAAFKGHSSRLA  543

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +
Sbjct  544  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDD  603

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  604  FKRQMKDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  639



>ref|XP_010246043.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Nelumbo 
nucifera]
Length=456

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR+LFPL+E K++LA  EE    KG +S LA
Sbjct  285  MLRGMGFDNTTSVYIAAGKIYKAEKFMAPLRQLFPLLETKETLALPEELAPFKGHSSRLA  344

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V ++S++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W  
Sbjct  345  ALDYTVCLNSEVFVTTQGGNFPHFLMGHRRYFFGGHAKTIKPDKRKLALLFDSPNIRWEY  404

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + E   H++ +G I ++KP+ SLYT+P PDCMC
Sbjct  405  FKRQMQEMLHHSDLKG-IEMKKPSSSLYTFPIPDCMC  440



>ref|XP_002272758.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=582

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LAS EE    KG +S LA
Sbjct  411  MLRGMGFDNTTSVYVAAGKIYKAERYMAPLRQMFPRLETKDTLASPEELAPFKGHSSRLA  470

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + +++W  
Sbjct  471  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDSPDISWDN  530

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  531  FKSQMQDMLRHSDSKGS-ELRKPSSSLYTFPMPDCMC  566



>gb|EMT33054.1| hypothetical protein F775_09106 [Aegilops tauschii]
Length=463

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y  A  ++ LR++FPL++ K +LA SEE  + +G +S LA
Sbjct  303  MLRGMGFDNTTFLYVASGKIYNAAKYMAPLRQMFPLLQTKDTLALSEELAKFEGYSSRLA  362

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W  
Sbjct  363  ALDYTVCVQSEVFVTTQGGNFPHFLMGHRRYLLGGNAKTIKPDKRKLVLSFDDPNIRWSR  422

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  ++E   H++ +G I  RKP  S+YT+P PDCMC 
Sbjct  423  FKHHMLEILHHSDIRG-IAFRKPNDSIYTFPMPDCMCQ  459



>ref|XP_010246042.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nelumbo 
nucifera]
Length=510

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR+LFPL+E K++LA  EE    KG +S LA
Sbjct  339  MLRGMGFDNTTSVYIAAGKIYKAEKFMAPLRQLFPLLETKETLALPEELAPFKGHSSRLA  398

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V ++S++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W  
Sbjct  399  ALDYTVCLNSEVFVTTQGGNFPHFLMGHRRYFFGGHAKTIKPDKRKLALLFDSPNIRWEY  458

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + E   H++ +G I ++KP+ SLYT+P PDCMC
Sbjct  459  FKRQMQEMLHHSDLKG-IEMKKPSSSLYTFPIPDCMC  494



>ref|XP_010246041.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
Length=532

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 103/158 (65%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR+LFPL+E K++LA  EE    KG +S LA
Sbjct  361  MLRGMGFDNTTSVYIAAGKIYKAEKFMAPLRQLFPLLETKETLALPEELAPFKGHSSRLA  420

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V ++S++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W  
Sbjct  421  ALDYTVCLNSEVFVTTQGGNFPHFLMGHRRYFFGGHAKTIKPDKRKLALLFDSPNIRWEY  480

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  + E   H++ +G I ++KP+ SLYT+P PDCMC 
Sbjct  481  FKRQMQEMLHHSDLKG-IEMKKPSSSLYTFPIPDCMCK  517



>ref|XP_011096470.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=586

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 99/157 (63%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+A+ K+Y     ++ L+++FP +E K SLAS EE     G +S LA
Sbjct  415  MLRGMGFDNTTSLYVAAGKIYKVEKHMAPLKQMFPGLETKDSLASPEELAPFMGHSSRLA  474

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + +VGHR Y    + KTIRP+ + L QLF   ++ W +
Sbjct  475  ALDYTVCLHSEVFVTTQGGNFPHFLVGHRRYFYEGHAKTIRPDKRKLAQLFDKPSIRWQD  534

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H + +G   LRKP+ SLY YP PDCMC
Sbjct  535  FKRQLQDMLRHNDVKGS-ELRKPSNSLYMYPMPDCMC  570



>ref|XP_003578848.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=558

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFD++T LY+AS K+Y  A  ++ LR++FPL+E K+SLA  EE  E +G +S LA
Sbjct  398  MLRGMGFDHSTFLYVASGKIYNAAKYMAPLRQMFPLLETKESLALPEELAEFEGYSSRLA  457

