BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN045C09

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP28148.1|  hypothetical protein JCGZ_13919                         175   1e-51   Jatropha curcas
ref|XP_006423746.1|  hypothetical protein CICLE_v10029382mg             175   2e-51   Citrus clementina [clementine]
ref|XP_006487496.1|  PREDICTED: uncharacterized protein LOC102621...    175   2e-51   Citrus sinensis [apfelsine]
ref|XP_008451574.1|  PREDICTED: uncharacterized protein LOC103492814    174   4e-51   Cucumis melo [Oriental melon]
ref|XP_004136030.1|  PREDICTED: universal stress protein MJ0531-like    173   6e-51   Cucumis sativus [cucumbers]
ref|XP_006423740.1|  hypothetical protein CICLE_v10029454mg             173   9e-51   Citrus clementina [clementine]
ref|XP_006487493.1|  PREDICTED: uncharacterized protein LOC102621046    172   2e-50   Citrus sinensis [apfelsine]
ref|XP_002523068.1|  conserved hypothetical protein                     169   2e-49   
ref|XP_011033550.1|  PREDICTED: uncharacterized protein LOC105132002    169   3e-49   Populus euphratica
emb|CDP20842.1|  unnamed protein product                                169   4e-49   Coffea canephora [robusta coffee]
emb|CBI36844.3|  unnamed protein product                                169   5e-49   Vitis vinifera
ref|XP_009399264.1|  PREDICTED: uncharacterized protein LOC103983718    169   5e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007050903.1|  Adenine nucleotide alpha hydrolases-like sup...    168   7e-49   
ref|XP_002321009.2|  universal stress family protein                    168   9e-49   
ref|XP_008369009.1|  PREDICTED: uncharacterized protein LOC103432589    168   9e-49   Malus domestica [apple tree]
ref|XP_010038207.1|  PREDICTED: universal stress protein A-like p...    167   1e-48   Eucalyptus grandis [rose gum]
gb|KJB23277.1|  hypothetical protein B456_004G089400                    167   1e-48   Gossypium raimondii
ref|XP_003591541.1|  Universal stress protein                           167   1e-48   Medicago truncatula
ref|XP_009586786.1|  PREDICTED: universal stress protein A-like p...    167   2e-48   Nicotiana tomentosiformis
ref|XP_011082474.1|  PREDICTED: universal stress protein A-like p...    167   2e-48   Sesamum indicum [beniseed]
ref|XP_009142507.1|  PREDICTED: universal stress protein A-like p...    166   4e-48   Brassica rapa
ref|XP_010684515.1|  PREDICTED: uncharacterized protein LOC104899079    166   4e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009342098.1|  PREDICTED: universal stress protein A-like p...    166   5e-48   Pyrus x bretschneideri [bai li]
ref|XP_008369005.1|  PREDICTED: uncharacterized protein LOC103432...    166   7e-48   
gb|KHG06374.1|  hypothetical protein F383_32883                         166   7e-48   Gossypium arboreum [tree cotton]
ref|XP_003591542.1|  Universal stress protein                           166   7e-48   Medicago truncatula
ref|XP_008369008.1|  PREDICTED: uncharacterized protein LOC103432...    166   8e-48   
ref|XP_010532403.1|  PREDICTED: universal stress protein A-like p...    166   8e-48   Tarenaya hassleriana [spider flower]
ref|XP_010069941.1|  PREDICTED: universal stress protein A-like p...    165   9e-48   Eucalyptus grandis [rose gum]
emb|CDY53014.1|  BnaC04g00160D                                          165   1e-47   Brassica napus [oilseed rape]
ref|XP_004290788.1|  PREDICTED: universal stress protein A-like p...    164   2e-47   Fragaria vesca subsp. vesca
ref|XP_008369003.1|  PREDICTED: uncharacterized protein LOC103432...    164   2e-47   
ref|XP_011008059.1|  PREDICTED: universal stress protein A-like p...    164   2e-47   Populus euphratica
ref|XP_008800823.1|  PREDICTED: universal stress protein A-like p...    164   2e-47   Phoenix dactylifera
gb|ACF74293.1|  universal stress protein                                165   2e-47   Arachis hypogaea [goober]
ref|XP_009799461.1|  PREDICTED: universal stress protein A-like p...    164   2e-47   Nicotiana sylvestris
ref|XP_008369004.1|  PREDICTED: uncharacterized protein LOC103432...    163   5e-47   
gb|AGV40783.1|  universal stress protein                                163   6e-47   Salicornia brachiata
ref|XP_002265489.2|  PREDICTED: uncharacterized protein LOC100260568    168   6e-47   Vitis vinifera
ref|XP_009405430.1|  PREDICTED: uncharacterized protein LOC103988576    163   7e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002301521.2|  LlDD2A18 family protein                            162   1e-46   
gb|AAR07598.1|  fiber protein Fb19                                      162   1e-46   Gossypium barbadense [Egyptian cotton]
ref|XP_004495963.1|  PREDICTED: universal stress protein A-like p...    162   1e-46   Cicer arietinum [garbanzo]
ref|XP_004495962.1|  PREDICTED: universal stress protein A-like p...    162   1e-46   Cicer arietinum [garbanzo]
ref|XP_010110918.1|  Universal stress protein A-like protein            162   2e-46   Morus notabilis
ref|NP_001066983.1|  Os12g0552500                                       162   2e-46   
gb|ADB54814.1|  universal stress protein 9303                           162   3e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010931649.1|  PREDICTED: universal stress protein A-like p...    161   4e-46   Elaeis guineensis
ref|XP_010921685.1|  PREDICTED: universal stress protein A-like p...    161   4e-46   Elaeis guineensis
ref|XP_009797826.1|  PREDICTED: universal stress protein A-like p...    161   5e-46   Nicotiana sylvestris
gb|AEZ00873.1|  putative universal stress protein                       160   6e-46   Elaeis guineensis
gb|EYU46674.1|  hypothetical protein MIMGU_mgv1a015298mg                160   6e-46   Erythranthe guttata [common monkey flower]
ref|XP_006588416.1|  PREDICTED: uncharacterized protein LOC100527...    160   6e-46   Glycine max [soybeans]
ref|XP_006664626.1|  PREDICTED: uncharacterized protein LOC102702434    161   6e-46   Oryza brachyantha
gb|AFK41746.1|  unknown                                                 160   7e-46   Lotus japonicus
ref|XP_007201282.1|  hypothetical protein PRUPE_ppa012608mg             160   7e-46   Prunus persica
ref|XP_008235225.1|  PREDICTED: uncharacterized protein LOC103334077    160   8e-46   Prunus mume [ume]
ref|XP_004494374.1|  PREDICTED: universal stress protein MJ0531-like    160   1e-45   Cicer arietinum [garbanzo]
ref|XP_008801104.1|  PREDICTED: universal stress protein A-like p...    161   1e-45   Phoenix dactylifera
ref|NP_001236718.1|  uncharacterized protein LOC100306046               160   1e-45   Glycine max [soybeans]
gb|KHN43511.1|  Universal stress protein A-like protein                 159   2e-45   Glycine soja [wild soybean]
gb|KFK37511.1|  hypothetical protein AALP_AA4G266700                    159   2e-45   Arabis alpina [alpine rockcress]
ref|XP_002301477.2|  hypothetical protein POPTR_0002s20670g             161   2e-45   Populus trichocarpa [western balsam poplar]
ref|NP_001238718.1|  uncharacterized protein LOC100527357               159   2e-45   Glycine max [soybeans]
gb|EYU46675.1|  hypothetical protein MIMGU_mgv1a015298mg                159   3e-45   Erythranthe guttata [common monkey flower]
ref|XP_003575575.1|  PREDICTED: uncharacterized protein LOC100829422    159   4e-45   Brachypodium distachyon [annual false brome]
ref|XP_009596691.1|  PREDICTED: universal stress protein A-like p...    159   4e-45   Nicotiana tomentosiformis
ref|XP_006397968.1|  hypothetical protein EUTSA_v10001666mg             158   5e-45   Eutrema salsugineum [saltwater cress]
ref|NP_001240086.1|  uncharacterized protein LOC100816212               158   6e-45   Glycine max [soybeans]
ref|XP_004962797.1|  PREDICTED: uncharacterized protein LOC101782...    157   1e-44   Setaria italica
ref|XP_007163107.1|  hypothetical protein PHAVU_001G206900g             157   2e-44   Phaseolus vulgaris [French bean]
ref|XP_009346602.1|  PREDICTED: uncharacterized protein LOC103938325    157   2e-44   
emb|CDX95730.1|  BnaC03g26110D                                          157   2e-44   
ref|XP_009133823.1|  PREDICTED: universal stress protein A-like p...    156   2e-44   Brassica rapa
ref|XP_010269547.1|  PREDICTED: uncharacterized protein LOC104606...    156   3e-44   Nelumbo nucifera [Indian lotus]
gb|KCW50026.1|  hypothetical protein EUGRSUZ_K03472                     157   3e-44   Eucalyptus grandis [rose gum]
ref|XP_010523934.1|  PREDICTED: uncharacterized protein LOC104802...    156   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_006574464.1|  PREDICTED: uncharacterized protein LOC100816...    156   3e-44   Glycine max [soybeans]
ref|XP_002882129.1|  universal stress protein family protein            156   3e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_002443334.1|  hypothetical protein SORBIDRAFT_08g017660          156   3e-44   Sorghum bicolor [broomcorn]
ref|XP_008386701.1|  PREDICTED: uncharacterized protein LOC103449189    155   5e-44   Malus domestica [apple tree]
ref|XP_006295139.1|  hypothetical protein CARUB_v10024211mg             155   6e-44   Capsella rubella
ref|NP_566108.1|  adenine nucleotide alpha hydrolases-like protein      155   7e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006352812.1|  PREDICTED: uncharacterized protein LOC102580875    155   9e-44   Solanum tuberosum [potatoes]
ref|XP_010507861.1|  PREDICTED: universal stress protein A-like p...    155   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_004242313.1|  PREDICTED: uncharacterized protein LOC101246641    155   1e-43   Solanum lycopersicum
gb|AFW56490.1|  hypothetical protein ZEAMMB73_742470                    155   1e-43   
emb|CBI36845.3|  unnamed protein product                                155   2e-43   Vitis vinifera
ref|XP_010518486.1|  PREDICTED: universal stress protein A-like p...    154   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_002271563.1|  PREDICTED: universal stress protein A-like p...    154   2e-43   Vitis vinifera
ref|XP_010269548.1|  PREDICTED: universal stress protein A-like p...    154   2e-43   Nelumbo nucifera [Indian lotus]
gb|EPS66020.1|  hypothetical protein M569_08758                         154   2e-43   Genlisea aurea
ref|NP_001288970.1|  universal stress protein A-like protein            154   3e-43   Brassica rapa
ref|XP_010038209.1|  PREDICTED: uncharacterized protein LOC104426758    154   3e-43   Eucalyptus grandis [rose gum]
ref|XP_006840564.1|  hypothetical protein AMTR_s00045p00225160          153   6e-43   Amborella trichopoda
gb|AAM63890.1|  unknown                                                 153   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009346604.1|  PREDICTED: universal stress protein A-like p...    153   6e-43   Pyrus x bretschneideri [bai li]
ref|XP_008789877.1|  PREDICTED: universal stress protein A-like p...    153   8e-43   Phoenix dactylifera
gb|AFW56491.1|  hypothetical protein ZEAMMB73_742470                    151   9e-43   
ref|NP_001150162.1|  fiber protein Fb19                                 152   1e-42   Zea mays [maize]
gb|ACF84743.1|  unknown                                                 152   1e-42   Zea mays [maize]
ref|XP_010523936.1|  PREDICTED: universal stress protein A-like p...    152   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_009346600.1|  PREDICTED: universal stress protein A-like p...    151   4e-42   
ref|XP_010938498.1|  PREDICTED: universal stress protein A-like p...    152   7e-42   
ref|NP_001066982.1|  Os12g0552400                                       150   8e-42   
ref|XP_004956772.1|  PREDICTED: uncharacterized protein LOC101762...    149   2e-41   Setaria italica
ref|XP_004240539.1|  PREDICTED: universal stress protein A-like p...    149   3e-41   Solanum lycopersicum
ref|XP_008386702.1|  PREDICTED: uncharacterized protein LOC103449190    148   4e-41   
gb|ABK22555.1|  unknown                                                 147   5e-41   Picea sitchensis
ref|XP_006355801.1|  PREDICTED: uncharacterized protein LOC102583766    148   6e-41   Solanum tuberosum [potatoes]
gb|EPS57241.1|  hypothetical protein M569_17579                         147   7e-41   Genlisea aurea
ref|XP_009412097.1|  PREDICTED: universal stress protein A-like p...    147   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB38589.1|  hypothetical protein B456_006G262000                    147   1e-40   Gossypium raimondii
ref|XP_009782538.1|  PREDICTED: universal stress protein A-like p...    147   1e-40   Nicotiana sylvestris
ref|XP_010692533.1|  PREDICTED: uncharacterized protein LOC104905637    147   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010276435.1|  PREDICTED: universal stress protein A-like p...    146   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010259730.1|  PREDICTED: uncharacterized protein LOC104599062    146   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_009598749.1|  PREDICTED: universal stress protein A-like p...    146   3e-40   Nicotiana tomentosiformis
emb|CDO98861.1|  unnamed protein product                                146   3e-40   Coffea canephora [robusta coffee]
ref|XP_004956773.1|  PREDICTED: uncharacterized protein LOC101762...    145   6e-40   
ref|XP_003625924.1|  Universal stress protein A-like protein            144   2e-39   Medicago truncatula
gb|EAY83459.1|  hypothetical protein OsI_38670                          148   2e-39   Oryza sativa Indica Group [Indian rice]
gb|AAT07452.1|  putative universal stress protein                       142   1e-38   Mirabilis jalapa
ref|XP_006342804.1|  PREDICTED: uncharacterized protein C167.05-like    141   2e-38   Solanum tuberosum [potatoes]
ref|XP_006844758.1|  hypothetical protein AMTR_s00016p00256970          141   3e-38   Amborella trichopoda
dbj|BAK07550.1|  predicted protein                                      141   6e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010321386.1|  PREDICTED: universal stress protein A-like p...    139   8e-38   
ref|XP_009595892.1|  PREDICTED: universal stress protein A-like p...    139   1e-37   Nicotiana tomentosiformis
ref|NP_001159181.1|  uncharacterized protein LOC100304266               139   2e-37   Zea mays [maize]
ref|XP_009795153.1|  PREDICTED: universal stress protein A-like p...    138   3e-37   Nicotiana sylvestris
ref|XP_004229244.1|  PREDICTED: universal stress protein A-like p...    138   4e-37   Solanum lycopersicum
ref|XP_003575585.1|  PREDICTED: uncharacterized protein LOC100832482    139   4e-37   Brachypodium distachyon [annual false brome]
ref|XP_007144278.1|  hypothetical protein PHAVU_007G143000g             136   1e-36   Phaseolus vulgaris [French bean]
ref|XP_008451579.1|  PREDICTED: uncharacterized protein LOC103492817    135   7e-36   Cucumis melo [Oriental melon]
ref|XP_004962799.1|  PREDICTED: universal stress protein A-like p...    134   1e-35   Setaria italica
ref|XP_010276436.1|  PREDICTED: uncharacterized protein LOC104611...    133   1e-35   
gb|KGN44937.1|  hypothetical protein Csa_7G397010                       133   3e-35   Cucumis sativus [cucumbers]
ref|XP_004136170.1|  PREDICTED: universal stress protein YxiE-like      133   4e-35   
ref|XP_007160573.1|  hypothetical protein PHAVU_002G333200g             132   6e-35   Phaseolus vulgaris [French bean]
ref|XP_007035604.1|  Adenine nucleotide alpha hydrolases-like sup...    134   8e-35   
ref|XP_004134490.1|  PREDICTED: universal stress protein MJ0531-like    132   9e-35   Cucumis sativus [cucumbers]
gb|EMT03450.1|  Universal stress protein A-like protein                 132   9e-35   
ref|XP_006380142.1|  LlDD2A18 family protein                            132   1e-34   
ref|XP_002443333.1|  hypothetical protein SORBIDRAFT_08g017640          134   1e-34   
ref|XP_009769248.1|  PREDICTED: universal stress protein A-like p...    131   2e-34   Nicotiana sylvestris
gb|EMS51706.1|  Universal stress protein A-like protein                 131   2e-34   Triticum urartu
ref|XP_004298129.1|  PREDICTED: uncharacterized protein LOC101292697    130   3e-34   Fragaria vesca subsp. vesca
ref|XP_006349949.1|  PREDICTED: uncharacterized protein LOC102595448    130   3e-34   
ref|XP_010440254.1|  PREDICTED: uncharacterized protein LOC104723570    130   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009612671.1|  PREDICTED: universal stress protein A-like p...    130   3e-34   Nicotiana tomentosiformis
ref|XP_004253149.1|  PREDICTED: universal stress protein A-like p...    130   5e-34   Solanum lycopersicum
ref|XP_004136029.1|  PREDICTED: universal stress protein MJ0531-like    130   6e-34   
ref|XP_008451580.1|  PREDICTED: uncharacterized protein LOC103492...    129   7e-34   Cucumis melo [Oriental melon]
ref|XP_002863949.1|  hypothetical protein ARALYDRAFT_917855             129   1e-33   Arabidopsis lyrata subsp. lyrata
emb|CDY05645.1|  BnaC02g38920D                                          129   2e-33   
gb|EMS45264.1|  Universal stress protein A-like protein                 127   2e-33   Triticum urartu
ref|XP_006395098.1|  hypothetical protein EUTSA_v10005680mg             128   2e-33   
ref|XP_008451581.1|  PREDICTED: uncharacterized protein LOC103492...    128   2e-33   Cucumis melo [Oriental melon]
gb|KFK31273.1|  hypothetical protein AALP_AA6G090900                    128   3e-33   Arabis alpina [alpine rockcress]
ref|XP_010523937.1|  PREDICTED: uncharacterized protein LOC104802163    128   3e-33   Tarenaya hassleriana [spider flower]
gb|AAV65310.1|  universal stress protein                                128   3e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009129758.1|  PREDICTED: uncharacterized protein LOC103854572    128   4e-33   
ref|XP_010524712.1|  PREDICTED: universal stress protein A-like p...    127   4e-33   Tarenaya hassleriana [spider flower]
emb|CDY33932.1|  BnaA02g30550D                                          127   6e-33   Brassica napus [oilseed rape]
ref|XP_007199080.1|  hypothetical protein PRUPE_ppa019122mg             125   1e-32   
ref|XP_010445967.1|  PREDICTED: universal stress protein A-like p...    126   1e-32   
ref|XP_006423747.1|  hypothetical protein CICLE_v10029382mg             126   2e-32   
ref|XP_004958663.1|  PREDICTED: uncharacterized protein LOC101769282    127   2e-32   Setaria italica
ref|XP_006658108.1|  PREDICTED: uncharacterized protein LOC102707323    126   2e-32   Oryza brachyantha
ref|XP_006487495.1|  PREDICTED: uncharacterized protein LOC102621...    127   2e-32   Citrus sinensis [apfelsine]
gb|EMS51705.1|  Universal stress protein A-like protein                 125   3e-32   Triticum urartu
ref|XP_010909279.1|  PREDICTED: uncharacterized protein LOC105035428    124   3e-32   
ref|NP_001060607.1|  Os07g0673400                                       125   3e-32   
ref|XP_006593395.1|  PREDICTED: uncharacterized protein LOC100527...    125   5e-32   
gb|EAZ05105.1|  hypothetical protein OsI_27297                          125   5e-32   Oryza sativa Indica Group [Indian rice]
gb|KHN30217.1|  Universal stress protein A-like protein                 124   5e-32   Glycine soja [wild soybean]
gb|AAM09541.1|AF491815_1  putative universal stress protein USP1        125   5e-32   Oryza sativa Indica Group [Indian rice]
ref|NP_001235200.1|  uncharacterized protein LOC100527376               124   6e-32   Glycine max [soybeans]
ref|XP_008340802.1|  PREDICTED: uncharacterized protein LOC103403747    124   8e-32   
gb|KDO50052.1|  hypothetical protein CISIN_1g030516mg                   124   1e-31   Citrus sinensis [apfelsine]
gb|EMT19721.1|  hypothetical protein F775_00737                         124   1e-31   
ref|XP_006423741.1|  hypothetical protein CICLE_v100301792mg            119   5e-31   
ref|XP_010440246.1|  PREDICTED: universal stress protein A-like p...    120   7e-31   Camelina sativa [gold-of-pleasure]
gb|KJB23278.1|  hypothetical protein B456_004G089400                    120   1e-30   Gossypium raimondii
ref|XP_008223197.1|  PREDICTED: universal stress protein A-like p...    121   1e-30   Prunus mume [ume]
emb|CAN83653.1|  hypothetical protein VITISV_015456                     120   1e-30   Vitis vinifera
gb|KDO71686.1|  hypothetical protein CISIN_1g044140mg                   120   2e-30   Citrus sinensis [apfelsine]
ref|XP_008451577.1|  PREDICTED: universal stress protein A-like p...    120   2e-30   Cucumis melo [Oriental melon]
ref|XP_008451575.1|  PREDICTED: universal stress protein A-like p...    121   2e-30   Cucumis melo [Oriental melon]
ref|XP_004136171.1|  PREDICTED: universal stress protein A-like p...    119   7e-30   
ref|XP_007199013.1|  hypothetical protein PRUPE_ppa017534mg             116   8e-30   
ref|XP_007225541.1|  hypothetical protein PRUPE_ppa026734mg             119   1e-29   Prunus persica
ref|XP_008438889.1|  PREDICTED: uncharacterized protein LOC103483...    118   2e-29   Cucumis melo [Oriental melon]
ref|XP_006419561.1|  hypothetical protein CICLE_v10007124mg             118   2e-29   
ref|XP_006281889.1|  hypothetical protein CARUB_v10028087mg             118   2e-29   
ref|XP_003591534.1|  Universal stress protein                           121   3e-29   
ref|XP_008438888.1|  PREDICTED: uncharacterized protein LOC103483...    119   3e-29   Cucumis melo [Oriental melon]
ref|XP_006489259.1|  PREDICTED: uncharacterized protein LOC102617240    117   4e-29   
gb|AES61785.2|  universal stress protein, putative                      119   7e-29   Medicago truncatula
ref|XP_008451576.1|  PREDICTED: universal stress protein A-like p...    117   8e-29   Cucumis melo [Oriental melon]
ref|XP_008451578.1|  PREDICTED: universal stress protein A-like p...    116   8e-29   Cucumis melo [Oriental melon]
ref|XP_010445975.1|  PREDICTED: universal stress protein A-like p...    116   1e-28   
emb|CDY27474.1|  BnaC04g51150D                                          111   7e-28   Brassica napus [oilseed rape]
gb|EMT19722.1|  Universal stress protein A-like protein                 113   7e-28   
ref|XP_004160568.1|  PREDICTED: LOW QUALITY PROTEIN: universal st...    114   8e-28   
gb|EMT26129.1|  Universal stress protein A-like protein                 114   1e-27   
ref|XP_003562469.1|  PREDICTED: universal stress protein A-like p...    112   3e-27   Brachypodium distachyon [annual false brome]
dbj|BAJ89788.1|  predicted protein                                      111   3e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008801103.1|  PREDICTED: uncharacterized protein LOC103715...    111   4e-26   Phoenix dactylifera
gb|EMS51704.1|  Universal stress protein A-like protein                 110   4e-26   Triticum urartu
tpg|DAA53433.1|  TPA: hypothetical protein ZEAMMB73_383574              108   7e-26   
ref|XP_007132573.1|  hypothetical protein PHAVU_011G106200g             107   1e-25   Phaseolus vulgaris [French bean]
ref|XP_008789878.1|  PREDICTED: uncharacterized protein LOC103707...    105   6e-25   Phoenix dactylifera
ref|XP_004962796.1|  PREDICTED: uncharacterized protein LOC101782...    106   6e-25   
ref|XP_008661990.1|  PREDICTED: fiber protein Fb19 isoform X1           104   5e-24   Zea mays [maize]
gb|ABR17632.1|  unknown                                                 103   1e-23   Picea sitchensis
gb|AID16048.1|  putative universal stress protein                     97.1    5e-22   Catharanthus roseus [chatas]
gb|AAM66054.1|  ethylene-responsive protein, putative                 98.6    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001030675.1|  universal stress protein-like protein            98.6    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566406.1|  universal stress protein-like protein               98.6    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850562.1|  universal stress protein-like protein               98.6    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882756.1|  universal stress protein family protein          98.6    1e-21   
ref|XP_010681487.1|  PREDICTED: uncharacterized protein LOC104896...  96.3    2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006841415.1|  hypothetical protein AMTR_s00003p00027540        96.7    3e-21   Amborella trichopoda
ref|XP_004956771.1|  PREDICTED: uncharacterized protein LOC101762...  97.1    4e-21   
ref|XP_010259333.1|  PREDICTED: universal stress protein A-like p...  95.9    4e-21   Nelumbo nucifera [Indian lotus]
ref|XP_008781086.1|  PREDICTED: universal stress protein A-like p...  95.9    5e-21   
ref|XP_002319486.1|  hypothetical protein POPTR_0013s01110g           95.9    6e-21   
ref|XP_009593918.1|  PREDICTED: universal stress protein A-like p...  94.4    6e-21   Nicotiana tomentosiformis