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W +
Sbjct  458  AIDYTVCVQSEVFVTTQGGNFPHFLMGHRRYLFGGNAKTIKPDKRKLVLSFDDPNIRWSQ  517

Query  354  FQDAVIEG-HANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  + E  H +    I  RKP  S+YT+P PDCMC 
Sbjct  518  FKRHMQEILHHSDIKSIAFRKPNDSIYTFPMPDCMCQ  554



>ref|XP_010246040.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nelumbo 
nucifera]
Length=576

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ LR+LFPL+E K++LA  EE    KG +S LA
Sbjct  405  MLRGMGFDNTTSVYIAAGKIYKAEKFMAPLRQLFPLLETKETLALPEELAPFKGHSSRLA  464

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V ++S++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W  
Sbjct  465  ALDYTVCLNSEVFVTTQGGNFPHFLMGHRRYFFGGHAKTIKPDKRKLALLFDSPNIRWEY  524

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + E   H++ +G I ++KP+ SLYT+P PDCMC
Sbjct  525  FKRQMQEMLHHSDLKG-IEMKKPSSSLYTFPIPDCMC  560



>ref|XP_009362462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=582

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 104/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ L+++FP +E K +LA++EE    KG  S LA
Sbjct  416  MLRGMGFDNTTSVYVAAGKIYKAEKYMAPLKQMFPHLEMKDTLATAEELAPFKGHLSRLA  475

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W +
Sbjct  476  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIKPDKRKLALLFDNPNIRWED  535

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++++G + L+KP+ SLYT+P PDCMC
Sbjct  536  FKRQMQDMLRHSDQKG-VELKKPSASLYTFPMPDCMC  571



>ref|XP_004299893.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=564

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 104/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ L+++FP ++ K +LA+SEE    KG  S LA
Sbjct  394  MLMGMGFDNTTSVYIAAGKIYKAEKYMAPLKQMFPRLQMKDTLATSEELAPYKGHLSRLA  453

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N ++ W +
Sbjct  454  ALDYTVCLHSEVFVTTQGGNFPHFLIGHRRYLYGGHSKTIKPDKRKLALLFDNPSIRWED  513

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++++G + +RKP+ SLYT+P PDCMC
Sbjct  514  FKRQMQDMLRHSDQKG-VEVRKPSASLYTFPMPDCMC  549



>ref|XP_006349651.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=571

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 105/157 (67%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDNNT LY+A+ K+Y     ++ L+++FP +E+K +LAS+EE    +G +S LA
Sbjct  400  MLRGMGFDNNTSLYVAAGKIYKAEKYMTPLKQMFPRLESKDTLASTEELAPFEGHSSRLA  459

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V ++S+ F++   GN  + +VGHR Y    + KTI+P+ + L  LF + ++ W +
Sbjct  460  ALDYTVCLYSEAFVTTQGGNFPHFLVGHRRYLYEGHAKTIKPDKRKLALLFDSPDIRWND  519

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G + L+KP+ SLYT+P PDCMC
Sbjct  520  FKSQLQDMLHHSDTKG-VELKKPSSSLYTFPMPDCMC  555



>ref|XP_006383813.1| hypothetical protein POPTR_0005s28420g, partial [Populus trichocarpa]
 gb|ERP61610.1| hypothetical protein POPTR_0005s28420g, partial [Populus trichocarpa]
Length=133

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 85/139 (61%), Gaps = 14/139 (10%)
 Frame = +3

Query  48   ASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFIS  227
            +S    G  A   AL +   ++   +SLAS+E+  ++ GKASLLAAVDY+  + SDIFIS
Sbjct  9    SSCDFRGDKAERLALAKFREVLRQGRSLASAEQLTKVNGKASLLAAVDYFESLQSDIFIS  68

Query  228  ASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEGHANRQGEIRL  407
            ASPGNMHNA+          T R NM ++G LFLNK++ WPEFQ AV+ GH +RQG  + 
Sbjct  69   ASPGNMHNAL----------TTRANMVMVGSLFLNKSMEWPEFQRAVLNGHKSRQGPDQF  118

Query  408  RKPAKSLYTYPAPDCMCNA  464
             K A+       PDC C +
Sbjct  119  EKEAE----VAIPDCTCQS  133



>gb|KJB30799.1| hypothetical protein B456_005G161000 [Gossypium raimondii]
Length=561

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 101/159 (64%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDNNT ++LAS K+Y     +++L  +FP ++ K+ LAS EE    K  +S +A
Sbjct  392  MLRGMGFDNNTYIFLASGKIYNAEKTMASLLEMFPNLQTKEMLASEEELAPYKNFSSRMA  451