ref|XP_010264179.1|  PREDICTED: universal stress protein A-like p...  95.5    6e-21   Nelumbo nucifera [Indian lotus]
ref|XP_010681486.1|  PREDICTED: universal stress protein A-like p...  95.5    7e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007031134.1|  USP-like protein isoform 3                       95.5    9e-21   
ref|XP_009593917.1|  PREDICTED: uncharacterized protein LOC104090...  94.7    1e-20   Nicotiana tomentosiformis
gb|KDO76973.1|  hypothetical protein CISIN_1g031713mg                 94.7    1e-20   Citrus sinensis [apfelsine]
ref|XP_010464931.1|  PREDICTED: universal stress protein A-like p...  95.1    1e-20   
ref|XP_007031133.1|  Adenine nucleotide alpha hydrolases-like sup...  95.1    1e-20   
ref|XP_010464930.1|  PREDICTED: universal stress protein A-like p...  95.1    1e-20   
ref|XP_010464927.1|  PREDICTED: uncharacterized protein LOC104745...  95.5    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006407394.1|  hypothetical protein EUTSA_v10021565mg           95.1    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_006407393.1|  hypothetical protein EUTSA_v10021565mg           95.1    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010464928.1|  PREDICTED: universal stress protein A-like p...  95.1    2e-20   
ref|XP_011007726.1|  PREDICTED: universal stress protein A-like p...  94.4    2e-20   Populus euphratica
gb|KJB45407.1|  hypothetical protein B456_007G304500                  94.7    2e-20   Gossypium raimondii
ref|XP_011094181.1|  PREDICTED: uncharacterized protein C167.05-like  94.7    2e-20   Sesamum indicum [beniseed]
gb|ABK21527.1|  unknown                                               94.4    2e-20   Picea sitchensis
gb|KHG27977.1|  hypothetical protein F383_14126                       94.0    3e-20   Gossypium arboreum [tree cotton]
ref|XP_009795288.1|  PREDICTED: uncharacterized protein LOC104242017  95.5    3e-20   Nicotiana sylvestris
gb|KHG14939.1|  hypothetical protein F383_18523                       94.0    3e-20   Gossypium arboreum [tree cotton]
ref|XP_010938295.1|  PREDICTED: universal stress protein A-like p...  94.0    3e-20   Elaeis guineensis
ref|XP_010921510.1|  PREDICTED: universal stress protein A-like p...  94.0    3e-20   Elaeis guineensis
ref|XP_010498281.1|  PREDICTED: uncharacterized protein LOC104775...  94.7    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006842311.1|  hypothetical protein AMTR_s00079p00131240        93.6    3e-20   Amborella trichopoda
ref|XP_010486864.1|  PREDICTED: uncharacterized protein LOC104764...  94.4    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010486863.1|  PREDICTED: uncharacterized protein LOC104764...  94.4    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006448454.1|  hypothetical protein CICLE_v10017054mg           93.2    4e-20   
ref|XP_010486865.1|  PREDICTED: uncharacterized protein LOC104764...  94.4    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010498273.1|  PREDICTED: uncharacterized protein LOC104775...  94.7    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010498264.1|  PREDICTED: uncharacterized protein LOC104775...  94.4    4e-20   Camelina sativa [gold-of-pleasure]
dbj|BAF63495.1|  universal stress protein                             91.3    5e-20   Potamogeton distinctus
gb|KJB77133.1|  hypothetical protein B456_012G122100                  92.8    6e-20   Gossypium raimondii
ref|XP_008389279.1|  PREDICTED: universal stress protein A-like p...  92.8    6e-20   Malus domestica [apple tree]
ref|XP_007044293.1|  Adenine nucleotide alpha hydrolases-like sup...  92.8    7e-20   
gb|KJB45433.1|  hypothetical protein B456_007G305600                  93.2    7e-20   Gossypium raimondii
ref|XP_007031132.1|  USP-like protein isoform 1                       93.2    7e-20   
ref|XP_009121035.1|  PREDICTED: uncharacterized protein LOC103845...  93.6    7e-20   Brassica rapa
ref|XP_009121027.1|  PREDICTED: uncharacterized protein LOC103845...  93.6    7e-20   Brassica rapa
ref|XP_006296620.1|  hypothetical protein CARUB_v10014583mg           94.0    7e-20   
ref|XP_006296619.1|  hypothetical protein CARUB_v10014583mg           94.0    8e-20   
emb|CDY47907.1|  BnaAnng09390D                                        93.6    9e-20   Brassica napus [oilseed rape]
ref|XP_009135195.1|  PREDICTED: uncharacterized protein LOC103859...  93.6    9e-20   Brassica rapa
ref|XP_009135196.1|  PREDICTED: uncharacterized protein LOC103859...  93.2    9e-20   Brassica rapa
ref|XP_006481853.1|  PREDICTED: universal stress protein A-like p...  93.2    1e-19   Citrus sinensis [apfelsine]
ref|XP_006448455.1|  hypothetical protein CICLE_v10017054mg           92.0    1e-19   Citrus clementina [clementine]
ref|XP_007202546.1|  hypothetical protein PRUPE_ppa011155mg           93.6    1e-19   
ref|XP_006429979.1|  hypothetical protein CICLE_v10013408mg           92.8    1e-19   
ref|XP_010668291.1|  PREDICTED: universal stress protein A-like p...  91.3    1e-19   
ref|XP_009630150.1|  PREDICTED: universal stress protein A-like p...  92.0    2e-19   Nicotiana tomentosiformis
ref|NP_001237625.1|  uncharacterized protein LOC100305594             91.7    2e-19   Glycine max [soybeans]
ref|XP_009630149.1|  PREDICTED: universal stress protein A-like p...  91.7    2e-19   Nicotiana tomentosiformis
ref|XP_008241214.1|  PREDICTED: uncharacterized protein LOC103339659  92.4    2e-19   
ref|XP_008781084.1|  PREDICTED: universal stress protein A-like p...  91.3    3e-19   
ref|XP_008781085.1|  PREDICTED: uncharacterized protein LOC103700...  90.9    3e-19   
gb|KDP29423.1|  hypothetical protein JCGZ_18344                       91.3    3e-19   
gb|KHN23151.1|  Universal stress protein A-like protein               91.3    3e-19   
ref|XP_004299064.1|  PREDICTED: universal stress protein A-like p...  90.9    3e-19   
ref|XP_009804591.1|  PREDICTED: universal stress protein A-like p...  91.3    3e-19   
gb|KFK35113.1|  hypothetical protein AALP_AA5G237800                  92.0    3e-19   
ref|XP_002314854.1|  hypothetical protein POPTR_0010s13310g           90.9    3e-19   
emb|CDY01070.1|  BnaC05g41300D                                        90.9    3e-19   
ref|XP_006468711.1|  PREDICTED: universal stress protein A-like p...  90.9    4e-19   
ref|XP_004229049.1|  PREDICTED: universal stress protein A-like p...  90.9    4e-19   
ref|NP_001241989.1|  uncharacterized protein LOC100813085             90.5    4e-19   
gb|KFK35112.1|  hypothetical protein AALP_AA5G237800                  91.7    4e-19   
emb|CDY08484.1|  BnaA05g27200D                                        91.7    4e-19   
gb|EYU37238.1|  hypothetical protein MIMGU_mgv1a015255mg              90.9    4e-19   
ref|XP_002526987.1|  conserved hypothetical protein                   90.5    4e-19   
ref|XP_009804590.1|  PREDICTED: universal stress protein A-like p...  90.9    4e-19   
ref|XP_009376345.1|  PREDICTED: uncharacterized protein LOC103965052  91.3    6e-19   
ref|XP_004144759.1|  PREDICTED: universal stress protein MJ0577-l...  90.5    6e-19   
gb|AIR07400.1|  universal stress protein A                            90.5    7e-19   
ref|XP_004229048.1|  PREDICTED: universal stress protein A-like p...  90.1    8e-19   
gb|AFK39818.1|  unknown                                               89.7    8e-19   
ref|XP_009116523.1|  PREDICTED: uncharacterized protein C167.05-l...  90.5    8e-19   
ref|XP_003591211.1|  Universal stress protein A-like protein          90.1    8e-19   
ref|XP_004144758.1|  PREDICTED: universal stress protein MJ0577-l...  90.5    8e-19   
ref|XP_011023763.1|  PREDICTED: universal stress protein A-like p...  90.1    9e-19   
ref|XP_010524887.1|  PREDICTED: universal stress protein A-like p...  90.1    9e-19   
ref|XP_008241135.1|  PREDICTED: universal stress protein A-like p...  90.1    9e-19   
gb|KHG02297.1|  hypothetical protein F383_24645                       89.7    1e-18   
gb|AFK46242.1|  unknown                                               89.7    1e-18   
ref|XP_002526986.1|  conserved hypothetical protein                   89.7    1e-18   
ref|XP_010504800.1|  PREDICTED: uncharacterized protein LOC104781...  90.1    1e-18   
emb|CDY53924.1|  BnaC03g73550D                                        87.0    1e-18   
ref|XP_007029142.1|  Adenine nucleotide alpha hydrolases-like sup...  89.4    1e-18   
ref|XP_010524879.1|  PREDICTED: universal stress protein A-like p...  89.7    1e-18   
ref|XP_007029143.1|  Adenine nucleotide alpha hydrolases-like sup...  89.4    1e-18   
ref|XP_010524871.1|  PREDICTED: universal stress protein A-like p...  89.7    2e-18   
gb|KJB45404.1|  hypothetical protein B456_007G304400                  89.4    2e-18   
emb|CBI27004.3|  unnamed protein product                              89.0    2e-18   
ref|XP_007206031.1|  hypothetical protein PRUPE_ppa012501mg           89.0    2e-18   
ref|XP_006402787.1|  hypothetical protein EUTSA_v10006473mg           89.7    2e-18   
ref|XP_010431458.1|  PREDICTED: universal stress protein A-like p...  89.0    2e-18   
ref|XP_010921509.1|  PREDICTED: uncharacterized protein LOC105045047  89.0    2e-18   
ref|XP_002283402.1|  PREDICTED: universal stress protein A-like p...  89.0    2e-18   
ref|XP_010268016.1|  PREDICTED: universal stress protein A-like p...  88.6    2e-18   
ref|XP_006429978.1|  hypothetical protein CICLE_v10012833mg           89.4    2e-18   
ref|XP_006429977.1|  hypothetical protein CICLE_v10012833mg           89.4    2e-18   
ref|XP_011094180.1|  PREDICTED: universal stress protein A-like p...  89.4    2e-18   
gb|KDO70763.1|  hypothetical protein CISIN_1g046290mg                 89.4    2e-18   
gb|AID16045.1|  putative universal stress protein                     89.0    3e-18   
emb|CBI27006.3|  unnamed protein product                              88.2    3e-18   
ref|XP_010096805.1|  Universal stress protein A-like protein          88.6    3e-18   
ref|XP_002308342.2|  hypothetical protein POPTR_0006s21250g           89.0    3e-18   
ref|XP_010519995.1|  PREDICTED: universal stress protein A-like p...  89.0    3e-18   
ref|XP_006344751.1|  PREDICTED: uncharacterized protein C167.05-like  88.6    3e-18   
ref|XP_010519994.1|  PREDICTED: universal stress protein A-like p...  89.0    3e-18   
ref|XP_007216690.1|  hypothetical protein PRUPE_ppa026863mg           87.4    3e-18   
ref|XP_006433519.1|  hypothetical protein CICLE_v10002689mg           88.6    3e-18   
ref|XP_004495667.1|  PREDICTED: universal stress protein A-like p...  88.2    4e-18   
ref|XP_002283390.1|  PREDICTED: universal stress protein A-like p...  88.2    4e-18   
ref|XP_002980442.1|  hypothetical protein SELMODRAFT_112416           88.6    4e-18   
ref|XP_007202660.1|  hypothetical protein PRUPE_ppa012339mg           88.2    4e-18   
ref|XP_008389277.1|  PREDICTED: universal stress protein A-like p...  88.6    4e-18   
ref|XP_002962652.1|  hypothetical protein SELMODRAFT_79236            88.6    4e-18   
ref|NP_850717.1|  adenine nucleotide alpha hydrolases-like superf...  88.6    4e-18   
ref|XP_010504799.1|  PREDICTED: uncharacterized protein LOC104781...  88.6    4e-18   
ref|XP_009146670.1|  PREDICTED: uncharacterized protein LOC103870298  88.6    5e-18   
ref|XP_011464104.1|  PREDICTED: universal stress protein A-like p...  87.8    5e-18   
gb|KDO35866.1|  hypothetical protein CISIN_1g038513mg                 85.5    5e-18   
ref|XP_004230297.1|  PREDICTED: universal stress protein A-like p...  87.8    6e-18   
ref|XP_006293247.1|  hypothetical protein CARUB_v10019581mg           88.6    6e-18   
ref|XP_009116522.1|  PREDICTED: uncharacterized protein C167.05-l...  88.2    6e-18   
ref|XP_007223620.1|  hypothetical protein PRUPE_ppa012591mg           87.8    6e-18   
ref|XP_009116521.1|  PREDICTED: uncharacterized protein C167.05-l...  88.2    6e-18   
ref|XP_010268015.1|  PREDICTED: universal stress protein A-like p...  87.8    6e-18   
ref|XP_009758852.1|  PREDICTED: universal stress protein A-like p...  87.8    7e-18   
gb|KJB36208.1|  hypothetical protein B456_006G146300                  87.4    8e-18   
ref|XP_006481852.1|  PREDICTED: universal stress protein A-like p...  87.8    8e-18   
emb|CDX67744.1|  BnaA07g17840D                                        87.8    8e-18   
ref|XP_004303418.2|  PREDICTED: uncharacterized protein LOC101308005  89.0    9e-18   
ref|XP_006472185.1|  PREDICTED: universal stress protein A-like p...  87.4    9e-18   
ref|XP_004230296.1|  PREDICTED: universal stress protein A-like p...  87.4    9e-18   
ref|XP_003559418.1|  PREDICTED: universal stress protein A-like p...  88.2    9e-18   
ref|XP_011007756.1|  PREDICTED: universal stress protein A-like p...  87.4    9e-18   
ref|NP_191404.2|  adenine nucleotide alpha hydrolases-like superf...  87.8    1e-17   
ref|XP_006472184.1|  PREDICTED: universal stress protein A-like p...  87.4    1e-17   
ref|XP_008243247.1|  PREDICTED: uncharacterized protein C167.05-like  87.0    1e-17   
ref|XP_010044257.1|  PREDICTED: universal stress protein A-like p...  87.0    1e-17   
ref|XP_006417542.1|  hypothetical protein EUTSA_v10008924mg           87.0    1e-17   
ref|XP_009588426.1|  PREDICTED: universal stress protein A-like p...  87.4    1e-17   
gb|EYU18171.1|  hypothetical protein MIMGU_mgv1a026609mg              87.0    1e-17   
ref|XP_010677621.1|  PREDICTED: universal stress protein A-like p...  87.0    1e-17   
ref|XP_010265105.1|  PREDICTED: universal stress protein A-like p...  86.7    1e-17   
ref|XP_006576202.1|  PREDICTED: uncharacterized protein LOC100527...  87.0    1e-17   
ref|NP_001235063.1|  uncharacterized protein LOC100527623             87.0    1e-17   
ref|XP_003567587.1|  PREDICTED: universal stress protein A-like p...  86.7    1e-17   
ref|XP_009389841.1|  PREDICTED: universal stress protein A-like p...  87.0    1e-17   
gb|ABK26351.1|  unknown                                               86.3    2e-17   
ref|XP_009356253.1|  PREDICTED: universal stress protein A-like p...  87.0    2e-17   
ref|XP_010105075.1|  Universal stress protein A-like protein          87.0    2e-17   
ref|XP_002314856.1|  hypothetical protein POPTR_0010s13330g           86.7    2e-17   
gb|EPS58073.1|  hypothetical protein M569_16744                       85.1    2e-17   
ref|XP_008388484.1|  PREDICTED: universal stress protein A-like p...  86.7    2e-17   
ref|XP_010534373.1|  PREDICTED: universal stress protein A-like p...  87.0    2e-17   
ref|XP_006429980.1|  hypothetical protein CICLE_v10012835mg           87.0    2e-17   
ref|XP_010259332.1|  PREDICTED: universal stress protein A-like p...  86.3    2e-17   
gb|KFK38558.1|  hypothetical protein AALP_AA3G129200                  87.0    2e-17   
gb|KDO70762.1|  hypothetical protein CISIN_1g044973mg                 87.0    2e-17   
ref|XP_002512499.1|  conserved hypothetical protein                   86.7    2e-17   
ref|XP_010259331.1|  PREDICTED: universal stress protein A-like p...  86.3    2e-17   
ref|XP_002467191.1|  hypothetical protein SORBIDRAFT_01g021200        86.3    2e-17   
emb|CDX71957.1|  BnaC08g29170D                                        86.7    2e-17   
ref|XP_009338192.1|  PREDICTED: universal stress protein A-like p...  86.3    2e-17   
gb|KHN43465.1|  Universal stress protein A-like protein               85.5    2e-17   
ref|XP_009393020.1|  PREDICTED: universal stress protein A-like p...  86.3    2e-17   
ref|XP_006604738.1|  PREDICTED: universal stress protein A-like p...  85.9    2e-17   
emb|CDP10547.1|  unnamed protein product                              86.3    2e-17   
ref|XP_008370382.1|  PREDICTED: universal stress protein A-like p...  85.9    2e-17   
ref|XP_011042515.1|  PREDICTED: universal stress protein A-like p...  86.3    3e-17   
ref|XP_010917884.1|  PREDICTED: universal stress protein A-like p...  86.3    3e-17   
gb|EYU40765.1|  hypothetical protein MIMGU_mgv1a025375mg              85.5    3e-17   
ref|XP_009104144.1|  PREDICTED: universal stress protein A-like p...  86.7    3e-17   
ref|XP_007144994.1|  hypothetical protein PHAVU_007G200700g           85.5    3e-17   
ref|XP_010099245.1|  Universal stress protein A-like protein          85.9    3e-17   
gb|KJB77132.1|  hypothetical protein B456_012G122100                  86.3    3e-17   
ref|XP_007202545.1|  hypothetical protein PRUPE_ppa011155mg           86.7    3e-17   
gb|KDP21924.1|  hypothetical protein JCGZ_03062                       85.9    3e-17   
ref|XP_006481854.1|  PREDICTED: universal stress protein A-like p...  86.3    4e-17   
ref|XP_006650590.1|  PREDICTED: universal stress protein A-like p...  85.5    4e-17   
ref|XP_007144315.1|  hypothetical protein PHAVU_007G145800g           84.7    4e-17   
ref|XP_004983044.1|  PREDICTED: universal stress protein A-like p...  85.5    5e-17   
ref|XP_010921785.1|  PREDICTED: universal stress protein A-like p...  85.1    5e-17   
ref|XP_006337956.1|  PREDICTED: universal stress protein A-like p...  85.5    5e-17   
gb|KDP21925.1|  hypothetical protein JCGZ_03063                       85.5    5e-17   
ref|XP_009116524.1|  PREDICTED: universal stress protein A-like p...  85.5    5e-17   
gb|KDP29425.1|  hypothetical protein JCGZ_18346                       84.7    6e-17   
ref|NP_172445.2|  adenine nucleotide alpha hydrolases-like protein    85.1    6e-17   
ref|XP_002323356.2|  hypothetical protein POPTR_0016s06400g           85.9    6e-17   
gb|ADE77419.1|  unknown                                               84.7    6e-17   
ref|XP_009373273.1|  PREDICTED: universal stress protein A-like p...  85.1    7e-17   
ref|XP_009373274.1|  PREDICTED: universal stress protein A-like p...  84.7    7e-17   
ref|XP_006841416.1|  hypothetical protein AMTR_s00003p00028670        82.8    7e-17   
emb|CBI27007.3|  unnamed protein product                              83.2    7e-17   
ref|XP_002889767.1|  hypothetical protein ARALYDRAFT_471075           84.7    7e-17   
ref|XP_011022261.1|  PREDICTED: universal stress protein A-like p...  84.7    7e-17   
gb|ABK23398.1|  unknown                                               84.3    7e-17   
ref|XP_010264134.1|  PREDICTED: universal stress protein A-like p...  84.7    8e-17   
ref|XP_008454297.1|  PREDICTED: uncharacterized protein C167.05       84.7    8e-17   
ref|XP_010044261.1|  PREDICTED: universal stress protein A-like p...  84.7    8e-17   
ref|XP_010516493.1|  PREDICTED: uncharacterized protein LOC104792...  84.7    1e-16   
ref|XP_011087485.1|  PREDICTED: universal stress protein A-like p...  84.3    1e-16   
gb|AAB60745.1|  ESTs gb|ATTS1236,gb|T43334,gb|N97019,gb|AA395203 ...  84.3    1e-16   
emb|CBI39085.3|  unnamed protein product                              83.2    1e-16   
ref|XP_008243246.1|  PREDICTED: universal stress protein A-like p...  84.3    1e-16   
ref|XP_009110805.1|  PREDICTED: universal stress protein A-like p...  84.0    1e-16   
ref|XP_006651364.1|  PREDICTED: universal stress protein A-like p...  82.4    1e-16   
ref|XP_002312405.1|  universal stress family protein                  84.0    1e-16   
ref|XP_002282460.1|  PREDICTED: universal stress protein A-like p...  84.0    1e-16   
ref|XP_010475820.1|  PREDICTED: universal stress protein A-like p...  84.0    2e-16   
ref|XP_002455517.1|  hypothetical protein SORBIDRAFT_03g012520        84.0    2e-16   
ref|XP_009356255.1|  PREDICTED: universal stress protein A-like p...  84.0    2e-16   
ref|XP_009416236.1|  PREDICTED: uncharacterized protein LOC103996900  84.3    2e-16   
ref|XP_002876463.1|  universal stress protein family protein          84.3    2e-16   
ref|XP_010024119.1|  PREDICTED: universal stress protein A-like p...  83.6    2e-16   
ref|XP_011047112.1|  PREDICTED: universal stress protein A-like p...  84.3    2e-16   
ref|XP_011047113.1|  PREDICTED: uncharacterized protein LOC105141...  84.3    2e-16   
ref|XP_008369051.1|  PREDICTED: universal stress protein A-like p...  83.6    2e-16   
ref|XP_010024118.1|  PREDICTED: universal stress protein A-like p...  83.6    2e-16   
gb|ABR16994.1|  unknown                                               83.2    2e-16   
ref|XP_010659697.1|  PREDICTED: universal stress protein A-like p...  83.6    2e-16   
ref|XP_002282537.1|  PREDICTED: universal stress protein A-like p...  83.6    2e-16   
ref|XP_004300460.1|  PREDICTED: uncharacterized protein LOC101301587  83.6    2e-16   
emb|CAN69650.1|  hypothetical protein VITISV_010535                   83.6    2e-16   
ref|XP_006305720.1|  hypothetical protein CARUB_v10010470mg           83.6    2e-16   
ref|XP_002266746.3|  PREDICTED: universal stress protein A-like p...  84.3    2e-16   
ref|XP_011079565.1|  PREDICTED: universal stress protein A-like p...  83.2    2e-16   
ref|XP_004299066.1|  PREDICTED: universal stress protein A-like p...  83.6    3e-16   
gb|KDP23405.1|  hypothetical protein JCGZ_23238                       83.2    3e-16   
ref|XP_006486684.1|  PREDICTED: uncharacterized protein C167.05-like  83.2    3e-16   
gb|KEH41788.1|  adenine nucleotide alpha hydrolase superfamily pr...  83.2    3e-16   
ref|XP_006422530.1|  hypothetical protein CICLE_v10030411mg           83.2    3e-16   
ref|NP_001132550.1|  universal stress protein                         83.2    3e-16   
ref|NP_850563.1|  universal stress protein-like protein               84.0    3e-16   
gb|AGT17355.1|  hypothetical protein SHCRBa_260_G18_F_60              83.2    3e-16   
ref|XP_008386726.1|  PREDICTED: universal stress protein A-like p...  82.8    3e-16   
ref|XP_010265106.1|  PREDICTED: universal stress protein A-like p...  83.2    3e-16   
ref|XP_010458272.1|  PREDICTED: universal stress protein A-like p...  83.2    3e-16   
ref|XP_010653225.1|  PREDICTED: universal stress protein A-like p...  83.6    3e-16   
ref|XP_010490289.1|  PREDICTED: universal stress protein A-like p...  82.8    3e-16   
ref|XP_010046110.1|  PREDICTED: uncharacterized protein LOC104434970  82.8    3e-16   
ref|XP_003591417.1|  Universal stress protein A-like protein          82.8    3e-16   
emb|CDP10546.1|  unnamed protein product                              84.3    3e-16   
ref|XP_010087250.1|  Universal stress protein A-like protein          82.8    4e-16   
ref|XP_004135089.1|  PREDICTED: universal stress protein A-like p...  82.4    4e-16   
ref|XP_011036946.1|  PREDICTED: universal stress protein A-like p...  82.8    4e-16   
emb|CDY20676.1|  BnaC08g13820D                                        82.8    4e-16   
ref|XP_006649957.1|  PREDICTED: uncharacterized protein C167.05-like  82.8    4e-16   
ref|XP_009395576.1|  PREDICTED: universal stress protein A-like p...  82.4    4e-16   
ref|XP_010516491.1|  PREDICTED: uncharacterized protein LOC104792...  83.2    4e-16   
ref|NP_001051280.1|  Os03g0750000                                     81.6    4e-16   
ref|XP_008241215.1|  PREDICTED: uncharacterized protein LOC103339661  83.6    4e-16   
ref|XP_003518831.1|  PREDICTED: universal stress protein A-like p...  82.4    4e-16   
ref|XP_008446610.1|  PREDICTED: universal stress protein A-like p...  82.4    4e-16   
gb|EAY78646.1|  hypothetical protein OsI_33745                        82.8    5e-16   
ref|XP_002283457.1|  PREDICTED: universal stress protein A-like p...  82.4    5e-16   
gb|ACG26484.1|  universal stress protein                              82.4    5e-16   
ref|XP_008797807.1|  PREDICTED: universal stress protein A-like p...  82.4    5e-16   
ref|NP_001064677.1|  Os10g0437500                                     82.8    5e-16   
ref|XP_004495908.1|  PREDICTED: universal stress protein A-like p...  82.0    5e-16   
gb|ADB54816.1|  universal stress protein 9308                         82.8    5e-16   
gb|KDP28246.1|  hypothetical protein JCGZ_14017                       82.4    5e-16   
gb|ADB54817.1|  universal stress protein 9308                         82.8    5e-16   
gb|EYU18169.1|  hypothetical protein MIMGU_mgv11b0160062mg            80.1    5e-16   
ref|XP_010066711.1|  PREDICTED: universal stress protein A-like p...  80.9    5e-16   
ref|XP_010041145.1|  PREDICTED: universal stress protein A-like p...  82.4    6e-16   
ref|XP_010263144.1|  PREDICTED: universal stress protein A-like p...  82.8    6e-16   
ref|XP_008339660.1|  PREDICTED: universal stress protein A-like p...  82.8    6e-16   
ref|XP_010040271.1|  PREDICTED: universal stress protein A-like p...  82.0    6e-16   
ref|XP_010041104.1|  PREDICTED: universal stress protein A-like p...  82.0    6e-16   
emb|CDP18238.1|  unnamed protein product                              82.4    6e-16   