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  
Sbjct  452  AIDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLHGGHSKTIRPDKRKLALLFDNPNIGWKS  511

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            F+  ++    H++ +G   L++P+ S+YT+P PDCMC+ 
Sbjct  512  FKRQMLNMRSHSDSKG-FELKRPSDSIYTFPCPDCMCHT  549



>ref|XP_008776785.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=563

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 101/159 (64%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF NNT +YLAS K+Y     ++ L  +FPL++ K++LAS+EE    K  +S +A
Sbjct  394  ILQGMGFSNNTAIYLASGKIYKAEKTMAPLLEMFPLLQTKETLASAEELAPFKNYSSRMA  453

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            AVDY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N  ++W  
Sbjct  454  AVDYSVCLHSEVFLTTQGGNFPHFLIGHRRYLYGGHSKTIKPDKRKLALLFDNPKVSWKA  513

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
             +  ++    H++ +G I +++P  S+YTYP PDCMC +
Sbjct  514  LKRQLLNMRAHSDAKG-IEIKRPNDSIYTYPCPDCMCRS  551



>ref|XP_010262622.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=563

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 97/156 (62%), Gaps = 4/156 (3%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN+T +YLAS K+Y     ++ L  +FPL++ K++LAS EE    K  +S +A
Sbjct  394  MLRGMGFDNSTSIYLASGKIYKAEKTMAPLLEMFPLLQTKETLASVEELAPFKNYSSRMA  453

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  
Sbjct  454  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKT  513

Query  354  FQDAVIEGHANRQGE-IRLRKPAKSLYTYPAPDCMC  458
            F+  ++   A    + I L++P  S YT+P PDCMC
Sbjct  514  FKHNMLNMRAQSDAKGIELKRPNDSTYTFPCPDCMC  549



>ref|XP_006304663.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
 gb|EOA37561.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
Length=580

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF+NNT +Y+A+  +Y     ++ LR++FPL++ K +LA++EE    KG +S LA
Sbjct  411  MLRGMGFNNNTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLATTEELAPFKGHSSRLA  470

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    ++ W  
Sbjct  471  ALDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPSIRWDY  530

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H + +G I LRKPA SLYT+P PDCMC
Sbjct  531  FKKQMQDMLRHNDAKG-IELRKPAASLYTFPMPDCMC  566



>ref|XP_004237568.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=571

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 105/157 (67%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF+NNT LY+A+ K+Y     ++ L+++FP +E+K +LAS+EE    +G +S LA
Sbjct  400  MLRGMGFENNTSLYVAAGKIYKAEKYMTPLKQMFPRLESKDTLASTEELAPFEGHSSRLA  459

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V ++S+ F++   GN  + +VGHR Y    + KTI+P+ + L  LF + ++ W +
Sbjct  460  ALDYTVCLYSEAFVTTQGGNFPHFLVGHRRYLYEGHAKTIKPDKRKLALLFDSPDIRWND  519

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G + L+KP+ SLYT+P PDCMC
Sbjct  520  FKSQLQDMLHHSDTKG-VELKKPSSSLYTFPMPDCMC  555



>ref|XP_007222464.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
 gb|EMJ23663.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
Length=569

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ L+++FP +E K +LA++EE    +G  S LA
Sbjct  394  MLRGMGFDNTTSVYIAAGKIYKAEKYMAPLKQMFPRLEMKDTLATAEELAPFQGHLSRLA  453

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI P+ + L  LF N ++ W +
Sbjct  454  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTINPDKRKLALLFDNPSIRWED  513

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  V +   H++++G + L+KP+ SLYT+P PDCMC
Sbjct  514  FKRQVQDMLRHSDQKG-VELKKPSASLYTFPMPDCMC  549



>ref|XP_010319880.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=568

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 105/157 (67%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF+NNT LY+A+ K+Y     ++ L+++FP +E+K +LAS+EE    +G +S LA
Sbjct  397  MLRGMGFENNTSLYVAAGKIYKAEKYMTPLKQMFPRLESKDTLASTEELAPFEGHSSRLA  456

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V ++S+ F++   GN  + +VGHR Y    + KTI+P+ + L  LF + ++ W +
Sbjct  457  ALDYTVCLYSEAFVTTQGGNFPHFLVGHRRYLYEGHAKTIKPDKRKLALLFDSPDIRWND  516

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G + L+KP+ SLYT+P PDCMC
Sbjct  517  FKSQLQDMLHHSDTKG-VELKKPSSSLYTFPMPDCMC  552



>ref|XP_008378761.1| PREDICTED: uncharacterized protein At1g04910 [Malus domestica]
Length=455

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+  +Y     +S L+ +FP +E K +LA++EE    KG  S LA
Sbjct  280  MLRGMGFDNATSVYIAAGNIYNAEKYMSPLKLMFPRLEMKDTLATAEELAPFKGHLSRLA  339

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W +
Sbjct  340  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIKPDKRKLALLFDBPNIRWED  399

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++++G   L+KP+ SLYT+P PDCMC
Sbjct  400  FKRQMQDMLRHSDQKG-FELKKPSASLYTFPMPDCMC  435



>ref|XP_009594772.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana tomentosiformis]
Length=564

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDNNT LY+A+ K+Y     ++ L+++FP +E+K +LAS EE    +G +S LA
Sbjct  393  MLRGMGFDNNTSLYVAAGKIYKAEKYMTPLKQIFPRLESKDTLASREELAPFEGHSSRLA  452

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHN---LKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V ++S+ F++   GN  + +VGHR Y N    KTI+P+ + L  LF + ++ W E
Sbjct  453  ALDYTVCLYSEAFVTTQGGNFPHFLVGHRRYLNEGHAKTIKPDKRKLALLFDSPDIRWNE  512

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G + L+K + SLYT+P PDCMC
Sbjct  513  FKRQLQDMLHHSDLKG-VELKKSSSSLYTFPMPDCMC  548



>gb|EYU22809.1| hypothetical protein MIMGU_mgv1a003510mg [Erythranthe guttata]
Length=580

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 97/156 (62%), Gaps = 4/156 (3%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+A+ K+Y     ++ L+++FP +E K +LAS EE     G +S LA
Sbjct  409  MLRGMGFDNTTSLYVAAGKIYKVEKHMAPLKQMFPGLETKDTLASIEELAPFTGHSSRLA  468

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + +VGHR Y    + KTI+P+ + L QLF   ++ W +
Sbjct  469  ALDYTVCLHSEVFVTTQGGNFPHFLVGHRRYFYEGHSKTIKPDKRKLAQLFDKPSIRWQD  528

Query  354  FQDAVIEG-HANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +  H N    I LRK + SLY YP PDCMC
Sbjct  529  FKRQLQDMLHHNDVKGIELRKSSSSLYMYPMPDCMC  564



>ref|XP_009420104.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=571

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 100/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF NNT +YLAS K+Y     +  L  +FPL++ K++LAS+EE    K  +S +A
Sbjct  402  MLRGMGFGNNTAIYLASGKIYKAEKTMVPLLEMFPLLQTKETLASTEELAPFKNYSSRMA  461

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  
Sbjct  462  AIDYSVCLHSEVFVTTQGGNFPHFLIGHRRYLYGGHSKTIKPDKRKLALLFDNPNIGWKS  521

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
             +  ++    H++ +G + +++P+ SLYT+P PDCMC
Sbjct  522  LKRQLLNMRAHSDAKG-MEMKRPSDSLYTFPCPDCMC  557



>ref|XP_010695805.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 99/157 (63%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFD NT +YLAS K+Y     ++ L  +FPL++ K+ LAS EE    +  +S +A
Sbjct  403  MLRGMGFDRNTSIYLASGKIYDAERNMAPLFEMFPLLQTKEMLASPEELASYQNYSSRMA  462

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L Q+F N N+ W  
Sbjct  463  AIDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIRPDKRKLAQIFDNPNIGWKT  522

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  ++    H++ +G   L++P  S+Y++P PDCMC
Sbjct  523  FKRHMLNMRSHSDSKG-FELKRPNDSIYSFPCPDCMC  558



>ref|XP_002441904.1| hypothetical protein SORBIDRAFT_08g004650 [Sorghum bicolor]
 gb|EES15742.1| hypothetical protein SORBIDRAFT_08g004650 [Sorghum bicolor]
Length=533

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 96/156 (62%), Gaps = 4/156 (3%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  EE  + KG +S LA
Sbjct  372  MLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALPEELAQFKGHSSQLA  431

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W +
Sbjct  432  ALDYTVCVQSEVFVTTQGGNFPHFLMGHRRYLFGGNAKTIKPDKRKLVLSFDDPNIRWDQ  491