>gb|KDP28148.1| hypothetical protein JCGZ_13919 [Jatropha curcas]
Length=161

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+VDSDLK+IAARVIERAKEICASKSV+D ++E+ EGDARNVLCE VEKHHASI
Sbjct  61   GAAEVLPYVDSDLKRIAARVIERAKEICASKSVNDVIYEVGEGDARNVLCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            L VGSHGYGAIKRAVLGSVSDYC+HHAHC+VMIVKKPK K
Sbjct  121  LAVGSHGYGAIKRAVLGSVSDYCSHHAHCSVMIVKKPKIK  160



>ref|XP_006423746.1| hypothetical protein CICLE_v10029382mg [Citrus clementina]
 gb|ESR36986.1| hypothetical protein CICLE_v10029382mg [Citrus clementina]
Length=161

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+VDSDLKKIAARV+E+AKEIC+SKSV D + E++EGDARN+LCE VEKHHASI
Sbjct  61   GAAEVLPYVDSDLKKIAARVVEKAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK+PK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPKTK  160



>ref|XP_006487496.1| PREDICTED: uncharacterized protein LOC102621599 isoform X2 [Citrus 
sinensis]
Length=161

 Score =   175 bits (443),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+VDSDLKKIAARV+E+AKEIC+SKSV D + E++EGDARN+LCE VEKHHASI
Sbjct  61   GAAEVLPYVDSDLKKIAARVVEKAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK+PK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPKTK  160



>ref|XP_008451574.1| PREDICTED: uncharacterized protein LOC103492814 [Cucumis melo]
Length=162

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+VDSDLKKIAARVIE+AKEIC ++SV D + E++EGDARNVLCE VEKHHAS+
Sbjct  62   GAAEVLPYVDSDLKKIAARVIEKAKEICLARSVHDVVLEVIEGDARNVLCEAVEKHHASV  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTK  161



>ref|XP_004136030.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus]
 ref|XP_004173164.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus]
 gb|KGN44933.1| hypothetical protein Csa_7G396480 [Cucumis sativus]
Length=162

 Score =   173 bits (439),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+VDSDLKKIAARVIE+AKE+C ++SV D + E++EGDARNVLCE VEKHHAS+
Sbjct  62   GAAEVLPYVDSDLKKIAARVIEKAKELCLARSVHDVLLEVIEGDARNVLCEAVEKHHASM  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTK  161



>ref|XP_006423740.1| hypothetical protein CICLE_v10029454mg [Citrus clementina]
 ref|XP_006487494.1| PREDICTED: uncharacterized protein LOC102621316 [Citrus sinensis]
 gb|ESR36980.1| hypothetical protein CICLE_v10029454mg [Citrus clementina]
 gb|KDO50051.1| hypothetical protein CISIN_1g030516mg [Citrus sinensis]
Length=161

 Score =   173 bits (438),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA ++LPHVDSD KKIAARV+E AKEIC+SKSV D + E++EGDARN+LCE VEKHHASI
Sbjct  61   GAVEVLPHVDSDFKKIAARVVEEAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK+PK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPKTK  160



>ref|XP_006487493.1| PREDICTED: uncharacterized protein LOC102621046 [Citrus sinensis]
Length=161

 Score =   172 bits (436),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA ++LPHVDSDLKKIAAR++E AKEIC+SKSV D + E++EGDARN+LC+ VEKHHASI
Sbjct  61   GAVEVLPHVDSDLKKIAARLVEEAKEICSSKSVHDAVVEVVEGDARNILCDAVEKHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK+PK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPKTK  160



>ref|XP_002523068.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39253.1| conserved hypothetical protein [Ricinus communis]
Length=161

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+VD+DLK+IAARV+E+AKE C SKSV+D ++E++EGDARNVLCE VEKHHASI
Sbjct  61   GAAEVLPYVDADLKRIAARVVEKAKEKCTSKSVNDVVYEVVEGDARNVLCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYC+HHAHC+VMIVK+PK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCSHHAHCSVMIVKRPKIK  160



>ref|XP_011033550.1| PREDICTED: uncharacterized protein LOC105132002 [Populus euphratica]
Length=162

 Score =   169 bits (428),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP V+SDLKKIAARVIE+AK  C SKSV D +FE++EGDARNVLCE V+KH+ASI
Sbjct  62   GAAEVLPFVESDLKKIAARVIEKAKGTCTSKSVSDVVFELVEGDARNVLCEAVDKHNASI  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK+PK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPKIK  161



>emb|CDP20842.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   169 bits (427),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+VD DLKKIAARV+E AKEIC++KSV+D   E +EGDARNVLCE VEKHHASI
Sbjct  61   GAADVLPYVDVDLKKIAARVLESAKEICSAKSVNDVAVEAVEGDARNVLCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGAIKRAVLGSVSDYC HHAHCTVMIVKKPK K
Sbjct  121  LVLGSHGYGAIKRAVLGSVSDYCVHHAHCTVMIVKKPKIK  160



>emb|CBI36844.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   169 bits (427),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+V++DLKKIA RV+ +A EICASKSV D + E++EGDARNV+CE VEKHHASI
Sbjct  61   GAADVLPYVEADLKKIAGRVVGKAHEICASKSVTDVILEVVEGDARNVMCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIK  160



>ref|XP_009399264.1| PREDICTED: uncharacterized protein LOC103983718 [Musa acuminata 
subsp. malaccensis]
Length=170

 Score =   169 bits (427),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP V+SDL+KI+ RVIE+AKEIC S SV D  FE++EGDARNVLCE VEKHHA I
Sbjct  70   GAADVLPFVESDLRKISLRVIEKAKEICTSHSVADVEFEVVEGDARNVLCEAVEKHHAEI  129

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKR VLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  130  LVVGSHGYGAIKRTVLGSVSDYCAHHAHCTVMIVKKPKPK  169



>ref|XP_007050903.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
 gb|EOX95060.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
[Theobroma cacao]
Length=161

 Score =   168 bits (425),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+VD+DL+KIAARV+E+AKE+C  KSV+D + E++EGDARNVLCE VEKHHAS+
Sbjct  61   GAADVLPYVDADLRKIAARVVEKAKELCLGKSVNDAVVEVVEGDARNVLCEAVEKHHASM  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVK+P  K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKRPTIK  160



>ref|XP_002321009.2| universal stress family protein [Populus trichocarpa]
 gb|EEE99324.2| universal stress family protein [Populus trichocarpa]
Length=162

 Score =   168 bits (425),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP V+SDLKKIAARVIE+AK  C SKSV D +FE++EGDARNVLCE V+KH+ASI
Sbjct  62   GAAEVLPFVESDLKKIAARVIEKAKGTCTSKSVSDVVFELVEGDARNVLCEAVDKHNASI  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKR VLGSVSDYCAHHAHCTVMIVK+PK K
Sbjct  122  LVVGSHGYGAIKRVVLGSVSDYCAHHAHCTVMIVKRPKIK  161



>ref|XP_008369009.1| PREDICTED: uncharacterized protein LOC103432589 [Malus domestica]
Length=161

 Score =   168 bits (425),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP VDSDLKK+AARV E+AKE CASKSV D + E++EGDARNVLCE VE+HHASI
Sbjct  61   GAAEVLPIVDSDLKKMAARVTEKAKEFCASKSVTDVVAEVVEGDARNVLCEAVERHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYC HHAHCTVMIVKKPK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCTHHAHCTVMIVKKPKIK  160



>ref|XP_010038207.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
 gb|KCW50025.1| hypothetical protein EUGRSUZ_K03471 [Eucalyptus grandis]
Length=159

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G AD+LP V++DLKKIAARV+E+AKEIC SK V+D + E+ EGDARNVLCE VEKHHASI
Sbjct  59   GTADVLPFVEADLKKIAARVLEKAKEICCSKLVNDVVLEVGEGDARNVLCEAVEKHHASI  118

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVG+HGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  119  LVVGNHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIK  158



>gb|KJB23277.1| hypothetical protein B456_004G089400 [Gossypium raimondii]
Length=162

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+VD+DL+KIAARV+E+AKE+C SKSV D + E++EGDARNVLC+ VEKHHAS+
Sbjct  62   GAADVLPYVDADLRKIAARVVEKAKELCLSKSVHDAVVEVVEGDARNVLCDAVEKHHASV  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            L VGSHGYGAIKRAVLGSVSDYC+HHAHC+VMIVKKPK K
Sbjct  122  LAVGSHGYGAIKRAVLGSVSDYCSHHAHCSVMIVKKPKIK  161



>ref|XP_003591541.1| Universal stress protein [Medicago truncatula]
 gb|AES61792.1| universal stress family protein [Medicago truncatula]
 gb|AFK47017.1| unknown [Medicago truncatula]
Length=167

 Score =   167 bits (424),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            AGAA++LP VDSDL+KIAARV E AK++C  KSV+D + E++EGDARNVLC+TVEK+ AS
Sbjct  66   AGAAEVLPIVDSDLRKIAARVAENAKQLCIKKSVNDVIVEVVEGDARNVLCDTVEKYRAS  125

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  126  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTK  166



>ref|XP_009586786.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=160

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ +ILP +++DLKKIAARV+E+AKEIC +KSV+D + E+ EGDARNVLCE VEKHHASI
Sbjct  60   GSVEILPSLETDLKKIAARVVEKAKEICTAKSVNDVIVEVEEGDARNVLCEAVEKHHASI  119

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LVVGSHGYG ++R VLGSVSDYCAHHAHC+VMIVKKPKHK+
Sbjct  120  LVVGSHGYGVLRRTVLGSVSDYCAHHAHCSVMIVKKPKHKS  160



>ref|XP_011082474.1| PREDICTED: universal stress protein A-like protein [Sesamum indicum]
Length=158

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+A++LP+VD DL+KIAARV+E+AKE+C +KSV+D MFE+++GDARNVLCE VEKH A++
Sbjct  58   GSAEVLPYVDLDLRKIAARVLEKAKEMCTAKSVNDAMFEVVDGDARNVLCEAVEKHPATV  117

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGA+KRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  118  LVVGSHGYGALKRAVLGSVSDYCAHHAHCSVMIVKKPKIK  157



>ref|XP_009142507.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
 emb|CDX80128.1| BnaA05g00280D [Brassica napus]
Length=162

 Score =   166 bits (420),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+VD+DLK IAARVIE AK IC SKSVD  MFE+ EGDAR++LC+ V+KHHAS+
Sbjct  62   GAAEVLPYVDTDLKHIAARVIEMAKGICQSKSVDGAMFEVFEGDARSILCDVVDKHHASL  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKIK  161



>ref|XP_010684515.1| PREDICTED: uncharacterized protein LOC104899079 [Beta vulgaris 
subsp. vulgaris]
Length=160

 Score =   166 bits (420),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G ++ILP VD+DLKKIAARVIE+AKE+C SKS+DD   E++EGDARNVLCE VEKHHAS+
Sbjct  60   GGSEILPVVDTDLKKIAARVIEKAKELCHSKSLDDVAVEVVEGDARNVLCEAVEKHHASM  119

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  120  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKIK  159



>ref|XP_009342098.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=161

 Score =   166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP V++DLKK+AARV E+AKE CASKSV D + E++EGDARNVLCE VE+HHASI
Sbjct  61   GAAEVLPIVEADLKKMAARVTEKAKEFCASKSVTDVVAEVVEGDARNVLCEAVERHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYC HHAHCTVMIVKKPK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCTHHAHCTVMIVKKPKTK  160



>ref|XP_008369005.1| PREDICTED: uncharacterized protein LOC103432587 isoform X1 [Malus 
domestica]
 ref|XP_008369006.1| PREDICTED: uncharacterized protein LOC103432587 isoform X1 [Malus 
domestica]
 ref|XP_008369007.1| PREDICTED: uncharacterized protein LOC103432587 isoform X1 [Malus 
domestica]
Length=161

 Score =   166 bits (419),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
             A++LP VD+DLKK+AARV ERAKE CASKSV D + E+MEGDARNVLCE VE+HHASIL
Sbjct  62   GAEVLPIVDADLKKMAARVTERAKEFCASKSVTDVVVEVMEGDARNVLCEAVERHHASIL  121

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            VVGSHGYGAIKRA LGSVSDYCAHH HCTVMIVKKPK K
Sbjct  122  VVGSHGYGAIKRAXLGSVSDYCAHHVHCTVMIVKKPKTK  160



>gb|KHG06374.1| hypothetical protein F383_32883 [Gossypium arboreum]
Length=162

 Score =   166 bits (419),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+VD+DL+KIAARV+E+AKE+C SKSV D + E+ EGDARNVLC+ VEKHHASI
Sbjct  62   GAADVLPYVDADLRKIAARVVEKAKELCLSKSVHDAVVEVGEGDARNVLCDAVEKHHASI  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            L VGSHGYGAIKRAVLGSVSDYC+HHAHC+VMIVK+PK K
Sbjct  122  LAVGSHGYGAIKRAVLGSVSDYCSHHAHCSVMIVKRPKIK  161



>ref|XP_003591542.1| Universal stress protein [Medicago truncatula]
 gb|AES61793.1| universal stress family protein [Medicago truncatula]
 gb|AFK39064.1| unknown [Medicago truncatula]
Length=164

 Score =   166 bits (419),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP VDSDL+KIAARV E AK++C  KSV+D + E++EGDARNVLC+TVEK+ ASI
Sbjct  64   GAAEVLPIVDSDLRKIAARVAENAKQLCIKKSVNDVIVEVVEGDARNVLCDTVEKYRASI  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  124  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTK  163



>ref|XP_008369008.1| PREDICTED: uncharacterized protein LOC103432587 isoform X2 [Malus 
domestica]
Length=160

 Score =   166 bits (419),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
             A++LP VD+DLKK+AARV ERAKE CASKSV D + E+MEGDARNVLCE VE+HHASIL
Sbjct  61   GAEVLPIVDADLKKMAARVTERAKEFCASKSVTDVVVEVMEGDARNVLCEAVERHHASIL  120

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            VVGSHGYGAIKRA LGSVSDYCAHH HCTVMIVKKPK K
Sbjct  121  VVGSHGYGAIKRAXLGSVSDYCAHHVHCTVMIVKKPKTK  159



>ref|XP_010532403.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
 ref|XP_010519347.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
 ref|XP_010521003.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=162

 Score =   166 bits (419),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P VD+DLKKIAARV+E+AKEIC S+SV D   E++EGDARNVLCE VE+HHAS+
Sbjct  62   GTAEVVPFVDADLKKIAARVVEKAKEICHSRSVSDATVEVIEGDARNVLCEVVERHHASV  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKIK  161



>ref|XP_010069941.1| PREDICTED: universal stress protein A-like protein [Eucalyptus 
grandis]
 gb|KCW58470.1| hypothetical protein EUGRSUZ_H01151 [Eucalyptus grandis]
Length=163

 Score =   165 bits (418),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++ P VD+DLKK AARV+E+AK++CASKSV D  FE++EGD RNVLC+ VEKHHASI
Sbjct  63   GAAEVFPIVDADLKKRAARVVEKAKDLCASKSVHDVTFEVVEGDPRNVLCDAVEKHHASI  122

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  123  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKAK  162



>emb|CDY53014.1| BnaC04g00160D [Brassica napus]
Length=162

 Score =   165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+VD+DLK IAARVIE AK IC SKSV+  MFE+ EGDAR++LC+ V+KHHAS+
Sbjct  62   GAAEVLPYVDTDLKHIAARVIEMAKGICQSKSVNGAMFEVFEGDARSILCDVVDKHHASL  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKIK  161



>ref|XP_004290788.1| PREDICTED: universal stress protein A-like protein [Fragaria 
vesca subsp. vesca]
Length=159

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+++P VD+DLKK AARV E+AKE CASKSV D + E++EGDARNVLCE VE+HHAS+
Sbjct  59   GAAEVMPIVDADLKKQAARVSEKAKEFCASKSVKDVVIEVIEGDARNVLCEAVERHHASV  118

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  119  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKRPKTK  158



>ref|XP_008369003.1| PREDICTED: uncharacterized protein LOC103432586 isoform X1 [Malus 
domestica]
Length=161

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            A  A+ILP VD DLKK+AARV E+AKE CASKSV D + E+MEGDARNVLCE  E+HHAS
Sbjct  60   AAGAEILPIVDXDLKKMAARVTEKAKEFCASKSVTDVVVEVMEGDARNVLCEAAERHHAS  119

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            ILVVGSHGYGAIKRA LGSVSDYCAH AHCTVMIVKKPK K
Sbjct  120  ILVVGSHGYGAIKRAFLGSVSDYCAHQAHCTVMIVKKPKTK  160



>ref|XP_011008059.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=161

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A++LP V+SDLKK A RVI +AKEIC SKSV D +FE++EGD RNVLCE VEKHHAS+
Sbjct  62   GIAEVLPIVESDLKKTAVRVIGKAKEICISKSVSDVIFEVVEGDPRNVLCEAVEKHHASV  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK+PK
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPK  159



>ref|XP_008800823.1| PREDICTED: universal stress protein A-like protein [Phoenix dactylifera]
Length=167

 Score =   164 bits (416),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 2/105 (2%)
 Frame = +3

Query  189  NLAG--AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK  362
             LAG  AAD+LP ++SDLK+IAARV+E+AKE+C + SV D  +E++EGD RNVLCETVEK
Sbjct  62   GLAGPAAADVLPFLESDLKRIAARVMEKAKELCTANSVADIEYEVVEGDPRNVLCETVEK  121

Query  363  HHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            HHA +LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  122  HHADMLVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKPK  166



>gb|ACF74293.1| universal stress protein [Arachis hypogaea]
Length=181

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 92/101 (91%), Gaps = 0/101 (0%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            AGAA++LP VDSDLKKIAARV++ AK+IC+ +SV D + E++EGD RNVLC+ VEK+HAS
Sbjct  65   AGAAEVLPIVDSDLKKIAARVVDNAKQICSKRSVTDVITEVVEGDPRNVLCDAVEKYHAS  124