Query  354  FQDAVIEG-HANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + E  H +    I  RKP  S+YT+P P+CMC
Sbjct  492  FKQNMQEILHHSDMKSIAFRKPNDSVYTFPMPECMC  527



>ref|XP_006397450.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
 gb|ESQ38903.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
Length=571

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF+N+T +Y+A+  +Y     ++ LR++FPL++ K +LA+ EE    KG +S LA
Sbjct  404  ILRGMGFNNSTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLATPEELAPFKGHSSRLA  463

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QLF   ++ W  
Sbjct  464  ALDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLFDKPSIRWDY  523

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  524  FKKQMQDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  559



>gb|EPS61269.1| hypothetical protein M569_13528, partial [Genlisea aurea]
Length=174

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 98/157 (62%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFD NT +YLAS K+Y     ++ L  +FPL++ K+ LAS +E    +  +S +A
Sbjct  5    MLRGMGFDRNTNIYLASGKIYNSERYMAPLLDMFPLLQTKEMLASPDELSPFQNYSSRMA  64

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR +    + +TIRP+ + L  +F N N+ W  
Sbjct  65   AIDYTVCLHSEVFVTTQGGNFPHFLLGHRRFLYGGHSRTIRPDKRKLAVIFDNPNIGWKS  124

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  ++    H++ +G I L++P  S+Y+ P PDCMC
Sbjct  125  FKRQMLNMRSHSDSKG-IELKRPNDSIYSVPCPDCMC  160



>ref|XP_010461317.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF+N+T +Y+A+  +Y     ++ LR++FPL++ K +LAS EE    KG +S LA
Sbjct  410  MLRGMGFNNSTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLASPEELAPFKGHSSRLA  469

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    N+ W  
Sbjct  470  ALDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPNIRWDY  529

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  530  FKKQMQDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  565



>gb|EMS55867.1| hypothetical protein TRIUR3_34733 [Triticum urartu]
Length=463

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y  A  ++ L ++FPL++ K +LA SEE  + +G +S LA
Sbjct  303  MLRGMGFDNTTFLYVASGKIYNAAKYMAPLGQMFPLLQTKDTLALSEELAKFEGYSSRLA  362

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W  
Sbjct  363  ALDYTVCVQSEVFVTTPGGNFPHFLMGHRRYLLGGNAKTIKPDKRKLVLSFDDPNIRWSR  422

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  ++E   H++ +G I  RKP  S+YT+P PDCMC 
Sbjct  423  FKHHMLEILHHSDIRG-IAFRKPNDSIYTFPMPDCMCQ  459



>ref|XP_002284457.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI26895.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 99/157 (63%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFD +T +YLAS K+Y     ++ L  +FPL++ K+ LAS+EE    K  +S +A
Sbjct  392  MLRGMGFDKSTSIYLASGKIYKSEKTMAPLFEMFPLLQTKEMLASAEELAPFKNYSSRMA  451

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KT+RP+ + L  LF N N+ W  
Sbjct  452  AIDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTVRPDKRKLALLFDNPNIGWKS  511

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  ++    H++ +G   L++P  S+YT+P PDCMC
Sbjct  512  FKRQMLNMRAHSDAKG-FELKRPNDSIYTFPCPDCMC  547



>ref|XP_010500036.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF+N+T +Y+A+  +Y     ++ LR++FPL++ K +LAS EE    KG +S LA
Sbjct  410  MLRGMGFNNSTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLASPEELAPFKGHSSRLA  469

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    N+ W  
Sbjct  470  ALDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPNIRWDY  529

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  530  FKKQMQDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  565



>emb|CDY03127.1| BnaC06g08460D [Brassica napus]
Length=560

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF+NNT +Y+A+  +Y     ++ LR++FPL++ K +LA+ EE    KG +S LA
Sbjct  393  MLRGMGFNNNTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLATQEELAPFKGHSSRLA  452

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    ++ W  
Sbjct  453  ALDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPSIRWDY  512

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  513  FKKQLQDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  548



>ref|XP_009407491.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=569

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 100/158 (63%), Gaps = 8/158 (5%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF N+T +YLAS K+Y     ++ L  +FPL++ K++LAS+EE    +  +S +A
Sbjct  400  MLRGMGFSNDTAIYLASGKIYKAEKTMAPLLEMFPLLQTKETLASAEELAPFENYSSRMA  459

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY----HNLKTIRPNMQLLGQLFLNKNLTWP  350
            A+DY V +HS++F+S   GN    ++GHR Y    H+ KTI+P+ + L  LF N N+ W 
Sbjct  460  AIDYSVCLHSEVFVSTQGGNFPQILIGHRRYLYGGHS-KTIKPDKRKLALLFDNPNIGWK  518