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            ILVVGSHGYGAIKRAVLG+VSDYCAHHAHCTVMIVK+PK K
Sbjct  125  ILVVGSHGYGAIKRAVLGNVSDYCAHHAHCTVMIVKRPKTK  165



>ref|XP_009799461.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=160

 Score =   164 bits (415),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ +ILP +++DLKKIAARV+E+AKEIC +KSV+D + E  EGDARNVLC+ VEKHHASI
Sbjct  60   GSVEILPSIETDLKKIAARVVEKAKEICTAKSVNDVIVEAEEGDARNVLCDAVEKHHASI  119

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LVVGSHGYG ++R VLGSVSDYCAHHAHC+VMIVKKPKHK+
Sbjct  120  LVVGSHGYGVLRRTVLGSVSDYCAHHAHCSVMIVKKPKHKS  160



>ref|XP_008369004.1| PREDICTED: uncharacterized protein LOC103432586 isoform X2 [Malus 
domestica]
Length=160

 Score =   163 bits (413),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  192  LAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA  371
            +   A+ILP VD DLKK+AARV E+AKE CASKSV D + E+MEGDARNVLCE  E+HHA
Sbjct  58   VGAGAEILPIVDXDLKKMAARVTEKAKEFCASKSVTDVVVEVMEGDARNVLCEAAERHHA  117

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            SILVVGSHGYGAIKRA LGSVSDYCAH AHCTVMIVKKPK K
Sbjct  118  SILVVGSHGYGAIKRAFLGSVSDYCAHQAHCTVMIVKKPKTK  159



>gb|AGV40783.1| universal stress protein [Salicornia brachiata]
Length=161

 Score =   163 bits (413),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G +++LP VD+DLKKI+ARVIE+AKE+C SKSV D   EI+EGDARNVLCE VE HHAS+
Sbjct  61   GGSEVLPFVDTDLKKISARVIEKAKEMCHSKSVPDVSAEIVEGDARNVLCEAVESHHASM  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKIK  160



>ref|XP_002265489.2| PREDICTED: uncharacterized protein LOC100260568 [Vitis vinifera]
Length=332

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+V++DLKKIA RV+ +A EICASKSV D + E++EGDARNV+CE VEKHHASI
Sbjct  61   GAADVLPYVEADLKKIAGRVVGKAHEICASKSVTDVILEVVEGDARNVMCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIK  160


 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA D+LP+V++DLKK A RV+E+A+EIC+SKSV D   E++EGDARNV+CE VEKHHASI
Sbjct  232  GAIDVLPYVEADLKKTADRVVEKAREICSSKSVTDVTVEVVEGDARNVMCEAVEKHHASI  291

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  292  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTK  331



>ref|XP_009405430.1| PREDICTED: uncharacterized protein LOC103988576 [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   163 bits (413),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP V+SDL+KI+++VIE+AK+ICA+ SV D  +E++EGDARNVLCE V+KHHA +
Sbjct  72   GAADVLPFVESDLRKISSQVIEKAKDICAAHSVLDVEYEVVEGDARNVLCEAVDKHHAEM  131

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  132  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKPK  171



>ref|XP_002301521.2| LlDD2A18 family protein [Populus trichocarpa]
 gb|EEE80794.2| LlDD2A18 family protein [Populus trichocarpa]
Length=163

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A++LP V SDLKKIAAR IE+AKEIC SKSV D +FE++EGD RNVLCE VEKHHAS+
Sbjct  64   GIAEVLPQVKSDLKKIAARDIEKAKEICISKSVSDVIFEVVEGDPRNVLCEAVEKHHASV  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LVVGSHGYGAIKRAVLGSVSDYC H+A CTVMIVK+PK
Sbjct  124  LVVGSHGYGAIKRAVLGSVSDYCVHNARCTVMIVKRPK  161



>gb|AAR07598.1| fiber protein Fb19, partial [Gossypium barbadense]
Length=151

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+VD+DL+KIAARV+E+AKE+C SKSV D + E+ EGDA NVLC+ VEKHHASI
Sbjct  51   GAADVLPYVDADLRKIAARVVEKAKELCLSKSVHDAVVEVGEGDASNVLCDAVEKHHASI  110

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            L VGSHGYGAIKRAVLGSVSDYC+HHAHC+VMIVK+PK K
Sbjct  111  LAVGSHGYGAIKRAVLGSVSDYCSHHAHCSVMIVKRPKIK  150



>ref|XP_004495963.1| PREDICTED: universal stress protein A-like protein-like isoform 
X2 [Cicer arietinum]
Length=167

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+ILP VDSDL+KIAARV + AK++C  KSV+D + E++EGDARNV+C+TVEK+ ASI
Sbjct  67   GAAEILPIVDSDLRKIAARVADAAKQLCIKKSVNDVIVEVVEGDARNVICDTVEKYRASI  126

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  127  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTK  166



>ref|XP_004495962.1| PREDICTED: universal stress protein A-like protein-like isoform 
X1 [Cicer arietinum]
Length=170

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+ILP VDSDL+KIAARV + AK++C  KSV+D + E++EGDARNV+C+TVEK+ ASI
Sbjct  70   GAAEILPIVDSDLRKIAARVADAAKQLCIKKSVNDVIVEVVEGDARNVICDTVEKYRASI  129

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  130  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTK  169



>ref|XP_010110918.1| Universal stress protein A-like protein [Morus notabilis]
 gb|EXC58825.1| Universal stress protein A-like protein [Morus notabilis]
Length=161

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP VD+DL++IAARV+E+AKEICA KSV+  + E++EGDARNVLCE V+KHHAS 
Sbjct  61   GAAEVLPFVDTDLRRIAARVVEKAKEICARKSVNVFLAEVVEGDARNVLCEAVDKHHASA  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKRPKIK  160



>ref|NP_001066983.1| Os12g0552500 [Oryza sativa Japonica Group]
 gb|ABA99526.1| fiber protein Fb19, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30002.1| Os12g0552500 [Oryza sativa Japonica Group]
 dbj|BAG89978.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53394.1| hypothetical protein OsJ_36443 [Oryza sativa Japonica Group]
Length=169

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 90/100 (90%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP V++DLKK + RVIE+A+E+CA   V D +FE++EGDARNVLCE+VE+H A +
Sbjct  71   GAADVLPFVEADLKKSSMRVIEKARELCAQ--VSDALFEVLEGDARNVLCESVERHQAEM  128

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYC+HHAHCTVMIVKKPKHK
Sbjct  129  LVVGSHGYGAIKRAVLGSVSDYCSHHAHCTVMIVKKPKHK  168



>gb|ADB54814.1| universal stress protein 9303 [Hordeum vulgare subsp. vulgare]
 gb|ADB54815.1| universal stress protein 9303 [Hordeum vulgare subsp. vulgare]
Length=170

 Score =   162 bits (409),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP V++DLK+ + RVI++AKE+CA   V D +FE++EGDARNVLCE VE++HA +
Sbjct  70   GAADVLPFVEADLKRSSLRVIDKAKELCAQAQVGDGVFEVVEGDARNVLCEAVERNHAEM  129

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVG+HGYGAIKRAVLGSVSDYC HHAHCTVMIVKKPKHK
Sbjct  130  LVVGNHGYGAIKRAVLGSVSDYCTHHAHCTVMIVKKPKHK  169



>ref|XP_010931649.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=165

 Score =   161 bits (408),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  D+LP+V+SDLK+IAARVIE+AKE+C + SV D  +E++EGD+RNVLCE VEKHHA +
Sbjct  65   GGVDVLPYVESDLKRIAARVIEKAKELCTANSVADVEYEVVEGDSRNVLCEAVEKHHADM  124

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKR VLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  125  LVVGSHGYGAIKRTVLGSVSDYCAHHAHCSVMIVKKPKPK  164



>ref|XP_010921685.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=174

 Score =   161 bits (408),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP VD+DL+K AAR++E+A+E+C +KSV   + E++EGDARNVLCE VEKHHA +
Sbjct  74   GAADVLPFVDADLRKSAARIVEKAREVCVAKSVST-LVEVVEGDARNVLCEAVEKHHADM  132

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  133  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKSK  172



>ref|XP_009797826.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=164

 Score =   161 bits (407),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G AD+LP+V++DL+KI++RV E+AK+IC++KSV+D + E+MEGDARNVLC+ VEKHHAS+
Sbjct  64   GGADVLPYVEADLRKISSRVAEKAKQICSAKSVNDVVVEVMEGDARNVLCDAVEKHHASM  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYG +KR VLGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  124  LVVGSHGYGVLKRTVLGSVSDYCAHHAHCSVMIVKRPKVK  163



>gb|AEZ00873.1| putative universal stress protein [Elaeis guineensis]
Length=155

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP VD+DL+K AAR++E+A+E+C +KSV   + E++EGDARNVLCE VEKHHA +
Sbjct  55   GAADVLPFVDADLRKSAARIVEKAREVCVAKSVST-LVEVVEGDARNVLCEAVEKHHADM  113

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  114  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKSK  153



>gb|EYU46674.1| hypothetical protein MIMGU_mgv1a015298mg [Erythranthe guttata]
Length=162

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +3

Query  192  LAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA  371
            +AGAA+++P+VD DLK IAARV+++AKEIC +  V++ +FE +EGD RNVLCE VEKHHA
Sbjct  59   VAGAAEVIPYVDRDLKIIAARVLDKAKEICTATEVNNVLFEAVEGDPRNVLCEAVEKHHA  118

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            S+LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKP
Sbjct  119  SVLVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKP  157



>ref|XP_006588416.1| PREDICTED: uncharacterized protein LOC100527357 isoform X1 [Glycine 
max]
Length=164

 Score =   160 bits (406),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            AGAA+ILP VDSDL+KIAARV+E AK++C +KSV+D   E++EGD RNVLC+ V+K+ A+
Sbjct  63   AGAAEILPIVDSDLRKIAARVLETAKQLCFNKSVNDVTAEVVEGDPRNVLCDAVDKYRAA  122

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  123  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIK  163



>ref|XP_006664626.1| PREDICTED: uncharacterized protein LOC102702434 [Oryza brachyantha]
Length=176

 Score =   161 bits (407),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP V++DLKK + RVIE+AKE+CA   V D +FE++EGDARNVLCE VE+H A +
Sbjct  78   GAADVLPFVEADLKKSSMRVIEKAKELCAQ--VTDALFEVVEGDARNVLCEAVERHQAEM  135

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYC+HHAHCTVMIVKKPKHK
Sbjct  136  LVVGSHGYGAIKRAVLGSVSDYCSHHAHCTVMIVKKPKHK  175



>gb|AFK41746.1| unknown [Lotus japonicus]
Length=165

 Score =   160 bits (406),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            AGAA++LP VDSDLKKIAARV+E AK+IC   ++ D + E +EGD RNVLCE VEK+HAS
Sbjct  64   AGAAEVLPIVDSDLKKIAARVLENAKQICIKNNITDVVVEAVEGDPRNVLCEAVEKYHAS  123

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            +LVVGSHGYGA+KRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  124  VLVVGSHGYGALKRAVLGSVSDYCAHHAHCSVMIVKKPKTK  164



>ref|XP_007201282.1| hypothetical protein PRUPE_ppa012608mg [Prunus persica]
 gb|EMJ02481.1| hypothetical protein PRUPE_ppa012608mg [Prunus persica]
Length=162

 Score =   160 bits (406),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP VD+DLK++AARV ++AK++CA+KSV D   E++EGDARNVLC+ V++HHAS+
Sbjct  62   GAAEVLPIVDADLKRMAARVADKAKQLCATKSVTDVTVELVEGDARNVLCDAVDRHHASV  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKTK  161



>ref|XP_008235225.1| PREDICTED: uncharacterized protein LOC103334077 [Prunus mume]
Length=162

 Score =   160 bits (405),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP VD+DLK++AARV ++AK++CA+KSV D   E++EGDARNVLC+ VE+H AS+
Sbjct  62   GAAEVLPIVDADLKRMAARVADKAKQLCATKSVTDVTVELVEGDARNVLCDAVERHQASV  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKTK  161



>ref|XP_004494374.1| PREDICTED: universal stress protein MJ0531-like [Cicer arietinum]
Length=158

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+ILP VD+DLK+ A  VIE+AKEIC + SV D + E++EGDARNVLC+ VEKHHASI
Sbjct  58   GAAEILPIVDADLKRSAINVIEQAKEICTNNSVKDIVEEVVEGDARNVLCDAVEKHHASI  117

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGA+KRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  118  LVVGSHGYGALKRAVLGSVSDYCAHHAHCTVMIVKKPKTK  157



>ref|XP_008801104.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Phoenix dactylifera]
Length=207

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP VD+DL+K AAR++E+A+E C +KSV   +FE++EGDARNVLCE VEKHHA +
Sbjct  107  GAADVLPFVDADLRKSAARIVEKARENCVAKSVSA-LFEVVEGDARNVLCEAVEKHHADM  165

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVG+HGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  166  LVVGNHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKSK  205



>ref|NP_001236718.1| uncharacterized protein LOC100306046 [Glycine max]
 gb|ACU14034.1| unknown [Glycine max]
Length=163

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP V++DL+K AA++ ERA E+C  KSV+D   E++EGD RNVLCE VEKH AS+
Sbjct  63   GAAEVLPVVEADLRKTAAKITERATELCKKKSVNDVAVEVLEGDPRNVLCEAVEKHQASM  122

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYG +KRAVLGSVSDYCAHHAHCTVMIVKKPKHK
Sbjct  123  LVVGSHGYGTLKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  162



>gb|KHN43511.1| Universal stress protein A-like protein [Glycine soja]
Length=152

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP V++DL+K AA++ ERA E+C  KSV+D   E++EGD RNVLCE VEKH AS+
Sbjct  52   GAAEVLPVVEADLRKTAAKITERATELCKKKSVNDVAVEVLEGDPRNVLCEAVEKHQASM  111

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYG +KRAVLGSVSDYCAHHAHCTVMIVKKPKHK
Sbjct  112  LVVGSHGYGTLKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  151



>gb|KFK37511.1| hypothetical protein AALP_AA4G266700 [Arabis alpina]
Length=162

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P+VD+DLK  AARV+E+AK IC SKSV D   E+ EGDARN+LCE V+KHHAS+
Sbjct  62   GTAEVVPYVDADLKHTAARVVEKAKAICQSKSVHDTTIEVFEGDARNILCEVVDKHHASV  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYC+HHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCSHHAHCSVMIVKKPKIK  161



>ref|XP_002301477.2| hypothetical protein POPTR_0002s20670g [Populus trichocarpa]
 gb|EEE80750.2| hypothetical protein POPTR_0002s20670g [Populus trichocarpa]
Length=221

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A++LP V+SDLKK AARVI +AKEIC SKSV   +FE++EGD RNVLCE VEKHHAS+
Sbjct  122  GIAEVLPIVESDLKKSAARVIGKAKEICISKSVSGVIFEVVEGDPRNVLCEAVEKHHASV  181

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LVVGSHGYGAIKRAVLGSVSDYCAH AHCTVMIVK+PK
Sbjct  182  LVVGSHGYGAIKRAVLGSVSDYCAHQAHCTVMIVKRPK  219



>ref|NP_001238718.1| uncharacterized protein LOC100527357 [Glycine max]
 gb|ACU16442.1| unknown [Glycine max]
 gb|KHN03724.1| Universal stress protein A-like protein [Glycine soja]
Length=160

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+ILP VDSDL+KIAARV+E AK++C +KSV+D   E++EGD RNVLC+ V+K+ A+I
Sbjct  60   GAAEILPIVDSDLRKIAARVLETAKQLCFNKSVNDVTAEVVEGDPRNVLCDAVDKYRAAI  119

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  120  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIK  159



>gb|EYU46675.1| hypothetical protein MIMGU_mgv1a015298mg [Erythranthe guttata]
Length=159

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+++P+VD DLK IAARV+++AKEIC +  V++ +FE +EGD RNVLCE VEKHHAS+
Sbjct  58   GAAEVIPYVDRDLKIIAARVLDKAKEICTATEVNNVLFEAVEGDPRNVLCEAVEKHHASV  117

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKP
Sbjct  118  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKP  154



>ref|XP_003575575.1| PREDICTED: uncharacterized protein LOC100829422 [Brachypodium 
distachyon]
Length=178

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP V++DLK+ A RVI++AKE+CA   V   +FE+MEGDARNVLCE VE+HHA +
Sbjct  80   GAADVLPFVEADLKRSAMRVIDKAKELCAQ--VSHAVFEVMEGDARNVLCEAVERHHAEM  137

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVG+HGYGAIKRAVLGSVSDYC+HHAHCTVMIVKKPKHK
Sbjct  138  LVVGNHGYGAIKRAVLGSVSDYCSHHAHCTVMIVKKPKHK  177



>ref|XP_009596691.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=164

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G AD+LP+V++DL+KI++RV E+AK+IC++KS +D + E+MEGDARNVLC+ VEKHHAS+
Sbjct  64   GGADVLPYVEADLRKISSRVAEKAKQICSAKSANDVVVEVMEGDARNVLCDAVEKHHASM  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYG +KR VLGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  124  LVVGSHGYGVLKRTVLGSVSDYCAHHAHCSVMIVKRPKVK  163



>ref|XP_006397968.1| hypothetical protein EUTSA_v10001666mg [Eutrema salsugineum]
 dbj|BAJ33672.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ39421.1| hypothetical protein EUTSA_v10001666mg [Eutrema salsugineum]
Length=162

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P+VD+DLK  AARV+E++K IC SKSV   M E+ EGDARN+LCE V+KHHAS+
Sbjct  62   GTAEVVPYVDADLKHTAARVVEKSKAICQSKSVHGVMIEVFEGDARNILCEVVDKHHASL  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVLGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKTK  161



>ref|NP_001240086.1| uncharacterized protein LOC100816212 [Glycine max]
 gb|ACU16200.1| unknown [Glycine max]
Length=162

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = +3

Query  192  LAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA  371
             AGAA++LP VDSDL+KI ARV+E AK++C +KSV+D   E++EGD RNVLC+ V+K+ A
Sbjct  60   FAGAAEVLPIVDSDLRKIGARVLETAKQLCINKSVNDVTAEVVEGDPRNVLCDAVDKYRA  119

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            ++LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  120  AMLVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIK  161



>ref|XP_004962797.1| PREDICTED: uncharacterized protein LOC101782520 isoform X2 [Setaria 
italica]
Length=169

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 87/100 (87%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP V++DLK+ A RVIE+AKE+CA   V D  +E MEGDARNVLC+ VE+HHA +
Sbjct  71   GAADVLPFVEADLKRTALRVIEKAKELCAQ--VADAEYEAMEGDARNVLCDAVERHHAEM  128

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  129  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKPK  168



>ref|XP_007163107.1| hypothetical protein PHAVU_001G206900g [Phaseolus vulgaris]
 gb|ESW35101.1| hypothetical protein PHAVU_001G206900g [Phaseolus vulgaris]
Length=162

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+++P V++DLK+ AA+V E AK++C  KSV D   E++EGD RNVLCE VEKHHAS+
Sbjct  62   GAAEVMPIVEADLKRTAAKVTEYAKDLCQKKSVKDVSVEVVEGDPRNVLCEAVEKHHASM  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK+K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKNK  161



>ref|XP_009346602.1| PREDICTED: uncharacterized protein LOC103938325 [Pyrus x bretschneideri]
Length=164

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A++LP +++DL+KIA RV+E+AK+ICASK V+D + E++ GDARNVLCE VEKH ASI
Sbjct  64   GGAEVLPILEADLQKIAMRVVEKAKKICASKQVNDVVVELVAGDARNVLCEAVEKHKASI  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LV GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK+PK K 
Sbjct  124  LVSGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPKIKN  164



>emb|CDX95730.1| BnaC03g26110D [Brassica napus]
Length=162

 Score =   157 bits (396),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P+VD+DLK  A +VIE+AK +C SKSV   M E+ EGDARN+LCE V+KHHAS+
Sbjct  62   GTAEVVPYVDADLKHTAVKVIEKAKALCLSKSVHGAMMEVFEGDARNILCEVVDKHHASL  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKIK  161



>ref|XP_009133823.1| PREDICTED: universal stress protein A-like protein [Brassica 
rapa]
 emb|CDX83322.1| BnaA03g21840D [Brassica napus]
Length=162

 Score =   156 bits (395),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P+VD+DLK  A +VIE+AK +C SKSV   M E+ EGDARN+LCE V+KHHAS+
Sbjct  62   GTAEVVPYVDADLKHTAVKVIEKAKALCLSKSVHGAMIEVFEGDARNILCEVVDKHHASL  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKIK  161



>ref|XP_010269547.1| PREDICTED: uncharacterized protein LOC104606168 isoform X1 [Nelumbo 
nucifera]
Length=164

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +3

Query  189  NLAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH  368
             +AGAA++LP V+SDLKK+AARV E+AKEIC SKSV+  + E++EGDARNV+CE VEKHH
Sbjct  61   GIAGAAEVLPFVESDLKKMAARVAEKAKEICCSKSVEHVVVEVVEGDARNVICEAVEKHH  120

Query  369  ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            AS LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  121  ASTLVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIK  163



>gb|KCW50026.1| hypothetical protein EUGRSUZ_K03472 [Eucalyptus grandis]
Length=174

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  174  VLEP*NLAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCET  353
            V+E  ++ G  ++LP +D+DLKK+AA V ++AK+IC S+SV D  F++MEGDARNVLC+ 
Sbjct  66   VIELGDITGVIEVLPIIDADLKKVAAWVTQKAKDICNSRSVHDVTFQVMEGDARNVLCDA  125

Query  354  VEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            VEKHHAS+LVVGS G+GAIKRAVLGSVSDYC+HHAHCTVMIVK+PK
Sbjct  126  VEKHHASVLVVGSRGHGAIKRAVLGSVSDYCSHHAHCTVMIVKRPK  171



>ref|XP_010523934.1| PREDICTED: uncharacterized protein LOC104802162 isoform X1 [Tarenaya 
hassleriana]
Length=164

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+V++DLK IAA VI+RAK+IC SKSV D  FE++EGD R V+C+ V+KH AS+
Sbjct  64   GAAEVLPYVETDLKMIAAGVIQRAKQICLSKSVTDAKFEVVEGDPRLVMCDAVDKHVASV  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYC+HHAHCTVMIVKKPK K
Sbjct  124  LVVGSHGYGAIKRAVLGSVSDYCSHHAHCTVMIVKKPKTK  163



>ref|XP_006574464.1| PREDICTED: uncharacterized protein LOC100816212 isoform X1 [Glycine 
max]
 gb|ACU20991.1| unknown [Glycine max]
 gb|KHN46570.1| Universal stress protein A-like protein [Glycine soja]
Length=159

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP VDSDL+KI ARV+E AK++C +KSV+D   E++EGD RNVLC+ V+K+ A++
Sbjct  59   GAAEVLPIVDSDLRKIGARVLETAKQLCINKSVNDVTAEVVEGDPRNVLCDAVDKYRAAM  118

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  119  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIK  158



>ref|XP_002882129.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58388.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=162

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P+VD+DLK  AA+V+E+AK IC SKSV   + E+ EGDARN+LCE V+KHHASI
Sbjct  62   GTAEVVPYVDADLKHTAAKVVEKAKAICQSKSVHGAVIEVFEGDARNILCEVVDKHHASI  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGS SDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSTSDYCAHHAHCSVMIVKKPKIK  161