Query  351  EFQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
              +  ++    H++ +G I +++P  S+Y+YP PDCMC
Sbjct  519  SLKRQLLNMRAHSDAKG-IEMKRPNDSIYSYPCPDCMC  555



>ref|XP_004238827.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
 ref|XP_010320701.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=581

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 99/159 (62%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFD  T +YLAS K+Y     +  L  +FPL++ K+ LAS EE G  +  +S +A
Sbjct  412  MLRGMGFDKFTSIYLASGKIYDSERHMKPLLEMFPLLQTKEMLASPEELGPFQNYSSRMA  471

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + +TIRP+ + L  L+ N N+ W  
Sbjct  472  AIDYTVCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSRTIRPDKRKLALLYDNPNIGWKS  531

Query  354  FQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            F+  +  I  H++ +G I +++P  S+YT+P PDCMC +
Sbjct  532  FKRQMHSIRAHSDSKG-IEIKRPNDSIYTFPCPDCMCRS  569



>emb|CDY66921.1| BnaAnng23210D [Brassica napus]
Length=564

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF+NNT +Y+A+  +Y     ++ LR++FPL++ K +LA+ EE    KG +S LA
Sbjct  395  MLRGMGFNNNTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLATPEELAPFKGHSSRLA  454

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    ++ W  
Sbjct  455  ALDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPSIRWDY  514

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  515  FKKQMQDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  550



>ref|XP_009114709.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=562

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 101/157 (64%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF+NNT +Y+A+  +Y     ++ LR++FPL++ K +LA+ EE    KG +S LA
Sbjct  395  MLRGMGFNNNTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLATPEELAPFKGHSSRLA  454

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    ++ W  
Sbjct  455  ALDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPSIRWDY  514

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  515  FKKQMQDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  550



>ref|XP_009781764.1| PREDICTED: uncharacterized protein At1g04910 [Nicotiana sylvestris]
Length=565

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDNNT LY+A+ K+Y     ++ L+++FP +E+K +L S EE    +G +S LA
Sbjct  394  MLRGMGFDNNTSLYVAAGKIYKAEKYMTPLKQIFPRLESKDTLTSREELAPFEGHSSRLA  453

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYHN---LKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V ++S+ F++   GN  + +VGHR Y N    KTI+P+ + L  LF + N+ W +
Sbjct  454  ALDYTVCLYSEAFVTTQGGNFPHFLVGHRRYLNEGHAKTIKPDKRKLALLFDSPNIRWND  513

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++ +G + L+K + SLYT+P PDCMC
Sbjct  514  FKRQLQDMLHHSDLKG-VELKKSSSSLYTFPMPDCMC  549



>ref|XP_007045152.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY00984.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=561

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 98/157 (62%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDNNT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +A
Sbjct  392  MLRGMGFDNNTYIFLASGKIYNAEKTMAPLLEMFPNLQTKEMLASEEELAPYKNFSSRMA  451

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  
Sbjct  452  AIDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKS  511

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  ++    H++ +G   L++P  S+YT+P PDCMC
Sbjct  512  FKRQMLNMRSHSDSKG-FELKRPNDSIYTFPCPDCMC  547



>gb|AFK46212.1| unknown [Medicago truncatula]
Length=359

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 103/158 (65%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ L+++FP ++ K +LA+ EE  + KG +S LA
Sbjct  186  MLRGMGFDNTTLVYVAAGKIYKEQKYMAPLKQMFPRLQTKDTLATPEELAQFKGHSSRLA  245

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  
Sbjct  246  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYMYGGHSKTIKPDKRRLALLFDNPNIRWEV  305

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  + +   H++++G   ++K ++SLYT+P PDCMC 
Sbjct  306  FKQQMKDMLRHSDQKG-TGVKKASESLYTFPMPDCMCK  342



>ref|XP_002450409.1| hypothetical protein SORBIDRAFT_05g004890 [Sorghum bicolor]
 gb|EES09397.1| hypothetical protein SORBIDRAFT_05g004890 [Sorghum bicolor]
Length=544

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 99/158 (63%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y     ++ L++LFP ++ K+SL + EE  + KG +S LA
Sbjct  376  MLRGMGFDNTTSLYVASGKIYNAEKYMAPLQQLFPFLQTKESLVTPEELAQFKGHSSRLA  435

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V ++S++F+     N  + ++GHR Y    + KTI+P+ + L QLF N N+ W  
Sbjct  436  ALDYTVCLYSEVFVMTQGSNFPHFLMGHRRYMYGGHAKTIKPDKRKLVQLFDNPNIRWDR  495

Query  354  FQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  +  +  H+  +G + LRKP +S+Y  P PDCMC 
Sbjct  496  FKHYMEDMRRHSEMKG-LGLRKPQESMYNLPMPDCMCQ  532



>ref|XP_008389203.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=228

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 97/159 (61%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF+ NT +YLAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +A
Sbjct  59   MLRGMGFEKNTFIYLASGKIYNAEKSMAPLLEMFPNLQTKEMLASEEELAPFKNYSSRMA  118

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N  + W  
Sbjct  119  AIDYTVCLHSEVFVTTQGGNFPHFLIGHRRYMYGGHSKTIRPDKRKLALLFDNPQIGWKT  178

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            F+  ++    H++ +G   +++P  S+YT+P PDCMC +
Sbjct  179  FKRHLLGMRSHSDSKG-YEIKRPNDSIYTFPCPDCMCRS  216



>dbj|BAJ97328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 96/157 (61%), Gaps = 4/157 (3%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T LY+AS K+Y  A  ++ LR++FPL++ K +LA  EE  E +G +S LA
Sbjct  397  MLRGMGFDNTTFLYVASGKIYNAAKYMAPLRQMFPLLQTKDTLALPEELAEFEGYSSRLA  456

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V + S++F++   GN  + ++GHR Y    N KTI+P+   L   F + N+ W  
Sbjct  457  ALDYTVCVQSEVFVTTQGGNFPHFLMGHRRYLLGGNAKTIKPDKWKLVLSFDDPNIRWSR  516

Query  354  FQDAVIEG-HANRQGEIRLRKPAKSLYTYPAPDCMCN  461
            F+  + E  H +    I  RKP  S+YT+P PDCMC 
Sbjct  517  FKHHMQEILHNSDIRGIAFRKPNDSIYTFPMPDCMCQ  553



>ref|XP_009379518.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=571

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 102/157 (65%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+  +Y     +S L+++FP +E K +LA++EE    KG  S LA
Sbjct  396  MLRGMGFDNATSVYIAAGNIYKAEKYMSPLKQMFPRLEMKDTLATAEELAPFKGHLSRLA  455

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KT++P+ + L  LF N ++ W +
Sbjct  456  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTVKPDKRKLALLFDNPSIRWED  515

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++++G   L+KP+ SLYT+P PDCMC
Sbjct  516  FKRQMQDMLRHSDQKG-FELKKPSASLYTFPMPDCMC  551



>ref|XP_008219032.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=503

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 102/156 (65%), Gaps = 6/156 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ L+++FP +E K +LA++EE    +G  S LA
Sbjct  328  MLRGMGFDNTTSVYIAAGKIYKAEKYMAPLKQMFPRLEMKDTLATAEELAPFQGHLSRLA  387

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI P+ + L  LF N ++ W +
Sbjct  388  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTINPDKRKLALLFDNPSIRWED  447

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCM  455
            F+  V +   H++++G + L+KP+ SLYT+P PDCM
Sbjct  448  FKKQVQDMLRHSDQKG-VELKKPSASLYTFPMPDCM  482



>ref|XP_006355100.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=578

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 99/159 (62%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFD  T +YLAS K+Y     +  L  +FPL++ K+ LAS EE G  +  +S +A
Sbjct  409  MLRGMGFDKVTSIYLASGKIYDSERHMKPLLEMFPLLQTKEMLASPEELGPFQNYSSRMA  468

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + +TIRP+ + L  L+ N N+ W  
Sbjct  469  AIDYTVCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSRTIRPDKRKLALLYDNPNIGWKS  528

Query  354  FQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            F+  +  I  H++ +G I +++P  S+Y++P PDCMC +
Sbjct  529  FKRQMLSIRAHSDSKG-IEIKRPNDSIYSFPCPDCMCRS  566



>ref|XP_003598018.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES68269.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=577

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+A+ K+Y     ++ L+++FP ++ K +LA+ EE  + KG +S LA
Sbjct  389  MLRGMGFDNTTLVYVAAGKIYKEQKYMAPLKQMFPRLQTKDTLATPEELAQFKGHSSRLA  448

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  
Sbjct  449  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYMYGGHSKTIKPDKRRLALLFDNPNIRWEV  508