>ref|XP_002443334.1| hypothetical protein SORBIDRAFT_08g017660 [Sorghum bicolor]
 gb|EES17172.1| hypothetical protein SORBIDRAFT_08g017660 [Sorghum bicolor]
Length=176

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 88/99 (89%), Gaps = 2/99 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+V++DLKK A RVI++AK +CA   V D +FE +EGDAR+VLCE VE+HHA +
Sbjct  77   GAADVLPYVEADLKKTALRVIDKAKALCAQ--VSDAVFEAVEGDARSVLCEAVERHHAEM  134

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH
Sbjct  135  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  173



>ref|XP_008386701.1| PREDICTED: uncharacterized protein LOC103449189 [Malus domestica]
Length=164

 Score =   155 bits (393),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A +LP +++DL+KIA RV+E+AK+ICASK V+D + E++ GDARNVLCE VEKH ASI
Sbjct  64   GGAKVLPILEADLQKIAMRVVEKAKKICASKQVNDVVVELVAGDARNVLCEAVEKHKASI  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LV GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK+PK
Sbjct  124  LVSGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKRPK  161



>ref|XP_006295139.1| hypothetical protein CARUB_v10024211mg [Capsella rubella]
 gb|EOA28037.1| hypothetical protein CARUB_v10024211mg [Capsella rubella]
Length=162

 Score =   155 bits (393),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P+VD+DLK  AA+V+E+AK IC +KSV   + E+ EGDARN+LCE V+KHHASI
Sbjct  62   GTAEVVPYVDADLKHTAAKVVEKAKSICQTKSVHGAVIEVFEGDARNILCEVVDKHHASI  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGS SDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSTSDYCAHHAHCSVMIVKKPKIK  161



>ref|NP_566108.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
 gb|AAC63627.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96811.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10097.1| unknown protein [Arabidopsis thaliana]
 gb|AEC10879.1| adenine nucleotide alpha hydrolases-like protein [Arabidopsis 
thaliana]
Length=162

 Score =   155 bits (392),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P+VD+DLK  AA+V+E+AK IC S+SV   + E+ EGDARN+LCE V+KHHASI
Sbjct  62   GTAEVVPYVDADLKHTAAKVVEKAKAICQSRSVHGAVIEVFEGDARNILCEVVDKHHASI  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGS SDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSTSDYCAHHAHCSVMIVKKPKIK  161



>ref|XP_006352812.1| PREDICTED: uncharacterized protein LOC102580875 [Solanum tuberosum]
Length=157

 Score =   155 bits (391),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G AD+LP+V++DL+KI++R+ E+AK+IC++KSV+D + EI+EGDAR+VLC+ VEKHHAS+
Sbjct  57   GGADVLPYVEADLRKISSRIAEKAKKICSAKSVNDVVVEIVEGDARSVLCDAVEKHHASM  116

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYG +KR VLGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  117  LVVGSHGYGVLKRTVLGSVSDYCAHHAHCSVMIVKRPKIK  156



>ref|XP_010507861.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=163

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P+VD+DLK  AA+V+++AK IC SKSV   + E+ EGDARN+LCE V+KHHASI
Sbjct  63   GTAEVVPYVDADLKHTAAKVVDKAKSICQSKSVHGAVIEVFEGDARNILCEVVDKHHASI  122

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGS SDYCAHHAHC+VMIVKKPK K
Sbjct  123  LVVGSHGYGAIKRAVLGSTSDYCAHHAHCSVMIVKKPKIK  162



>ref|XP_004242313.1| PREDICTED: uncharacterized protein LOC101246641 [Solanum lycopersicum]
Length=157

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G AD+LP+V++DL+KI++R+ E+AK+IC++KSV+D + EI EGDAR+VLC+ VEKHHAS+
Sbjct  57   GGADVLPYVEADLRKISSRIAEKAKKICSAKSVNDVVVEIAEGDARSVLCDAVEKHHASM  116

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYG +KRAVLGSVSDYCAHH HC+VMIVK+PK K
Sbjct  117  LVVGSHGYGVLKRAVLGSVSDYCAHHTHCSVMIVKRPKIK  156



>gb|AFW56490.1| hypothetical protein ZEAMMB73_742470 [Zea mays]
Length=173

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+V++DLK+ A RV+E+AK +C      D +FE +EGDARNVLCE VE+H A +
Sbjct  72   GAADVLPYVEADLKRSALRVVEKAKGLCTQVRASDAVFEALEGDARNVLCEAVERHGAEM  131

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 
Sbjct  132  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKQ  170



>emb|CBI36845.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA D+LP+V++DLKK A RV+E+A+EIC+SKSV D   E++EGDARNV+CE VEKHHASI
Sbjct  82   GAIDVLPYVEADLKKTADRVVEKAREICSSKSVTDVTVEVVEGDARNVMCEAVEKHHASI  141

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  142  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKTK  181



>ref|XP_010518486.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=162

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P+VD+DLK  AA+V+++AK IC SKSV   + E+ EGDARN+LCE V+KHHASI
Sbjct  62   GTAEVVPYVDADLKHTAAKVVDKAKSICQSKSVHGVVIEVFEGDARNILCEVVDKHHASI  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGS SDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIKRAVLGSTSDYCAHHAHCSVMIVKKPKIK  161



>ref|XP_002271563.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera]
 emb|CBI26047.3| unnamed protein product [Vitis vinifera]
Length=158

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  DI+ HVDSDLKK AAR++++AK++C SKSV+D    +MEGDAR+++C+ V  HHASI
Sbjct  60   GLPDIIAHVDSDLKKAAARIVDKAKQMCNSKSVEDVTVSVMEGDARSIICDAVNIHHASI  119

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            LVVGSHGYGA+KRAVLGSVSDYCAHHAHCTVMIVKKPK+
Sbjct  120  LVVGSHGYGALKRAVLGSVSDYCAHHAHCTVMIVKKPKY  158



>ref|XP_010269548.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nelumbo nucifera]
Length=161

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP V+SDLKK+AARV E+AKEIC SKSV+  + E++EGDARNV+CE VEKHHAS 
Sbjct  61   GAAEVLPFVESDLKKMAARVAEKAKEICCSKSVEHVVVEVVEGDARNVICEAVEKHHAST  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKIK  160



>gb|EPS66020.1| hypothetical protein M569_08758, partial [Genlisea aurea]
Length=156

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = +3

Query  183  P*NLAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK  362
            P   AG A++LP V+ DLK+IAA+V+E+AKEIC +KSV D  +E +EGDARNVLCE VE 
Sbjct  55   PGPFAGTAEVLPIVERDLKRIAAKVLEKAKEICEAKSVTDVAYEAVEGDARNVLCEEVEN  114

Query  363  HHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            HHASILVVGSHGYGAI+RAVLGSVSDY AHHAHC+V+IVK P
Sbjct  115  HHASILVVGSHGYGAIRRAVLGSVSDYLAHHAHCSVLIVKTP  156



>ref|NP_001288970.1| universal stress protein A-like protein [Brassica rapa]
 gb|ABV89633.1| universal stress protein family protein [Brassica rapa]
 emb|CDY55534.1| BnaA04g29570D [Brassica napus]
Length=162

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  +++PHVD+DLK  AA+V+E+AK IC SKSV D   E+ EGDARN+LCE V+KHHAS+
Sbjct  62   GIVEVVPHVDADLKHTAAKVVEKAKGICESKSVHDATMEVFEGDARNILCEVVDKHHASL  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHG+GAIKRAV+GSVSDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGHGAIKRAVIGSVSDYCAHHAHCSVMIVKKPKIK  161



>ref|XP_010038209.1| PREDICTED: uncharacterized protein LOC104426758 [Eucalyptus grandis]
Length=166

 Score =   154 bits (388),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  ++LP +D+DLKK+AA V ++AK+IC S+SV D  F++MEGDARNVLC+ VEKHHAS+
Sbjct  66   GVIEVLPIIDADLKKVAAWVTQKAKDICNSRSVHDVTFQVMEGDARNVLCDAVEKHHASV  125

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LVVGS G+GAIKRAVLGSVSDYC+HHAHCTVMIVK+PK
Sbjct  126  LVVGSRGHGAIKRAVLGSVSDYCSHHAHCTVMIVKRPK  163



>ref|XP_006840564.1| hypothetical protein AMTR_s00045p00225160 [Amborella trichopoda]
 gb|ERN02239.1| hypothetical protein AMTR_s00045p00225160 [Amborella trichopoda]
Length=163

 Score =   153 bits (386),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA ++LP V++ LKK A R+++RA +IC +KSV+D   E++EGDARNVLCE VEKH A++
Sbjct  63   GAIEVLPLVEAGLKKSAERIVQRASDICKAKSVNDFTTEVVEGDARNVLCEAVEKHQATM  122

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            L VGSHGYGAIKRAVLGSVSDYC+HHAHCTVMIVKKPKHK
Sbjct  123  LAVGSHGYGAIKRAVLGSVSDYCSHHAHCTVMIVKKPKHK  162



>gb|AAM63890.1| unknown [Arabidopsis thaliana]
Length=162

 Score =   153 bits (386),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A+++P+VD+DLK  AA+V+E+AK IC S+SV   + E+ EGDARN+LCE V+KHHASI
Sbjct  62   GTAEVVPYVDADLKHTAAKVVEKAKAICQSRSVHRAVIEVFEGDARNILCEVVDKHHASI  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAI RAVLGS SDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVVGSHGYGAIXRAVLGSTSDYCAHHAHCSVMIVKKPKIK  161



>ref|XP_009346604.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=161

 Score =   153 bits (386),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+ILP V++DLKK AA V E+AKE CASKSV D + E++EGDARNVLC+ VE+HHASI
Sbjct  61   GAAEILPIVEADLKKSAAHVTEKAKEFCASKSVTDVVVEVVEGDARNVLCDAVERHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            L+VGSHGYGAIKRAVLGSVSDYCAHHAH TVMIVKKPK K
Sbjct  121  LIVGSHGYGAIKRAVLGSVSDYCAHHAHSTVMIVKKPKTK  160



>ref|XP_008789877.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Phoenix dactylifera]
Length=169

 Score =   153 bits (386),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA D+LP VD+DL+K AARV+E+A+E+C +KS+  P+ E++EGDAR VLCE VEKHHA +
Sbjct  70   GAVDVLPFVDADLRKSAARVVEKAREVCEAKSLS-PLVEVVEGDARYVLCEAVEKHHADM  128

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGAIKRAVLGSVSDYC HHA CTVMIVKKPK K
Sbjct  129  LVLGSHGYGAIKRAVLGSVSDYCTHHAPCTVMIVKKPKSK  168



>gb|AFW56491.1| hypothetical protein ZEAMMB73_742470, partial [Zea mays]
Length=116

 Score =   151 bits (381),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +3

Query  192  LAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA  371
              GAAD+LP+V++DLK+ A RV+E+AK +C   S  D +FE +EGDARNVLCE VE+H A
Sbjct  15   FPGAADVLPYVEADLKRSALRVVEKAKGLCTQAS--DAVFEALEGDARNVLCEAVERHGA  72

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
             +LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK
Sbjct  73   EMLVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  112



>ref|NP_001150162.1| fiber protein Fb19 [Zea mays]
 gb|ACG38096.1| fiber protein Fb19 [Zea mays]
 gb|AFW56488.1| fiber protein Fb19 [Zea mays]
Length=171

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+V++DLK+ A RV+E+AK +C   S  D +FE +EGDARNVLCE VE+H A +
Sbjct  72   GAADVLPYVEADLKRSALRVVEKAKGLCTQAS--DAVFEALEGDARNVLCEAVERHGAEM  129

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 
Sbjct  130  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKQ  168



>gb|ACF84743.1| unknown [Zea mays]
Length=153

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 2/99 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+V++DLK+ A RV+E+AK +C   S  D +FE +EGDARNVLCE VE+H A +
Sbjct  54   GAADVLPYVEADLKRSALRVVEKAKGLCTQAS--DAVFEALEGDARNVLCEAVERHGAEM  111

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 
Sbjct  112  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKQ  150



>ref|XP_010523936.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Tarenaya hassleriana]
Length=161

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 89/102 (87%), Gaps = 1/102 (1%)
 Frame = +3

Query  192  LAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA  371
            LAG  ++LP+V++DLK IAA VI+RAK+IC SKSV D  FE++EGD R V+C+ V+KH A
Sbjct  60   LAGP-EVLPYVETDLKMIAAGVIQRAKQICLSKSVTDAKFEVVEGDPRLVMCDAVDKHVA  118

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            S+LVVGSHGYGAIKRAVLGSVSDYC+HHAHCTVMIVKKPK K
Sbjct  119  SVLVVGSHGYGAIKRAVLGSVSDYCSHHAHCTVMIVKKPKTK  160



>ref|XP_009346600.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
 ref|XP_009346601.1| PREDICTED: universal stress protein A-like protein [Pyrus x bretschneideri]
Length=161

 Score =   151 bits (381),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+ILP V++DLKK AA   E+AKE CASKSV D + E++EGDARNVLC+ VE+HHASI
Sbjct  61   GAAEILPIVEADLKKSAAHATEKAKEFCASKSVTDVVVEVVEGDARNVLCDAVERHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            L+VGSHGYGAIKRAVLGSVSDYCAHHAH TVMIVKKPK K
Sbjct  121  LIVGSHGYGAIKRAVLGSVSDYCAHHAHSTVMIVKKPKTK  160



>ref|XP_010938498.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=225

 Score =   152 bits (384),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 87/100 (87%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA D+LP V++DL+K AA V+E+A+E+C +KSV  P+ E++EGDAR VLCE VEKHHA +
Sbjct  126  GAVDVLPFVEADLRKSAASVVEKAREVCEAKSVS-PLVEVVEGDARYVLCEAVEKHHADM  184

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGA+KRAVLGSVSDYCAHHA CTVMIVKKP+ K
Sbjct  185  LVVGSHGYGAVKRAVLGSVSDYCAHHAQCTVMIVKKPRSK  224



>ref|NP_001066982.1| Os12g0552400 [Oryza sativa Japonica Group]
 gb|ABA99525.1| fiber protein Fb19, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30001.1| Os12g0552400 [Oryza sativa Japonica Group]
 gb|EAZ20817.1| hypothetical protein OsJ_36442 [Oryza sativa Japonica Group]
 dbj|BAG91797.1| unnamed protein product [Oryza sativa Japonica Group]
Length=160

 Score =   150 bits (378),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 86/101 (85%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  ++LP ++ DLK+ AARVIE+AKE+C+   V D  +E++EGDARN+LCE VE+HHA +
Sbjct  60   GTTELLPTLELDLKRGAARVIEKAKEMCSQ--VIDASYEVLEGDARNILCEAVERHHADM  117

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LVVGSHGYGA KRAVLGSVSDYC+HHAHCTVMIVK+PKH T
Sbjct  118  LVVGSHGYGAWKRAVLGSVSDYCSHHAHCTVMIVKRPKHNT  158



>ref|XP_004956772.1| PREDICTED: uncharacterized protein LOC101762096 isoform X2 [Setaria 
italica]
Length=168

 Score =   149 bits (377),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 85/106 (80%), Gaps = 3/106 (3%)
 Frame = +3

Query  189  NLAGAA---DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE  359
             LAG     D+   V++DLK+ A RV+++AKE+CA   V D  FE +EGDARNVLC+  E
Sbjct  62   GLAGTGALMDVRSFVEADLKRAARRVLDKAKELCAQVQVADVEFEALEGDARNVLCDAAE  121

Query  360  KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            +HHA +LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK
Sbjct  122  RHHAEMLVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  167



>ref|XP_004240539.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=161

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ +    ++S+LKKIAARV+E+AKEIC  KSV+D + EI+EGDAR+VLCE VEK HAS+
Sbjct  61   GSVEAFSAIESNLKKIAARVVEKAKEICKEKSVNDVVVEIVEGDARHVLCEAVEKLHASV  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVG HGYG IKR VLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  121  LVVGCHGYGVIKRTVLGSVSDYCAHHAHCSVMIVKKPKTK  160



>ref|XP_008386702.1| PREDICTED: uncharacterized protein LOC103449190 [Malus domestica]
Length=161

 Score =   148 bits (374),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+ILP V++DLKK AA V E+AKE CASKSV D + E++ GDARNVLC+ VE HHASI
Sbjct  61   GAAEILPIVEADLKKTAAHVTEKAKEFCASKSVTDVVVEVVXGDARNVLCDAVEXHHASI  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRAVLGSVSDYCAHHAH TVMIVKKPK K
Sbjct  121  LVVGSHGYGAIKRAVLGSVSDYCAHHAHSTVMIVKKPKTK  160



>gb|ABK22555.1| unknown [Picea sitchensis]
Length=157

 Score =   147 bits (372),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +3

Query  192  LAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA  371
            +AG AD+LP V+ DLK++  R +E+AK +C ++S+ D   E++EGDARNVLCE VE+H A
Sbjct  57   MAGPADVLPSVELDLKRMGTRALEKAKGLCQNRSLRDFESEMVEGDARNVLCEAVERHGA  116

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
             IL VGSHGYGAIKRAVLGSVSDYCAHHA CTVMI+KKPKH
Sbjct  117  DILAVGSHGYGAIKRAVLGSVSDYCAHHAKCTVMIIKKPKH  157



>ref|XP_006355801.1| PREDICTED: uncharacterized protein LOC102583766 [Solanum tuberosum]
Length=161

 Score =   148 bits (373),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ +    ++S+LKKIAARV+E+A EIC +KSV+D + E++EGDAR+VLCE VEK HAS+
Sbjct  61   GSVEAFSAIESNLKKIAARVVEKAMEICKAKSVNDVVVEMVEGDARHVLCEAVEKLHASV  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LVVG HGYG IKR VLGSVSDYCAHHAHC+VMIVKKPK KT
Sbjct  121  LVVGCHGYGVIKRTVLGSVSDYCAHHAHCSVMIVKKPKTKT  161



>gb|EPS57241.1| hypothetical protein M569_17579 [Genlisea aurea]
Length=155

 Score =   147 bits (371),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A++ P VD++LKK A RV  +AK+IC +KS++D + E++EGDARNVL E VE H+ASI
Sbjct  55   GGAEVFPIVDAELKKKAERVTGKAKQICETKSINDAVIEVVEGDARNVLIEAVENHNASI  114

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LVVGSHGYGAIKRAVLGSVSDY AHHAHC+VMIVKKPK
Sbjct  115  LVVGSHGYGAIKRAVLGSVSDYLAHHAHCSVMIVKKPK  152



>ref|XP_009412097.1| PREDICTED: universal stress protein A-like protein [Musa acuminata 
subsp. malaccensis]
Length=160

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP V+SDLKKIA  VIE+AK++C++  V D  +E++EGD RN LC+  EKH A I
Sbjct  60   GAADVLPFVESDLKKIALLVIEKAKDLCSAFPVGDIQYELVEGDPRNALCDAAEKHQAEI  119

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKR VLGSVSD+CAHHA CTVMIVKKPK K
Sbjct  120  LVVGSHGYGAIKRVVLGSVSDHCAHHAQCTVMIVKKPKPK  159



>gb|KJB38589.1| hypothetical protein B456_006G262000 [Gossypium raimondii]
Length=159

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +3

Query  189  NLAG--AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK  362
             LAG   A+I+P ++ DLKK A R+ E+ KE+C  KSV++   E+MEGD R+VLCE V+K
Sbjct  54   QLAGPATAEIIPMMEIDLKKAAGRITEKVKELCKKKSVNEVNVEVMEGDPRDVLCEAVDK  113

Query  363  HHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            HHA+ILV+GSHGYG +KRAVLGSVSDYCAHHAHC+VMIVKKPK+K
Sbjct  114  HHATILVLGSHGYGIVKRAVLGSVSDYCAHHAHCSVMIVKKPKNK  158



>ref|XP_009782538.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=156

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  D+L  V++D+KK A RV E+AK++C++K V D  F+++EGDARNVLC+ V+KHHAS+
Sbjct  56   GTTDVLMLVETDIKKTAQRVCEKAKQLCSAKGVTDVEFDVVEGDARNVLCDAVDKHHASV  115

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGA KRAVLGSVSDYC+HHA C+VMIVKKPK K
Sbjct  116  LVMGSHGYGAFKRAVLGSVSDYCSHHARCSVMIVKKPKTK  155



>ref|XP_010692533.1| PREDICTED: uncharacterized protein LOC104905637 [Beta vulgaris 
subsp. vulgaris]
Length=162

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA+++  V++DLKK   R+IE+AK++C SK V D   +++EGDARN LCE VEKHHAS+
Sbjct  62   GAAEVVSLVEADLKKATTRLIEKAKDLCHSKLVHDVAVKVVEGDARNALCEAVEKHHASM  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGAIKRAVLGSVSDYCAHHAHC+VMIVKKPK K
Sbjct  122  LVMGSHGYGAIKRAVLGSVSDYCAHHAHCSVMIVKKPKTK  161



>ref|XP_010276435.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Nelumbo nucifera]
Length=160

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  192  LAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA  371
             +G  DILP V++DLKK A+R++++A ++C ++S+ D   E+ EGD RNVLCE VE H A
Sbjct  58   FSGPGDILPQVEADLKKTASRIVDKAHKLCKNRSISDFQVEVCEGDPRNVLCEAVENHRA  117

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
             ILVVGSHGYGAIKRA+LGSVSDYC HH HCTV+IVKKPK
Sbjct  118  DILVVGSHGYGAIKRAILGSVSDYCTHHVHCTVLIVKKPK  157



>ref|XP_010259730.1| PREDICTED: uncharacterized protein LOC104599062 [Nelumbo nucifera]
Length=165

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP V++DLKK + +V  +AKEIC+SKSV+    E +EGD RNVLCE VEK+HA+I
Sbjct  64   GAAEVLPFVEADLKKTSIKVAGKAKEICSSKSVNTTDVESVEGDPRNVLCEAVEKNHAAI  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LV+GSHGYGA+KRAVLGSVSDYCAHHA+C+VMIVKKPK
Sbjct  124  LVMGSHGYGALKRAVLGSVSDYCAHHANCSVMIVKKPK  161



>ref|XP_009598749.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=156

 Score =   146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G +D+L  V++D+KK A RV E+AK++C +K V D  F+++EGDARNVLC+ V+KHHAS+
Sbjct  56   GTSDVLMLVETDIKKTAQRVCEKAKQLCNAKGVTDVEFDVVEGDARNVLCDAVDKHHASV  115

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LV+GSHGYGA KRAVLGSVSDYC+HHA C+VMIVKKPK K 
Sbjct  116  LVMGSHGYGAFKRAVLGSVSDYCSHHARCSVMIVKKPKTKN  156



>emb|CDO98861.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ D+LP V++DLK+ A R+IE+AKE+C  K V+D  FE++EGDAR V+C+ V+KHHAS+
Sbjct  59   GSTDVLPLVEADLKRTAERLIEQAKELCKEKGVEDAEFEVIEGDARMVMCDAVDKHHASL  118

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LV+GSHGYGA+KR VLGSVSD+C+HHAHC+VMIVK+PK
Sbjct  119  LVLGSHGYGALKRVVLGSVSDHCSHHAHCSVMIVKQPK  156



>ref|XP_004956773.1| PREDICTED: uncharacterized protein LOC101762096 isoform X3 [Setaria 
italica]
Length=166

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 85/106 (80%), Gaps = 5/106 (5%)
 Frame = +3

Query  189  NLAGAA---DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE  359
             LAG     D+   V++DLK+ A RV+++AKE+CA   V D  FE +EGDARNVLC+  E
Sbjct  62   GLAGTGALMDVRSFVEADLKRAARRVLDKAKELCAQ--VADVEFEALEGDARNVLCDAAE  119