Query  354  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + +   H++++G   ++K ++SLYT+P PDCMC
Sbjct  509  FKQQMKDMLRHSDQKG-TEVKKASESLYTFPMPDCMC  544



>gb|AES59903.2| O-fucosyltransferase family protein [Medicago truncatula]
Length=549

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 99/159 (62%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF  NT +YLAS K+Y G   ++ LR +FP +  K++LAS EE    K  +S +A
Sbjct  391  MLRGMGFTKNTSIYLASGKIYNGEKTMAPLREMFPNLHTKETLASEEELAPFKNYSSRMA  450

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W  
Sbjct  451  AIDYTVCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSKTIKPDKRKLALLFDSTNIGWKS  510

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
             +  ++    H++ +G + L++P  S Y++P PDCMC+A
Sbjct  511  LKHQLLSMRSHSDSKG-VELKRPNDSTYSFPCPDCMCHA  548



>ref|XP_008784225.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=552

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 95/156 (61%), Gaps = 4/156 (3%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFDN T +Y+AS K+Y     +  LR+LFP +E K +LAS++E    KG +S LA
Sbjct  392  MLRGMGFDNTTSVYVASGKIYNAKKYMDPLRQLFPRLETKDTLASADELAPFKGHSSRLA  451

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            A+DY V  HS++F++   GN  + M+GHR Y    + KTI+P+ + L   F N N+ W  
Sbjct  452  ALDYTVCAHSEVFVTTQGGNFPHFMMGHRRYLYEGHSKTIKPDKRRLVLSFDNPNIRWDR  511

Query  354  FQDAVIEG-HANRQGEIRLRKPAKSLYTYPAPDCMC  458
            F+  + E  H +    + LRK   +LYT+P PDCMC
Sbjct  512  FERNMQEMLHYSDLKGVALRKSNATLYTFPMPDCMC  547



>ref|XP_006469184.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=558

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 98/159 (62%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFD NT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +A
Sbjct  395  MLRGMGFDKNTYIFLASGKIYNAEKTMAPLLEMFPNLQTKEMLASEEELSPFKNFSSRMA  454

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            AVDY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  
Sbjct  455  AVDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWRS  514

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            F+  ++    H++ +G   L++P+ S YT+P PDCMC A
Sbjct  515  FKRQMLSMRSHSDSKG-YELKRPSDSPYTFPCPDCMCRA  552



>ref|XP_006448248.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
 gb|ESR61488.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
Length=558

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 98/159 (62%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFD NT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +A
Sbjct  395  MLRGMGFDKNTYIFLASGKIYNAEKTMAPLLEMFPNLQTKEMLASEEELSPFKNFSSRMA  454

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            AVDY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  
Sbjct  455  AVDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWRS  514

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            F+  ++    H++ +G   L++P+ S YT+P PDCMC A
Sbjct  515  FKRQMLSMRSHSDSKG-YELKRPSDSPYTFPCPDCMCRA  552



>gb|KDO64642.1| hypothetical protein CISIN_1g008637mg [Citrus sinensis]
Length=558

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 98/159 (62%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GFD NT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +A
Sbjct  395  MLRGMGFDKNTYIFLASGKIYNAEKTMAPLIEMFPNLQTKEMLASEEELAPFKNFSSRMA  454

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            AVDY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  
Sbjct  455  AVDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWRS  514

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
            F+  ++    H++ +G   L++P+ S YT+P PDCMC A
Sbjct  515  FKRQMLSMRSHSDSKG-YELKRPSDSPYTFPCPDCMCRA  552



>ref|XP_010931259.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Elaeis guineensis]
Length=497

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 99/159 (62%), Gaps = 6/159 (4%)
 Frame = +3

Query  3    LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  182
            +L  +GF NNT +YLAS K+Y     ++ L  +FPL++ K++LAS+EE    K  +S +A
Sbjct  328  ILRGMGFSNNTAIYLASGKIYKAEKAMAPLLEMFPLLQTKETLASAEELAPFKNYSSRMA  387

Query  183  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  353
            AVDY V +H ++F++   GN  + ++GHR Y    + KTI+P+ + L  L  N  ++W  
Sbjct  388  AVDYSVCLHGEVFVTTQGGNFPHFLIGHRRYLYGGHSKTIKPDKRKLALLLDNPKVSWKA  447

Query  354  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  464
             +  ++    H++ +G I +++P  S+YTYP PDCMC +
Sbjct  448  LKRQLLNMRAHSDAKG-IEIKRPNDSIYTYPCPDCMCRS  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875