Query  360  KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            +HHA +LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK
Sbjct  120  RHHAEMLVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  165



>ref|XP_003625924.1| Universal stress protein A-like protein [Medicago truncatula]
 ref|XP_003628477.1| Universal stress protein A-like protein [Medicago truncatula]
 gb|ACJ83833.1| unknown [Medicago truncatula]
 gb|AES82142.1| universal stress family protein [Medicago truncatula]
 gb|AET02953.1| universal stress family protein [Medicago truncatula]
 gb|AFK37049.1| unknown [Medicago truncatula]
Length=162

 Score =   144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            AGAA+ILP V++DLK+ A  VIERA+EIC  +SV D + E+++GDARNVLC+ V+KHHAS
Sbjct  61   AGAAEILPIVEADLKRTATIVIERAQEICTKRSVKDVVVEVVDGDARNVLCDAVDKHHAS  120

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK K
Sbjct  121  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKPK  161



>gb|EAY83459.1| hypothetical protein OsI_38670 [Oryza sativa Indica Group]
Length=320

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A++LP ++ DLK+ AARV E+AKE+C+   V D  +E++EGDARN+LCE VE+HHA +
Sbjct  220  GTAELLPTLELDLKRGAARVNEKAKEMCSQ--VIDASYEVLEGDARNILCEAVERHHADM  277

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGA KRAVLGSVSDYC+HHAHCTVMIVK+PKH 
Sbjct  278  LVVGSHGYGAWKRAVLGSVSDYCSHHAHCTVMIVKRPKHN  317


 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 63/74 (85%), Gaps = 2/74 (3%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP V++DLKK + RVIE+A+E+CA   V D +FE++EGDARNVLCE VE+H A +
Sbjct  76   GAADVLPFVEADLKKSSMRVIEKARELCAQ--VSDALFEVLEGDARNVLCEAVERHQAEM  133

Query  378  LVVGSHGYGAIKRA  419
            LVVGSHGYGAIKR+
Sbjct  134  LVVGSHGYGAIKRS  147



>gb|AAT07452.1| putative universal stress protein [Mirabilis jalapa]
Length=170

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 88/105 (84%), Gaps = 2/105 (2%)
 Frame = +3

Query  192  LAG--AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKH  365
            LAG  AA+I P+VDSDLK IA RV E+A E+C SKS++D   E ++GDAR VLC+ VEK+
Sbjct  66   LAGPVAAEISPYVDSDLKNIATRVKEKALELCRSKSLNDVTVETVDGDARKVLCDAVEKY  125

Query  366  HASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            +AS+LVVGS G+GAIKRAVLGSVSDYCAHHAHC+V+IVKKPK K 
Sbjct  126  NASMLVVGSRGHGAIKRAVLGSVSDYCAHHAHCSVIIVKKPKTKN  170



>ref|XP_006342804.1| PREDICTED: uncharacterized protein C167.05-like [Solanum tuberosum]
Length=157

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 84/101 (83%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G +D+L  V+ D+KK A RV E++K++C +K V+   F+++EGDARNVLC+ V+KHHA+I
Sbjct  57   GTSDVLVVVEKDIKKTAQRVCEKSKQLCEAKGVNGVEFDVVEGDARNVLCDAVDKHHAAI  116

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LV+GSHGYGA KRAVLGSVSDYC+HHA C+VMIVKKPK K 
Sbjct  117  LVMGSHGYGAFKRAVLGSVSDYCSHHARCSVMIVKKPKAKN  157



>ref|XP_006844758.1| hypothetical protein AMTR_s00016p00256970 [Amborella trichopoda]
 gb|ERN06433.1| hypothetical protein AMTR_s00016p00256970 [Amborella trichopoda]
Length=162

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 80/98 (82%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  D+LP V++D+KK A  V+ +AKE+C  KSV D   EI+EGDAR+ LCE VEKH A +
Sbjct  58   GMGDVLPIVEADIKKTACSVVGKAKELCHKKSVKDFDVEIVEGDARSALCEAVEKHQADM  117

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LV+GSHGYGA KRA+LGSVSDYCAHHAHCTVMIVKKPK
Sbjct  118  LVLGSHGYGAFKRAILGSVSDYCAHHAHCTVMIVKKPK  155



>dbj|BAK07550.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=202

 Score =   141 bits (355),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 83/99 (84%), Gaps = 2/99 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A++LP V+ DLK+ +ARVI++AKE C+   V D  +E+ EGDARNVLCE VE+HHA +
Sbjct  92   GTAELLPKVELDLKRASARVIDKAKEHCSH--VTDVSYEVKEGDARNVLCEAVERHHADM  149

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            LV+GSHGYGA KRAVLGSVSDYC H+AHCTVMIVK+PKH
Sbjct  150  LVMGSHGYGAFKRAVLGSVSDYCTHNAHCTVMIVKQPKH  188



>ref|XP_010321386.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=152

 Score =   139 bits (351),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G +D+   V+SD+K+ + + I+++KE+C +K V +   EI+EGDARNV+CE VEK+HASI
Sbjct  52   GTSDMFTLVESDIKRASQKTIDKSKELCKTKGVSNVACEIIEGDARNVICEAVEKYHASI  111

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            L +GSHGYGA KRAVLGSVSDYC+HHAHC+VMIVKKPK K
Sbjct  112  LAMGSHGYGAFKRAVLGSVSDYCSHHAHCSVMIVKKPKPK  151



>ref|XP_009595892.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=158

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  D+   V++D+KK A ++I+RAKE+  SK V +   EI+EGDARNV+C+ VE+HHAS+
Sbjct  58   GTTDMYTMVETDIKKTAQKIIDRAKELSKSKGVANVACEILEGDARNVICDAVERHHASL  117

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LV+GSHGYG  KRAVLGSVSDYC+HHAHC+VMIVKKPK
Sbjct  118  LVMGSHGYGTFKRAVLGSVSDYCSHHAHCSVMIVKKPK  155



>ref|NP_001159181.1| uncharacterized protein LOC100304266 [Zea mays]
 gb|ACN25337.1| unknown [Zea mays]
 tpg|DAA55288.1| TPA: hypothetical protein ZEAMMB73_400725 [Zea mays]
Length=175

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+A++LP V++DLK+  ARV+++AK++C    V D  +E +EGDAR+V+C+ VE+HHA I
Sbjct  75   GSAELLPKVETDLKRSVARVMDKAKKLCTETEVTDVGYEAIEGDARSVICDAVERHHAEI  134

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVG H Y   KRAVLGSVSDYCAHHAHCTVMIVK+PKHK
Sbjct  135  LVVGCHAYSKWKRAVLGSVSDYCAHHAHCTVMIVKRPKHK  174



>ref|XP_009795153.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=158

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  D+   V++D+KK A ++I++AKE+  SK V +   EI+EGDARNV+C+ VE+HHAS+
Sbjct  58   GTTDMYTMVETDIKKTAQKIIDKAKELSKSKGVANVACEILEGDARNVICDAVERHHASL  117

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            LV+GSHGYG  KRAVLGSVSDYC+HHAHC+VMIVKKPK
Sbjct  118  LVMGSHGYGTFKRAVLGSVSDYCSHHAHCSVMIVKKPK  155



>ref|XP_004229244.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=158

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPM-FEIMEGDARNVLCETVEKHHAS  374
            G +D+L  V++D+KK A RV E++K++C +K V   + F+++EGDARNVLC+ V+KHHAS
Sbjct  57   GTSDVLAVVENDIKKTAQRVCEKSKQLCEAKGVMSGVEFDVVEGDARNVLCDVVDKHHAS  116

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            +LV+GSHGYGA KRAVLGSVSDYC+HHA C+VMIVKKPK K
Sbjct  117  VLVMGSHGYGAFKRAVLGSVSDYCSHHARCSVMIVKKPKAK  157



>ref|XP_003575585.1| PREDICTED: uncharacterized protein LOC100832482 [Brachypodium 
distachyon]
Length=203

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 2/99 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G A++LP V+ DLK+ +ARVI+RAK+ C+   V D  +E+ EGDARNVLCE V++HHA +
Sbjct  92   GTAELLPTVELDLKRASARVIDRAKDHCSH--VADVTYEVKEGDARNVLCEAVDRHHADM  149

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            LV+GSHGYGA KRAVLGSVSDYC+HHA CTVMIVK+PKH
Sbjct  150  LVMGSHGYGAFKRAVLGSVSDYCSHHADCTVMIVKRPKH  188



>ref|XP_007144278.1| hypothetical protein PHAVU_007G143000g [Phaseolus vulgaris]
 gb|ESW16272.1| hypothetical protein PHAVU_007G143000g [Phaseolus vulgaris]
Length=159

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            A +I   +DSDL+K A +VI+ AK++C  KSV D   E++EGD RNVLC  VEK+HA+IL
Sbjct  60   AGEIFSILDSDLQKTATKVIDSAKQLCIEKSVHDAALEVVEGDPRNVLCMAVEKYHAAIL  119

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            VVGSHG GA+KR VLGSVSD+CAHHA+CTVMIVKKPK K
Sbjct  120  VVGSHGRGALKRVVLGSVSDFCAHHANCTVMIVKKPKIK  158



>ref|XP_008451579.1| PREDICTED: uncharacterized protein LOC103492817 [Cucumis melo]
Length=165

 Score =   135 bits (339),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +3

Query  183  P*NLAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK  362
            P  + G+A     ++ DLKK AA +I  A+ IC SKSV+D  +E+ EGDARNVLC+ V+K
Sbjct  59   PGMIVGSAGSYQFLNEDLKKKAALIIATARGICESKSVNDVKYEVDEGDARNVLCQAVDK  118

Query  363  HHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            H+AS+LVVGSHGYGA+KRA LGSVSDYCAH A CTVMIVKK K K
Sbjct  119  HNASMLVVGSHGYGALKRAFLGSVSDYCAHQASCTVMIVKKLKTK  163



>ref|XP_004962799.1| PREDICTED: universal stress protein A-like protein-like [Setaria 
italica]
Length=167

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+A++LP V++DLK+  ARVI++AK +CA   V D  +E MEGDAR+V+CE V++HHA +
Sbjct  69   GSAELLPTVEADLKRTVARVIDKAKMLCAE--VTDVGYEAMEGDARSVICEAVDRHHAEM  126

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVG HGY   KRAVLGSVSDYC HHAHC+VM+VK PKHK
Sbjct  127  LVVGCHGYSKWKRAVLGSVSDYCTHHAHCSVMVVKMPKHK  166



>ref|XP_010276436.1| PREDICTED: uncharacterized protein LOC104611178 isoform X2 [Nelumbo 
nucifera]
Length=142

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  222  VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGY  401
            V++DLKK A+R++++A ++C ++S+ D   E+ EGD RNVLCE VE H A ILVVGSHGY
Sbjct  50   VEADLKKTASRIVDKAHKLCKNRSISDFQVEVCEGDPRNVLCEAVENHRADILVVGSHGY  109

Query  402  GAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            GAIKRA+LGSVSDYC HH HCTV+IVKKPK
Sbjct  110  GAIKRAILGSVSDYCTHHVHCTVLIVKKPK  139



>gb|KGN44937.1| hypothetical protein Csa_7G397010 [Cucumis sativus]
Length=165

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +3

Query  183  P*NLAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK  362
            P  + G+A     ++ DLKK AA VI  A+ IC SKSV+D  +E+ EGDAR VLC+ VEK
Sbjct  59   PGMIVGSAGSYQFLNEDLKKKAALVIATARGICESKSVNDVKYEVDEGDARYVLCQAVEK  118

Query  363  HHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            H+AS+LVVGSHGYGA+KRA LGSVSDYCAH A CTVMIVKK K K
Sbjct  119  HNASMLVVGSHGYGALKRAFLGSVSDYCAHQASCTVMIVKKLKTK  163



>ref|XP_004136170.1| PREDICTED: universal stress protein YxiE-like [Cucumis sativus]
 ref|XP_004160569.1| PREDICTED: universal stress protein YxiE-like [Cucumis sativus]
 gb|KGN44938.1| hypothetical protein Csa_7G397020 [Cucumis sativus]
Length=167

 Score =   133 bits (334),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = +3

Query  183  P*NLAGAADILPHV-DSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE  359
            P    G+A  L  V D +LKK A R++E+AKEICAS+SV +  F + EGDARNVLCE V 
Sbjct  62   PGMFMGSAPGLYQVLDQNLKKKAGRIMEKAKEICASRSVRNVEFVVEEGDARNVLCEGVN  121

Query  360  KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            K+ AS+LVVGSHGYGAIKRA+LGSVSDYCAHHA CT+ IV KPK  T
Sbjct  122  KYGASMLVVGSHGYGAIKRALLGSVSDYCAHHAQCTITIV-KPKPNT  167



>ref|XP_007160573.1| hypothetical protein PHAVU_002G333200g [Phaseolus vulgaris]
 gb|ESW32567.1| hypothetical protein PHAVU_002G333200g [Phaseolus vulgaris]
Length=165

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
             ++I P V+  LK  A ++ E+AK+ICASKSV +   E+ EGDARNVLC+ VE+H AS+L
Sbjct  66   GSEIFPAVEMQLKLNADQISEKAKQICASKSVGEVTVEVAEGDARNVLCDAVERHRASVL  125

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            V+GSHGYGAIKRAVLGSVSD+CA HA C+VMIVKKPK
Sbjct  126  VLGSHGYGAIKRAVLGSVSDHCARHARCSVMIVKKPK  162



>ref|XP_007035604.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
 gb|EOY06530.1| Adenine nucleotide alpha hydrolases-like superfamily protein, 
putative [Theobroma cacao]
Length=245

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
             +A+++P +   +KK A  V ++ KEIC +KS+ D   E++EGD RNV+CE VEK+HA+I
Sbjct  145  ASAEVVPIMKVGIKKTATMVKDKVKEICRNKSLSDVRVEVLEGDPRNVVCEAVEKYHAAI  204

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LV+GSHGYG ++RA+LGSVSDYCAHHAHC+VMIVKKPK + 
Sbjct  205  LVLGSHGYGTVRRAILGSVSDYCAHHAHCSVMIVKKPKQEN  245



>ref|XP_004134490.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus]
 ref|XP_004164307.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus]
 gb|KGN57116.1| hypothetical protein Csa_3G154380 [Cucumis sativus]
Length=156

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  192  LAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA  371
              G+ +++P +D+DLKK+  R ++RAK+IC   +V     E++EGDARNVLC++VEK HA
Sbjct  53   FLGSPNLMPTIDADLKKLTNRTVQRAKDICIEHNVQSVETEVVEGDARNVLCDSVEKFHA  112

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            SIL+VGSH YG +K+  LGSVSDYCA HAHC+VMIVK+P
Sbjct  113  SILIVGSHDYGVVKKMGLGSVSDYCAQHAHCSVMIVKRP  151



>gb|EMT03450.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=180

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            A A D++ +VD+DL++ A  V++RA+ +CA  SV   + E+++G+ R VLC  VEKHHA 
Sbjct  80   AAAGDVVRYVDADLRRRAEEVVDRARRLCAGNSVQG-VVEVIDGEPRFVLCNAVEKHHAD  138

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            +LVVGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  139  LLVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKPK  179



>ref|XP_006380142.1| LlDD2A18 family protein [Populus trichocarpa]
 ref|XP_011009836.1| PREDICTED: uncharacterized protein LOC105114843 [Populus euphratica]
 gb|ERP57939.1| LlDD2A18 family protein [Populus trichocarpa]
Length=159

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  D++P +++D KK A  V+++A+E+C +K V D + E++EGDARNV+C+ V++HHAS+
Sbjct  61   GLVDVIPIMEADSKKRAQNVVDKAREVCNNKGVSDVVVEVIEGDARNVMCDAVDRHHASM  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            LVVGSH YGA+KRA+LGSVSD+CAH+A C+V+IVK+PKH
Sbjct  121  LVVGSHNYGAVKRALLGSVSDHCAHNAPCSVLIVKQPKH  159



>ref|XP_002443333.1| hypothetical protein SORBIDRAFT_08g017640 [Sorghum bicolor]
 gb|EES17171.1| hypothetical protein SORBIDRAFT_08g017640 [Sorghum bicolor]
Length=275

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ ++LP V++DLK+  ARV+++AK++C    V D  +E +EGDAR+V+C+ V++HHA I
Sbjct  177  GSVELLPKVEADLKRTVARVMDKAKKLCTQ--VIDVSYEAIEGDARSVICDAVDRHHAEI  234

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVG HGY   KRAVLGSVSDYC HHAHCTVMIVKKPKHK
Sbjct  235  LVVGCHGYSKWKRAVLGSVSDYCTHHAHCTVMIVKKPKHK  274



>ref|XP_009769248.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
sylvestris]
Length=161

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  D+L  +++D+K+ A +VIE+AKE+C SK + D   E+ EGDARNV+C+ V+K+HAS+
Sbjct  60   GRIDVLTLLETDIKRGAYKVIEKAKELCKSKGLKDVSCEVNEGDARNVICDAVDKYHASL  119

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK---KPKH  494
            LV+GSHGYGA KRAVLGSVSDYC+HHA+C+VMIVK   KPK 
Sbjct  120  LVMGSHGYGAFKRAVLGSVSDYCSHHANCSVMIVKNDTKPKQ  161



>gb|EMS51706.1| Universal stress protein A-like protein [Triticum urartu]
Length=180

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            A A D++ +VD+DL++ A  V++RA+ +CA+ SV   + ++++G+ R VLC  VEKHHA 
Sbjct  80   AAAGDVVRYVDADLRRRAEEVVDRARRLCAANSVQG-VVKVIDGEPRYVLCNAVEKHHAD  138

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            +LVVGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  139  LLVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKPK  179



>ref|XP_004298129.1| PREDICTED: uncharacterized protein LOC101292697 [Fragaria vesca 
subsp. vesca]
Length=163

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ D L  + SD+KK A + +E+AKE+C  K V++   E+MEGD RNV+ E V+KH A++
Sbjct  60   GSGDFLNSLISDMKKSANKTVEKAKELCTKKKVENVQVEVMEGDPRNVMPEAVDKHGAAL  119

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGA+KRAVLGSVSD+CAHHA+C+VMIVK+P +K
Sbjct  120  LVLGSHGYGAVKRAVLGSVSDHCAHHANCSVMIVKRPMNK  159



>ref|XP_006349949.1| PREDICTED: uncharacterized protein LOC102595448 [Solanum tuberosum]
Length=163

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  D+L  +++D+K+   +VIE+AKE+C SK V +  +E+ EGDARN++ + VEK HA++
Sbjct  63   GRIDVLTLIETDIKRAVDKVIEKAKELCKSKGVTNVSYEVYEGDARNIIVDAVEKQHATL  122

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGA KRAVLGSVSDYC+HHA+C+VMIVK  K K
Sbjct  123  LVMGSHGYGAFKRAVLGSVSDYCSHHANCSVMIVKNNKPK  162



>ref|XP_010440254.1| PREDICTED: uncharacterized protein LOC104723570 [Camelina sativa]
Length=170

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  DI+P V+ DL K A  V +++ E+C++KSV+    E++EGD RN++ E VE+HHA +
Sbjct  64   GTVDIIPMVEQDLNKTAELVKKKSAEVCSAKSVEMASSEVIEGDPRNIMLEAVERHHACV  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LV+GSHGYGA+KR  LGSVSDY AHHAHC+VMIVKKPK K+
Sbjct  124  LVLGSHGYGAVKRVFLGSVSDYLAHHAHCSVMIVKKPKAKS  164



>ref|XP_009612671.1| PREDICTED: universal stress protein A-like protein [Nicotiana 
tomentosiformis]
Length=161

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 83/102 (81%), Gaps = 3/102 (3%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  D+L  +++D+K+ A +VIE+ KE+C SK + +   E++EGDARNV+C+ V+KHHAS+
Sbjct  60   GRIDVLTLIETDIKRGAEKVIEKTKELCKSKRLKEVSCEVIEGDARNVICDAVDKHHASL  119

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK---KPKH  494
            LV+GSHGYGA KRAVLGSVSDYC+HHA+C+VMIVK   KPK 
Sbjct  120  LVMGSHGYGAFKRAVLGSVSDYCSHHANCSVMIVKNDTKPKQ  161



>ref|XP_004253149.1| PREDICTED: universal stress protein A-like protein [Solanum lycopersicum]
Length=160

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  D+L  +++D+K+    VIE+AKE+C SK V +  +E+ EGDARN++ + VEK HA++
Sbjct  60   GRIDVLTLIETDIKRAVDNVIEKAKELCKSKGVSNVSYEVYEGDARNIIVDAVEKQHATL  119

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGA KRAVLGSVSDYC+HHA+C+VMIVK  K K
Sbjct  120  LVMGSHGYGAFKRAVLGSVSDYCSHHANCSVMIVKNNKPK  159



>ref|XP_004136029.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus]
 ref|XP_004160552.1| PREDICTED: universal stress protein MJ0531-like [Cucumis sativus]
Length=162

 Score =   130 bits (326),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 3/105 (3%)
 Frame = +3

Query  183  P*NLAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK  362
            P   AG+   L   + DLKK AA VI  A+ IC SKSV+D  +E+ EGDAR VLC+ VEK
Sbjct  59   PGRSAGSYQFL---NEDLKKKAALVIATARGICESKSVNDVKYEVDEGDARYVLCQAVEK  115

Query  363  HHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            H+AS+LVVGSHGYGA+KRA LGSVSDYCAH A CTVMIVKK K K
Sbjct  116  HNASMLVVGSHGYGALKRAFLGSVSDYCAHQASCTVMIVKKLKTK  160



>ref|XP_008451580.1| PREDICTED: uncharacterized protein LOC103492818 isoform X1 [Cucumis 
melo]
Length=168

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = +3

Query  183  P*NLAGAADILPHV-DSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE  359
            P    G+A  L  V D +LKK A  ++++AKEICA++SV D  F + EGDARNVLCE V 
Sbjct  63   PGTFLGSAPGLYQVLDQNLKKKAGNIMKKAKEICATRSVCDVEFVVEEGDARNVLCEGVN  122

Query  360  KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            K+ AS+LVVGSHGYGAIKRA+LGSVSDYCAHHA CTV+IVK   H
Sbjct  123  KYGASMLVVGSHGYGAIKRALLGSVSDYCAHHAQCTVIIVKPKPH  167



>ref|XP_002863949.1| hypothetical protein ARALYDRAFT_917855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40208.1| hypothetical protein ARALYDRAFT_917855 [Arabidopsis lyrata subsp. 
lyrata]
Length=167

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  DI+P V+ DL K A  V ++  E+C++KSV+    E++EGD RN++ E VE+HHA +
Sbjct  61   GTVDIIPMVEQDLNKTAELVKKKCSEVCSAKSVEISSLEVIEGDPRNIMLEAVERHHACV  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            +V+GSHGYGA+KR  LGSVSDY AHHAHC+VMIVKKPK K
Sbjct  121  IVLGSHGYGAVKRVFLGSVSDYLAHHAHCSVMIVKKPKAK  160



>emb|CDY05645.1| BnaC02g38920D [Brassica napus]
Length=167

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  DI+P V+ DL K A  V ++  ++C++KSV+    E++EGD RN++ E  E+HHAS+
Sbjct  61   GTVDIIPLVEQDLDKTADLVKKKCTDVCSAKSVEITSLEVIEGDPRNIMLEAAERHHASV  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGAIKR  LGSVSDY AHHAHC+VMIVKKPK K
Sbjct  121  LVLGSHGYGAIKRVFLGSVSDYLAHHAHCSVMIVKKPKAK  160



>gb|EMS45264.1| Universal stress protein A-like protein [Triticum urartu]
Length=108

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 78/99 (79%), Gaps = 7/99 (7%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            A D++  VD+DL+K A  V++RA+ +C + SV       MEG+AR VLC+ V+KHHA +L
Sbjct  16   AGDVVRVVDADLRKRAEDVVDRARRLCVANSV-------MEGEARYVLCDAVDKHHADLL  68

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            VVGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  69   VVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKTK  107



>ref|XP_006395098.1| hypothetical protein EUTSA_v10005680mg, partial [Eutrema salsugineum]
 gb|ESQ32384.1| hypothetical protein EUTSA_v10005680mg, partial [Eutrema salsugineum]
Length=171

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  DI+P V+ D  K A  V ++  E+C++KSV+    E++EGD RN++ E+ E+HHAS+
Sbjct  65   GTVDIIPMVEQDFDKTAELVKKKCAEVCSAKSVEISSSEVIEGDPRNIMLESAERHHASV  124

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LV+GSHGYG +KR  LGSVSDY AHHAHC+VMIVKKPK KT
Sbjct  125  LVLGSHGYGDVKRVFLGSVSDYLAHHAHCSVMIVKKPKAKT  165



>ref|XP_008451581.1| PREDICTED: uncharacterized protein LOC103492818 isoform X2 [Cucumis 
melo]
Length=157

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  222  VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGY  401
            +D +LKK A  ++++AKEICA++SV D  F + EGDARNVLCE V K+ AS+LVVGSHGY
Sbjct  66   LDQNLKKKAGNIMKKAKEICATRSVCDVEFVVEEGDARNVLCEGVNKYGASMLVVGSHGY  125

Query  402  GAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            GAIKRA+LGSVSDYCAHHA CTV+IVK   H
Sbjct  126  GAIKRALLGSVSDYCAHHAQCTVIIVKPKPH  156



>gb|KFK31273.1| hypothetical protein AALP_AA6G090900 [Arabis alpina]
Length=167

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  DI+P V+ DL K A+ V ++  E+C++KSV+    E++EGD RN++ E  E+HHAS+
Sbjct  61   GTVDIIPMVEQDLDKTASLVKKKCAEVCSAKSVEIMSSEVIEGDPRNIMLEGAERHHASV  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGA+KR  LGSVSDY AHHAHC+VMIVKKPK K
Sbjct  121  LVLGSHGYGAVKRVFLGSVSDYLAHHAHCSVMIVKKPKAK  160



>ref|XP_010523937.1| PREDICTED: uncharacterized protein LOC104802163 [Tarenaya hassleriana]
Length=166

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  213  LPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGS  392
            LP VDS LK++AA V+ERA++IC SKSV    F++++GD R VLC+ V+KH AS+LVVG+
Sbjct  64   LPIVDSHLKQVAAGVMERAEQICLSKSVTGARFKVVDGDPRLVLCDAVDKHAASVLVVGN  123

Query  393  HGYGAIKRAVLGSVSDYCAHHAHCTVM  473
            HGYGAIKRA+LGSVSDYCAHHAHCTVM
Sbjct  124  HGYGAIKRAILGSVSDYCAHHAHCTVM  150



>gb|AAV65310.1| universal stress protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            A A D++  VD+DL+K A  V++RA+ +C + SV   + E++EG+ R+VLC  V+KHHA 
Sbjct  73   AAAGDLVRVVDADLRKRAEDVVDRARRLCVANSVH-ALIEVIEGEPRHVLCSAVDKHHAD  131

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            +L VGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K 
Sbjct  132  LLAVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKSKN  173



>ref|XP_009129758.1| PREDICTED: uncharacterized protein LOC103854572 [Brassica rapa]
Length=167

 Score =   128 bits (321),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  DI+P V+ DL K A  V ++  ++C++KSV+    E++EGD RN++ E  E+HHAS+
Sbjct  61   GTVDIIPLVEQDLDKTADLVKKKCTDVCSAKSVEITSLEVVEGDPRNIMLEAAERHHASV  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGA+KR  LGSVSDY AHHAHC+VMIVKKPK K
Sbjct  121  LVLGSHGYGAVKRVFLGSVSDYLAHHAHCSVMIVKKPKAK  160



>ref|XP_010524712.1| PREDICTED: universal stress protein A-like protein [Tarenaya 
hassleriana]
Length=168

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA D++P V+ DLKK A  V+++  EIC++KS++    E+ EGD RN++ +  EKHHAS+
Sbjct  61   GAVDVMPMVEQDLKKTADWVLKKCNEICSNKSIEITASEVTEGDPRNIMVDASEKHHASV  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            +V+GSHGYGA+KR  LGSVSDY AHHAHC+VMIVK  KHKT
Sbjct  121  IVLGSHGYGAVKRVFLGSVSDYLAHHAHCSVMIVK--KHKT  159



>emb|CDY33932.1| BnaA02g30550D [Brassica napus]
Length=167

 Score =   127 bits (319),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G  DI+P V+ DL K A  V ++  ++C++KSV+    E++EGD RN++ E  E+HHAS+
Sbjct  61   GTVDIIPLVEQDLDKTADLVKKKCTDVCSAKSVEITSLEVVEGDPRNIMLEAAERHHASV  120

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LV+GSHGYGA+KR  LGSVSDY AHHAHC+VMIVKKPK K
Sbjct  121  LVLGSHGYGAVKRVFLGSVSDYLAHHAHCSVMIVKKPKVK  160



>ref|XP_007199080.1| hypothetical protein PRUPE_ppa019122mg [Prunus persica]
 gb|EMJ00279.1| hypothetical protein PRUPE_ppa019122mg [Prunus persica]
Length=112

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +3

Query  189  NLAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIME-------GDARNVLC  347
            N  G  ++LP  +++LKK+  RV ++ KEICASK V    +           G ARNVLC
Sbjct  2    NCVGGFEVLPTREAELKKMGIRVEDKVKEICASKWVIISSYSGERYGNRGGCGGARNVLC  61

Query  348  ETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            E VE+H AS+LV GSHGYGA+KRAVLGSVSDYCAHHA CTVMIVK+PK K 
Sbjct  62   EAVERHKASMLVSGSHGYGAMKRAVLGSVSDYCAHHARCTVMIVKRPKIKN  112



>ref|XP_010445967.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=168

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  207  DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVV  386
            DI+P V+ DL K A  V ++  E+C++KSV+    E++EGD RN++ E VE+HHA +LV+
Sbjct  65   DIIPMVEQDLNKTAELVKKKCAEVCSAKSVEIASSEVIEGDPRNIMLEAVERHHACVLVL  124

Query  387  GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            GSHGYGA+KR  LGSVSDY AHHAHC+VMIVKKPK K
Sbjct  125  GSHGYGAVKRVFLGSVSDYLAHHAHCSVMIVKKPKAK  161



>ref|XP_006423747.1| hypothetical protein CICLE_v10029382mg [Citrus clementina]
 gb|ESR36987.1| hypothetical protein CICLE_v10029382mg [Citrus clementina]
Length=176

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+VDSDLKKIAARV+E+AKEIC+SKSV D + E++EGDARN+LCE VEKHHASI
Sbjct  61   GAAEVLPYVDSDLKKIAARVVEKAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKR  416
            LVVGSHGYGAIKR
Sbjct  121  LVVGSHGYGAIKR  133



>ref|XP_004958663.1| PREDICTED: uncharacterized protein LOC101769282 [Setaria italica]
Length=189

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA + +  V++DL+K+A  V+ RA+++C + SV   + E++EG+ R VLC   EKHHA +
Sbjct  90   GAGEAMRCVEADLRKMAEAVVGRARQVCIANSVH-ALIEVVEGEPRYVLCNAAEKHHADL  148

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRA LGSVSDYCAHH HCTVMIVK+PK K
Sbjct  149  LVVGSHGYGAIKRAFLGSVSDYCAHHTHCTVMIVKRPKSK  188



>ref|XP_006658108.1| PREDICTED: uncharacterized protein LOC102707323 [Oryza brachyantha]
Length=171

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ +++  V++DL+K A  V+ERA+ +C + ++   + E++EG+ R VLC  VEKH+A +
Sbjct  66   GSGEVVRFVEADLRKTAEDVVERARRLCIANAMH-ALIEVIEGEPRYVLCNAVEKHNAGL  124

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  125  LVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKAK  164



>ref|XP_006487495.1| PREDICTED: uncharacterized protein LOC102621599 isoform X1 [Citrus 
sinensis]
Length=205

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/73 (81%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAA++LP+VDSDLKKIAARV+E+AKEIC+SKSV D + E++EGDARN+LCE VEKHHASI
Sbjct  61   GAAEVLPYVDSDLKKIAARVVEKAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKR  416
            LVVGSHGYGAIKR
Sbjct  121  LVVGSHGYGAIKR  133



>gb|EMS51705.1| Universal stress protein A-like protein [Triticum urartu]
Length=177

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            + D++  V++DL+K A  V++RA+ +C + SV   + E+++G+ R+VLC  VEKHHA +L
Sbjct  79   SGDVVRLVEADLRKKADGVVDRARRLCVANSVQG-VVEVVDGEPRHVLCNAVEKHHADLL  137

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            VVGSHGYGAIKRA+LGSVSDYCAHHAHC+VMIVK+PK K 
Sbjct  138  VVGSHGYGAIKRALLGSVSDYCAHHAHCSVMIVKQPKPKN  177



>ref|XP_010909279.1| PREDICTED: uncharacterized protein LOC105035428, partial [Elaeis 
guineensis]
Length=107

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  213  LPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGS  392
            L  V++DLKKIA  V+E+AKEIC  +S+ D      EGDARN LC+ VEK +A +L++GS
Sbjct  10   LSIVENDLKKIAVLVMEKAKEICEKRSLTDFEAVATEGDARNALCDAVEKRYADMLIMGS  69

Query  393  HGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            HGYG+ KRA+LGSVSDYCAHHA C+V+IVKKPK
Sbjct  70   HGYGSFKRAILGSVSDYCAHHAPCSVLIVKKPK  102



>ref|NP_001060607.1| Os07g0673400 [Oryza sativa Japonica Group]
 dbj|BAC16006.1| universal stress protein USP1-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF22521.1| Os07g0673400 [Oryza sativa Japonica Group]
 gb|EAZ41056.1| hypothetical protein OsJ_25543 [Oryza sativa Japonica Group]
 dbj|BAG88992.1| unnamed protein product [Oryza sativa Japonica Group]
Length=171

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ +++ +V++DL+K A  V+E+A+ +C + ++   + E++EG+ R VLC  VEKH A +
Sbjct  66   GSGEVVRYVEADLRKTAEDVVEKARRLCIANAMH-ALIEVIEGEPRYVLCNAVEKHSAGL  124

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  125  LVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKAK  164



>ref|XP_006593395.1| PREDICTED: uncharacterized protein LOC100527376 isoform X1 [Glycine 
max]
 ref|XP_006593396.1| PREDICTED: uncharacterized protein LOC100527376 isoform X2 [Glycine 
max]
Length=164

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  204  ADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV  383
            ++I P V   LK  A ++ E+AK+ CASKSV + + E++EGDARNVLC+ V++H AS+LV
Sbjct  66   SEIFPAVQVQLKANAEQIAEKAKQFCASKSVLEVLVEVVEGDARNVLCDAVDRHRASVLV  125

Query  384  VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            +GSHGYGAIKRAVLGSVSD+CA HAHC+VMIVK+PK K
Sbjct  126  LGSHGYGAIKRAVLGSVSDHCARHAHCSVMIVKRPKFK  163



>gb|EAZ05105.1| hypothetical protein OsI_27297 [Oryza sativa Indica Group]
Length=171

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ +++ +V++DL+K A  V+E+A+ +C + ++   + E++EG+ R VLC  VEKH A +
Sbjct  66   GSGEVVRYVEADLRKTAEDVVEKARRLCIANAMH-ALIEVIEGEPRYVLCNAVEKHSAGL  124

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  125  LVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKAK  164



>gb|KHN30217.1| Universal stress protein A-like protein [Glycine soja]
Length=155

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
             ++I P V   LK  A ++ E+AK+ CASKSV + + E++EGDARNVLC+ V++H AS+L
Sbjct  56   GSEIFPAVQVQLKANAEQIAEKAKQFCASKSVLEVLVEVVEGDARNVLCDAVDRHRASVL  115

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            V+GSHGYGAIKRAVLGSVSD+CA HAHC+VMIVK+PK K
Sbjct  116  VLGSHGYGAIKRAVLGSVSDHCARHAHCSVMIVKRPKFK  154



>gb|AAM09541.1|AF491815_1 putative universal stress protein USP1 [Oryza sativa Indica Group]
Length=171

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ +++ +V++DL+K A  V+E+A+ +C + ++   + E++EG+ R VLC  VEKH A +
Sbjct  66   GSGEVVRYVEADLRKTAEDVVEKARRLCIANAMH-ALIEVIEGEPRYVLCNAVEKHSAGL  124

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LVVGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  125  LVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKAK  164



>ref|NP_001235200.1| uncharacterized protein LOC100527376 [Glycine max]
 gb|ACU16464.1| unknown [Glycine max]
Length=164

 Score =   124 bits (312),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 81/98 (83%), Gaps = 0/98 (0%)
 Frame = +3

Query  204  ADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV  383
            ++I P V   LK  A ++ E+AK+ CASKSV + + E++EGDARNVLC+ V++H AS+LV
Sbjct  66   SEIFPAVQVQLKANAEQIAEKAKQFCASKSVLEVLVEVVEGDARNVLCDAVDRHRASVLV  125

Query  384  VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            +GSHGYGAIKRAVLGSVSD+CA HAHC+VMIVK+PK K
Sbjct  126  LGSHGYGAIKRAVLGSVSDHCARHAHCSVMIVKRPKFK  163



>ref|XP_008340802.1| PREDICTED: uncharacterized protein LOC103403747 [Malus domestica]
Length=161

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ + +  ++SD+KKI+++ +++AK+ C SK V++   E+MEGD RNV+C+ V+KHHAS+
Sbjct  62   GSGEFITSLESDMKKISSKTVQKAKDFCTSKKVENVEVEVMEGDPRNVMCDAVDKHHASL  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            LV+GSHGYG +KRAVLGSVSDYCAHHA C+VMIVKKP
Sbjct  122  LVLGSHGYGIVKRAVLGSVSDYCAHHAKCSVMIVKKP  158



>gb|KDO50052.1| hypothetical protein CISIN_1g030516mg [Citrus sinensis]
Length=176

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA ++LPHVDSD KKIAARV+E AKEIC+SKSV D + E++EGDARN+LCE VEKHHASI
Sbjct  61   GAVEVLPHVDSDFKKIAARVVEEAKEICSSKSVHDFVVEVVEGDARNILCEAVEKHHASI  120

Query  378  LVVGSHGYGAIKR  416
            LVVGSHGYGAIKR
Sbjct  121  LVVGSHGYGAIKR  133



>gb|EMT19721.1| hypothetical protein F775_00737 [Aegilops tauschii]
Length=165

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 81/100 (81%), Gaps = 1/100 (1%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            + D++  V++DL+K A  V+++A+ +C + SV   + E+++G+ R+VLC  V+KHHA +L
Sbjct  67   SGDVVRLVEADLRKKAEGVVDKARRLCVANSVQG-VVEVVDGEPRHVLCNAVDKHHADLL  125

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            VVGSHGYGAIKRA+LGSVSDYCAHHAHC+VMIVK+PK K 
Sbjct  126  VVGSHGYGAIKRALLGSVSDYCAHHAHCSVMIVKQPKSKN  165



>ref|XP_006423741.1| hypothetical protein CICLE_v100301792mg, partial [Citrus clementina]
 gb|ESR36981.1| hypothetical protein CICLE_v100301792mg, partial [Citrus clementina]
Length=69

 Score =   119 bits (299),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  294  VDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVM  473
            V D + E++EGDARN+LC+ VEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVM
Sbjct  1    VHDAVVEVVEGDARNILCDAVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVM  60

Query  474  IVKKPKHK  497
            IVK+PK K
Sbjct  61   IVKRPKTK  68



>ref|XP_010440246.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=100

 Score =   120 bits (300),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  222  VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGY  401
            V+ DL K A  V ++  E+C++KSV+    E++EGD RN++ E VE+HHA +LV+GSHGY
Sbjct  2    VEQDLNKTAELVKKKCAEVCSAKSVEIASSEVIEGDPRNIMLEAVERHHACVLVLGSHGY  61

Query  402  GAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            GA+KR  LGSVSDY AHHAHC+VMIVKKPK K+
Sbjct  62   GAVKRVFLGSVSDYLAHHAHCSVMIVKKPKAKS  94



>gb|KJB23278.1| hypothetical protein B456_004G089400 [Gossypium raimondii]
Length=135

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+VD+DL+KIAARV+E+AKE+C SKSV D + E++EGDARNVLC+ VEKHHAS+
Sbjct  62   GAADVLPYVDADLRKIAARVVEKAKELCLSKSVHDAVVEVVEGDARNVLCDAVEKHHASV  121

Query  378  LVVGSHGYGAIKR  416
            L VGSHGYGAIKR
Sbjct  122  LAVGSHGYGAIKR  134



>ref|XP_008223197.1| PREDICTED: universal stress protein A-like protein [Prunus mume]
Length=163

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ D +  +++D+KK   + +++AK++C SK V+D   E+MEGD RNV+C+ V+KHHAS+
Sbjct  64   GSVDFMTSLEADMKKSTCKTVQKAKDVCTSKKVEDVEVEVMEGDPRNVMCDAVDKHHASL  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            LVVGSHGYG +KRAVLGSVSDYCAHH  C+VMIVKKP
Sbjct  124  LVVGSHGYGLVKRAVLGSVSDYCAHHVKCSVMIVKKP  160



>emb|CAN83653.1| hypothetical protein VITISV_015456 [Vitis vinifera]
Length=140

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 3/88 (3%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+V++DLKKIA RV+ +A EICASKSV D + E++EGDARNV+CE VEKHHASI
Sbjct  53   GAADVLPYVEADLKKIAGRVVGKAHEICASKSVTDVILEVVEGDARNVMCEAVEKHHASI  112

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAH  461
            LVVGSHGYGAIKR    S+S Y  +  H
Sbjct  113  LVVGSHGYGAIKRY---SLSSYFLNFTH  137



>gb|KDO71686.1| hypothetical protein CISIN_1g044140mg [Citrus sinensis]
Length=166

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            AG+A ++  V+ D KK A +V ++A  ICA + V+D    +M+GD RNV+ E VE+ H +
Sbjct  65   AGSAHVINLVELDTKKRAQKVADKATSICAKREVNDMPVHVMQGDPRNVMTEAVERFHPT  124

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            ILV+GSHGYGA+KRAVLGSVSDY AHH  CTVMIVK PK K
Sbjct  125  ILVLGSHGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMPKSK  165



>ref|XP_008451577.1| PREDICTED: universal stress protein A-like protein isoform X3 
[Cucumis melo]
Length=171

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  189  NLAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH  368
             +AG+ +     D DLK+ AAR I+ A+EIC+SKSV D  FE+ EGDAR VLCE   KH 
Sbjct  63   RIAGSVETYQAFDGDLKRKAARTIKIAREICSSKSVCDVEFEVEEGDARYVLCEAAIKHR  122

Query  369  ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK  482
            AS+LVVGS G+G +KRA LGSVSDYC H A CTVMIVK
Sbjct  123  ASVLVVGSRGHGGMKRAFLGSVSDYCVHQAPCTVMIVK  160



>ref|XP_008451575.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Cucumis melo]
Length=183

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  189  NLAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH  368
             +AG+ +     D DLK+ AAR I+ A+EIC+SKSV D  FE+ EGDAR VLCE   KH 
Sbjct  75   RIAGSVETYQAFDGDLKRKAARTIKIAREICSSKSVCDVEFEVEEGDARYVLCEAAIKHR  134

Query  369  ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK  482
            AS+LVVGS G+G +KRA LGSVSDYC H A CTVMIVK
Sbjct  135  ASVLVVGSRGHGGMKRAFLGSVSDYCVHQAPCTVMIVK  172



>ref|XP_004136171.1| PREDICTED: universal stress protein A-like protein-like [Cucumis 
sativus]
 gb|KGN44936.1| hypothetical protein Csa_7G397000 [Cucumis sativus]
Length=171

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  189  NLAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH  368
            ++AG+ +     D DLK+ A R I+ A+EICASKSV D  FE+ EGDAR VLCE   KH 
Sbjct  63   SIAGSIETYQAFDGDLKRKAERTIKNAREICASKSVCDVEFEVEEGDARYVLCEAAIKHR  122

Query  369  ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK  482
            AS+LVVGS  +GAIKRA+LGSVSD+CAH A CTVMIVK
Sbjct  123  ASVLVVGSRDHGAIKRALLGSVSDHCAHQAPCTVMIVK  160



>ref|XP_007199013.1| hypothetical protein PRUPE_ppa017534mg, partial [Prunus persica]
 gb|EMJ00212.1| hypothetical protein PRUPE_ppa017534mg, partial [Prunus persica]
Length=69

 Score =   116 bits (290),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  294  VDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVM  473
            V D   E++EGDARNVLC+ V++HHAS+LVVGSHGYGAIKRAVLGSVSDYCAHHAHC+VM
Sbjct  1    VTDVTVELVEGDARNVLCDAVDRHHASVLVVGSHGYGAIKRAVLGSVSDYCAHHAHCSVM  60

Query  474  IVKKPKHK  497
            IVKKPK K
Sbjct  61   IVKKPKTK  68



>ref|XP_007225541.1| hypothetical protein PRUPE_ppa026734mg [Prunus persica]
 gb|EMJ26740.1| hypothetical protein PRUPE_ppa026734mg [Prunus persica]
Length=163

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ D +  +++D+KK   + +++AK++C SK V++   E+MEGD RNV+C+ V+KH AS+
Sbjct  64   GSVDFMTSLEADMKKSTGKTVQKAKDVCTSKKVENVEVEVMEGDPRNVMCDAVDKHQASL  123

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            LVVGSHGYG +KRAVLGSVSDYCAHH  C+VMIVK+P
Sbjct  124  LVVGSHGYGIVKRAVLGSVSDYCAHHVKCSVMIVKQP  160



>ref|XP_008438889.1| PREDICTED: uncharacterized protein LOC103483847 isoform X2 [Cucumis 
melo]
Length=155

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = +3

Query  192  LAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA  371
              G+ +++P +D+DLKK  + V +RAK+IC    V     E++EGDAR+VLC++V+K HA
Sbjct  53   FLGSPNLMPTIDADLKKTNSTV-QRAKDICIEHKVQSVETEVVEGDARHVLCDSVDKFHA  111

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            SILVVGSH YG +K+  LGSVSDYCA HAHC VMIVK+P
Sbjct  112  SILVVGSHDYGVVKKMGLGSVSDYCAQHAHCCVMIVKRP  150



>ref|XP_006419561.1| hypothetical protein CICLE_v10007124mg [Citrus clementina]
 gb|ESR32801.1| hypothetical protein CICLE_v10007124mg [Citrus clementina]
Length=167

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            AG+A ++  V+ D KK A +V +RA  ICA + V++    +M+GD RNV+ E VE+ H +
Sbjct  66   AGSAHVINLVELDTKKRAQKVADRATSICAKREVNNVPVHVMQGDPRNVMTEAVERFHPT  125

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            ILV+GS GYGA+KRAVLGSVSDY AHH  CTVMIVK PK K
Sbjct  126  ILVLGSRGYGAVKRAVLGSVSDYSAHHCSCTVMIVKMPKSK  166



>ref|XP_006281889.1| hypothetical protein CARUB_v10028087mg [Capsella rubella]
 gb|EOA14787.1| hypothetical protein CARUB_v10028087mg [Capsella rubella]
Length=167

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = +3

Query  207  DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVV  386
            D++  V+ DLKK A  V ++  E C++KSV+    E++EGD R+++ E  E+HHA +LV+
Sbjct  64   DVIQMVEQDLKKTAELVKKKCAEACSAKSVEIASSEVIEGDPRDIMLEAAERHHACVLVL  123

Query  387  GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            GSHGYGA+KR  LGSVSDY AHHAHC+VMIVKKPK K
Sbjct  124  GSHGYGAVKRVFLGSVSDYLAHHAHCSVMIVKKPKAK  160



>ref|XP_003591534.1| Universal stress protein [Medicago truncatula]
Length=321

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  258  IERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVS  437
            +E  +++   + V+D + E++EGDARNVLC+TVEK+ ASILVVGSHGYGAIKRAVLGSVS
Sbjct  241  VETERKMRCLEDVNDVIVEVVEGDARNVLCDTVEKYRASILVVGSHGYGAIKRAVLGSVS  300

Query  438  DYCAHHAHCTVMIVKKPKHK  497
            DYCAHHAHCTVMIVKKPK K
Sbjct  301  DYCAHHAHCTVMIVKKPKTK  320



>ref|XP_008438888.1| PREDICTED: uncharacterized protein LOC103483847 isoform X1 [Cucumis 
melo]
Length=209

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = +3

Query  192  LAGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA  371
              G+ +++P +D+DLKK  + V +RAK+IC    V     E++EGDAR+VLC++V+K HA
Sbjct  107  FLGSPNLMPTIDADLKKTNSTV-QRAKDICIEHKVQSVETEVVEGDARHVLCDSVDKFHA  165

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            SILVVGSH YG +K+  LGSVSDYCA HAHC VMIVK+P
Sbjct  166  SILVVGSHDYGVVKKMGLGSVSDYCAQHAHCCVMIVKRP  204



>ref|XP_006489259.1| PREDICTED: uncharacterized protein LOC102617240 [Citrus sinensis]
Length=167

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 74/101 (73%), Gaps = 0/101 (0%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS  374
            AG+A ++  V+ D KK A +V +RA  ICA + V++    +M+GD RNV+ E VE+ H +
Sbjct  66   AGSAHVINLVELDTKKRAQKVADRATSICAKREVNNVPVHVMQGDPRNVMTEAVERFHPT  125

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            ILV+GS GYG++KRAVLGSVSDY AHH  CTVMIVK PK K
Sbjct  126  ILVLGSRGYGSVKRAVLGSVSDYSAHHCSCTVMIVKMPKSK  166



>gb|AES61785.2| universal stress protein, putative [Medicago truncatula]
Length=286

 Score =   119 bits (299),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  294  VDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVM  473
            V+D + E++EGDARNVLC+TVEK+ ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVM
Sbjct  218  VNDVIVEVVEGDARNVLCDTVEKYRASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVM  277

Query  474  IVKKPKHK  497
            IVKKPK K
Sbjct  278  IVKKPKTK  285



>ref|XP_008451576.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Cucumis melo]
Length=180

 Score =   117 bits (292),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  225  DSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYG  404
            D DLK+ AAR I+ A+EIC+SKSV D  FE+ EGDAR VLCE   KH AS+LVVGS G+G
Sbjct  84   DGDLKRKAARTIKIAREICSSKSVCDVEFEVEEGDARYVLCEAAIKHRASVLVVGSRGHG  143

Query  405  AIKRAVLGSVSDYCAHHAHCTVMIVK  482
             +KRA LGSVSDYC H A CTVMIVK
Sbjct  144  GMKRAFLGSVSDYCVHQAPCTVMIVK  169



>ref|XP_008451578.1| PREDICTED: universal stress protein A-like protein isoform X4 
[Cucumis melo]
Length=168

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  225  DSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYG  404
            D DLK+ AAR I+ A+EIC+SKSV D  FE+ EGDAR VLCE   KH AS+LVVGS G+G
Sbjct  72   DGDLKRKAARTIKIAREICSSKSVCDVEFEVEEGDARYVLCEAAIKHRASVLVVGSRGHG  131

Query  405  AIKRAVLGSVSDYCAHHAHCTVMIVK  482
             +KRA LGSVSDYC H A CTVMIVK
Sbjct  132  GMKRAFLGSVSDYCVHQAPCTVMIVK  157



>ref|XP_010445975.1| PREDICTED: universal stress protein A-like protein [Camelina 
sativa]
Length=175

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 74/103 (72%), Gaps = 7/103 (7%)
 Frame = +3

Query  210  ILPHVDSDLK-------KIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH  368
            I+P V  D +        ++ R+  +  E+C++KSV+    E++EGD RN++ E VE+HH
Sbjct  66   IIPMVKQDFRPGHSVNHSVSVRLYSKCAEVCSAKSVEIASSEVIEGDPRNIMLEAVERHH  125

Query  369  ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            A +LV+GSHGYGA+KR  LGSVSDY AHHAHC+VMIVKKPK K
Sbjct  126  ACVLVLGSHGYGAVKRVFLGSVSDYLAHHAHCSVMIVKKPKAK  168



>emb|CDY27474.1| BnaC04g51150D [Brassica napus]
Length=64

 Score =   111 bits (277),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +3

Query  309  FEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
             E+ EGDARN+LCE V+KHHAS+LVVGSHG+GAIKRAV+GSVSDYCAHHAHC+VMIVKKP
Sbjct  1    MEVFEGDARNILCEVVDKHHASLLVVGSHGHGAIKRAVIGSVSDYCAHHAHCSVMIVKKP  60

Query  489  K  491
            K
Sbjct  61   K  61



>gb|EMT19722.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=128

 Score =   113 bits (282),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = +3

Query  189  NLAGAA---DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE  359
            N+ G     D++  V+ DL+K A  V+ +A+ +CA+ SV+  + ++++G+ ++VLC+ VE
Sbjct  23   NMGGPGVPGDVVGLVEEDLRKKAEGVVGKARSLCAANSVE-AVVDVVDGEPKHVLCDAVE  81

Query  360  KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            KHHA +LVVGS GYGAI+RA+LGSVSDYCAHHA C+V+IVK+P  K 
Sbjct  82   KHHADLLVVGSQGYGAIRRALLGSVSDYCAHHADCSVVIVKQPGSKN  128



>ref|XP_004160568.1| PREDICTED: LOW QUALITY PROTEIN: universal stress protein A-like 
protein-like [Cucumis sativus]
Length=168

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  225  DSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYG  404
            D DLK+ A R I+ A+EICASKSV D  FE+ EGDAR VLCE   KH AS+LVVGS  +G
Sbjct  72   DGDLKRKAERTIKNAREICASKSVCDVEFEVEEGDARYVLCEAAIKHRASVLVVGSRDHG  131

Query  405  AIKRAVLGSVSDYCAHHAHCTVMIVK  482
            AIKRA+LGSVSD+C H A CTVMIVK
Sbjct  132  AIKRALLGSVSDHCXHQAPCTVMIVK  157



>gb|EMT26129.1| Universal stress protein A-like protein [Aegilops tauschii]
Length=198

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 73/112 (65%), Gaps = 24/112 (21%)
 Frame = +3

Query  234  LKKIAARVIERAKEICASKSVDDP------------------------MFEIMEGDARNV  341
            L+K A  V++RA+ +C + SV                           + E+MEG+AR V
Sbjct  86   LRKRAEDVVDRARRLCVANSVTATTPARRIARSQRHFCNMPNKSQVHGLIEVMEGEARYV  145

Query  342  LCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            LC+ V+KHHA +LVVGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K
Sbjct  146  LCDAVDKHHADLLVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKSK  197



>ref|XP_003562469.1| PREDICTED: universal stress protein A-like protein [Brachypodium 
distachyon]
Length=175

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +3

Query  207  DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVV  386
            ++L +V++DL++ A  V+ERA+ +CA+ SV+  + E++EG+ R VLC  ++KH A +LVV
Sbjct  79   EVLRYVEADLRRRAEEVVERARRLCAASSVEG-VVEVVEGEPRIVLCNAIDKHRADMLVV  137

Query  387  GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            GSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PKH
Sbjct  138  GSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKH  173



>dbj|BAJ89788.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=236

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 84/107 (79%), Gaps = 4/107 (4%)
 Frame = +3

Query  189  NLAG---AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE  359
            N+ G   A D++  V++DL+K A  V+++A+ +CA+ SV   + ++++G+ ++VLC+ VE
Sbjct  131  NMGGPGVAGDVVGLVEADLRKKAEGVVDKARSLCAANSVQG-VVDVVDGEPKHVLCDAVE  189

Query  360  KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            KHHA +LVVGS GYGAI+RA+LGSVSDYCAHHA C+VMIVK+PK K 
Sbjct  190  KHHADLLVVGSQGYGAIRRALLGSVSDYCAHHADCSVMIVKQPKSKN  236



>ref|XP_008801103.1| PREDICTED: uncharacterized protein LOC103715297 isoform X1 [Phoenix 
dactylifera]
Length=225

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 2/81 (2%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP VD+DL+K AAR++E+A+E C +KSV   +FE++EGDARNVLCE VEKHHA +
Sbjct  107  GAADVLPFVDADLRKSAARIVEKARENCVAKSVSA-LFEVVEGDARNVLCEAVEKHHADM  165

Query  378  LVVGSHGYGAIKRAVLGSVSD  440
            LVVG+HGYGAIKR  LG V D
Sbjct  166  LVVGNHGYGAIKRR-LGVVKD  185



>gb|EMS51704.1| Universal stress protein A-like protein [Triticum urartu]
Length=188

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 79/107 (74%), Gaps = 4/107 (4%)
 Frame = +3

Query  189  NLAGAA---DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE  359
            N+ G     D++  V+ DL+K A  V+ +A+ +CA+ SV+  + ++++G+ ++VLC+ VE
Sbjct  83   NMGGPGVPGDVVGLVEEDLRKKAEGVVGKARSLCAANSVE-AVVDVVDGEPKHVLCDAVE  141

Query  360  KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
             H A +LVVGS GYGAI+RA+LGSVSDYCAHHA C+V+IVK+P  K 
Sbjct  142  NHRADLLVVGSQGYGAIRRALLGSVSDYCAHHADCSVVIVKQPGSKN  188



>tpg|DAA53433.1| TPA: hypothetical protein ZEAMMB73_383574 [Zea mays]
Length=162

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA + + HVD+ L+K A  V+ RA+ +CA+ S    + E++EG+ R VLC   EKH A +
Sbjct  62   GAGEAIRHVDAGLRKTAEAVVARARRVCAAASSARALVEVVEGEPRTVLCSAAEKHRADL  121

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            LV+GSHGYGA+KRA+LGSVSDYCAHHAHC+VMIVK+P
Sbjct  122  LVLGSHGYGAVKRALLGSVSDYCAHHAHCSVMIVKQP  158



>ref|XP_007132573.1| hypothetical protein PHAVU_011G106200g [Phaseolus vulgaris]
 gb|ESW04567.1| hypothetical protein PHAVU_011G106200g [Phaseolus vulgaris]
Length=147

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +3

Query  255  VIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSV  434
            V++   +  A+K V D   E++EGD RNVLC  VEK+HA+ILVVGSHG GA+KR VLGSV
Sbjct  67   VLDLGFQKTATK-VHDAALEVVEGDPRNVLCMAVEKYHAAILVVGSHGRGALKRVVLGSV  125

Query  435  SDYCAHHAHCTVMIVKKPKHK  497
            SD+CAHHA+CTVMIVKKPK K
Sbjct  126  SDFCAHHANCTVMIVKKPKIK  146



>ref|XP_008789878.1| PREDICTED: uncharacterized protein LOC103707246 isoform X2 [Phoenix 
dactylifera]
Length=150

 Score =   105 bits (263),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GA D+LP VD+DL+K AARV+E+A+E+C +KS+  P+ E++EGDAR VLCE VEKHHA +
Sbjct  70   GAVDVLPFVDADLRKSAARVVEKAREVCEAKSLS-PLVEVVEGDARYVLCEAVEKHHADM  128

Query  378  LVVGSHGYGAIKRAV  422
            LV+GSHGYGAIK A+
Sbjct  129  LVLGSHGYGAIKSAI  143



>ref|XP_004962796.1| PREDICTED: uncharacterized protein LOC101782520 isoform X1 [Setaria 
italica]
Length=181

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 2/79 (3%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP V++DLK+ A RVIE+AKE+CA   V D  +E MEGDARNVLC+ VE+HHA +
Sbjct  71   GAADVLPFVEADLKRTALRVIEKAKELCAQ--VADAEYEAMEGDARNVLCDAVERHHAEM  128

Query  378  LVVGSHGYGAIKRAVLGSV  434
            LVVGSHGYGAIKR+   S 
Sbjct  129  LVVGSHGYGAIKRSCSAST  147



>ref|XP_008661990.1| PREDICTED: fiber protein Fb19 isoform X1 [Zea mays]
Length=192

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 69/97 (71%), Gaps = 9/97 (9%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            GAAD+LP+V++DLK+ A RV+E+AK +C   S  D +FE +EGDARNVLCE VE+H A +
Sbjct  72   GAADVLPYVEADLKRSALRVVEKAKGLCTQAS--DAVFEALEGDARNVLCEAVERHGAEM  129

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            LVVGSHGYGAIKR+V   ++       HC   ++  P
Sbjct  130  LVVGSHGYGAIKRSVPSDLT-------HCLFSLLFSP  159



>gb|ABR17632.1| unknown [Picea sitchensis]
Length=164

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = +3

Query  207  DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVV  386
            D+L   ++D+KK   +++ RA EIC +K++  P  E+  GDAR V+C   +K+++ ILV+
Sbjct  67   DVLKIFENDIKKSTEKILARATEICKAKNLT-PETEVHTGDAREVICNAAKKYNSDILVL  125

Query  387  GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
            GSHGYGA+KR VLGSVSDYC HH  C V++VK  + K
Sbjct  126  GSHGYGALKRVVLGSVSDYCVHHVQCPVVVVKPRESK  162



>gb|AID16048.1| putative universal stress protein, partial [Catharanthus roseus]
Length=103

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
            G+ +I+P V++DLK+ A +V+++A+E+C  KS+ D  FE +EGDARNVLC+ VEKH AS+
Sbjct  28   GSTEIMPLVEADLKRSAEKVLDKARELCKKKSLTDAAFETIEGDARNVLCDAVEKHKASL  87

Query  378  LVVGSHGYGAIKRAVL  425
            LV+GSHGY A KR  L
Sbjct  88   LVLGSHGYTAFKRYCL  103



>gb|AAM66054.1| ethylene-responsive protein, putative [Arabidopsis thaliana]
Length=199

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
             ++ ++  V    ++ +A ++ RA ++C +K +      ++EG+A+ ++CE VEK H  +
Sbjct  99   ASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETL-VLEGEAKEMICEAVEKMHVDL  157

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LVVGS G G IKRA LGSVSDYCAHHA+C ++IVK PK  T
Sbjct  158  LVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKPPKEMT  198



>ref|NP_001030675.1| universal stress protein-like protein [Arabidopsis thaliana]
 gb|AEE75122.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=201

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
             ++ ++  V    ++ +A ++ RA ++C +K +      ++EG+A+ ++CE VEK H  +
Sbjct  101  ASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETL-VLEGEAKEMICEAVEKMHVDL  159

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LVVGS G G IKRA LGSVSDYCAHHA+C ++IVK PK  T
Sbjct  160  LVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKPPKEMT  200



>ref|NP_566406.1| universal stress protein-like protein [Arabidopsis thaliana]
 gb|AEE75119.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=199

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
             ++ ++  V    ++ +A ++ RA ++C +K +      ++EG+A+ ++CE VEK H  +
Sbjct  99   ASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETL-VLEGEAKEMICEAVEKMHVDL  157

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LVVGS G G IKRA LGSVSDYCAHHA+C ++IVK PK  T
Sbjct  158  LVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKPPKEMT  198



>ref|NP_850562.1| universal stress protein-like protein [Arabidopsis thaliana]
 gb|AAF23209.1|AC016795_22 unknown protein [Arabidopsis thaliana]
 gb|AAK49598.1|AF372882_1 MEC18.3/MEC18.3 [Arabidopsis thaliana]
 gb|AAL16217.1|AF428448_1 At3g11930/MEC18.3 [Arabidopsis thaliana]
 dbj|BAB03102.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK91376.1| MEC18.3/MEC18.3 [Arabidopsis thaliana]
 gb|AAL15351.1| AT3g11930/MEC18.3 [Arabidopsis thaliana]
 gb|AEE75121.1| universal stress protein-like protein [Arabidopsis thaliana]
Length=200

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 68/101 (67%), Gaps = 1/101 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
             ++ ++  V    ++ +A ++ RA ++C +K +      ++EG+A+ ++CE VEK H  +
Sbjct  100  ASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETL-VLEGEAKEMICEAVEKMHVDL  158

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LVVGS G G IKRA LGSVSDYCAHHA+C ++IVK PK  T
Sbjct  159  LVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKPPKEMT  199



>ref|XP_002882756.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59015.1| universal stress protein family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=200

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = +3

Query  237  KKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKR  416
            ++ +A ++ RA ++C +K +      ++EGDA+ ++CE VE+ H  +LVVGS G G IKR
Sbjct  113  QETSAALLSRALQMCRAKQIRTETL-VLEGDAKEMICEAVEQMHVDLLVVGSRGLGKIKR  171

Query  417  AVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            A LGSVSDYCAHHA+C ++IVK PK  T
Sbjct  172  AFLGSVSDYCAHHANCPILIVKPPKEMT  199



>ref|XP_010681487.1| PREDICTED: uncharacterized protein LOC104896434 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=145

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            AAD++  +  + KK  A ++ +AKEICA   VD     +M G+ ++ +C+ V+K+H  +L
Sbjct  50   AADLMTSMQDNQKKFVASLLAKAKEICAKHGVDADTVSVM-GNPKDAICDAVQKYHCQLL  108

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            V+GSHG GA+ RA LGSVS+YC +HA C V++V++P
Sbjct  109  VLGSHGRGAVGRAFLGSVSNYCVNHAKCPVLVVRQP  144



>ref|XP_006841415.1| hypothetical protein AMTR_s00003p00027540 [Amborella trichopoda]
 gb|ERN03090.1| hypothetical protein AMTR_s00003p00027540 [Amborella trichopoda]
Length=155

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            ++DI+  +D   K +A  V+E+AK IC S S      ++  GDAR V+CE VEK    +L
Sbjct  58   SSDIMATMDKYSKDLAEAVLEKAKMICQSSSRVTVETKLGCGDAREVICEQVEKLGGDLL  117

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            V+GSHGYGA KRA LGSVS++CA++  C V+IVK+PK
Sbjct  118  VMGSHGYGAFKRAFLGSVSNHCANNTKCPVLIVKRPK  154



>ref|XP_004956771.1| PREDICTED: uncharacterized protein LOC101762096 isoform X1 [Setaria 
italica]
Length=187

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 3/81 (4%)
 Frame = +3

Query  189  NLAGAA---DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE  359
             LAG     D+   V++DLK+ A RV+++AKE+CA   V D  FE +EGDARNVLC+  E
Sbjct  62   GLAGTGALMDVRSFVEADLKRAARRVLDKAKELCAQVQVADVEFEALEGDARNVLCDAAE  121

Query  360  KHHASILVVGSHGYGAIKRAV  422
            +HHA +LVVGSHGYGAIKR+V
Sbjct  122  RHHAEMLVVGSHGYGAIKRSV  142



>ref|XP_010259333.1| PREDICTED: universal stress protein A-like protein [Nelumbo nucifera]
Length=161

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            A+D++  ++   + +A  V+ERA+ I  + S      ++  GDAR V+C TVEK  A +L
Sbjct  64   ASDVIATMEKYSRDLADSVMERAEAIFKNHSNIKVEKKVGSGDAREVICMTVEKFGADLL  123

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            V+GSHGYG  KR VLGSVSDYCA HA C V+IVK+PK+
Sbjct  124  VMGSHGYGFFKRTVLGSVSDYCAKHAKCPVLIVKRPKN  161



>ref|XP_008781086.1| PREDICTED: universal stress protein A-like protein [Phoenix dactylifera]
Length=167

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +3

Query  207  DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVV  386
            ++   +D   K +A  V ERA+ IC   S      ++  GDAR+V+CE V+K  A +LV+
Sbjct  72   EVTASMDKYSKDLAVSVTERAQNICKGYSNIKAEVKVSVGDARDVICEMVQKLGADLLVM  131

Query  387  GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            GSHGYG IKRA LGSVSDYCA +A C ++IVK+P +
Sbjct  132  GSHGYGFIKRAFLGSVSDYCARNAKCPILIVKRPTN  167



>ref|XP_002319486.1| hypothetical protein POPTR_0013s01110g [Populus trichocarpa]
 gb|EEE95409.1| hypothetical protein POPTR_0013s01110g [Populus trichocarpa]
Length=171

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 70/101 (69%), Gaps = 1/101 (1%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIME-GDARNVLCETVEKHHASI  377
            ++DI+  +      IA  VIE+AK +C  +  D  +  I+E GDAR+++C+T EK HA +
Sbjct  68   SSDIMATMQKYSNDIADCVIEKAKRMCREQVQDVKVETIIEHGDARDLICQTAEKLHADM  127

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            LV+GSHGYG IKRA LGSVS++CA +  C V+IVK+PK  +
Sbjct  128  LVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVKRPKSNS  168



>ref|XP_009593918.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Nicotiana tomentosiformis]
Length=111

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +3

Query  246  AARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVL  425
            AAR++ RA E+C  K V      I+EGD +N+LCE  EK +  +L VGS G G IKRA L
Sbjct  26   AARILARASEMCKDKMVKAETL-ILEGDPKNMLCEATEKMNIDLLAVGSRGLGQIKRAFL  84

Query  426  GSVSDYCAHHAHCTVMIVKKPKH  494
            GSVSDYCAHHA C ++IVK  K 
Sbjct  85   GSVSDYCAHHAKCPMLIVKPTKE  107



>ref|XP_010264179.1| PREDICTED: universal stress protein A-like protein [Nelumbo nucifera]
Length=159

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 65/85 (76%), Gaps = 3/85 (4%)
 Frame = +3

Query  237  KKIAARVIERAKEICASKSVD-DPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIK  413
            +K++A ++E+AKEICA++ V  + + EI  GD +  +CE VEK + S+LV+GSHG G IK
Sbjct  76   EKLSAALLEKAKEICAARGVTAETISEI--GDPKEAICEAVEKFNISLLVLGSHGRGVIK  133

Query  414  RAVLGSVSDYCAHHAHCTVMIVKKP  488
            RAVLGSVS YC H A C+V++VKKP
Sbjct  134  RAVLGSVSSYCVHSAKCSVLVVKKP  158



>ref|XP_010681486.1| PREDICTED: universal stress protein A-like protein isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=160

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +3

Query  204  ADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV  383
            AD++  +  + KK  A ++ +AKEICA   VD     +M G+ ++ +C+ V+K+H  +LV
Sbjct  66   ADLMTSMQDNQKKFVASLLAKAKEICAKHGVDADTVSVM-GNPKDAICDAVQKYHCQLLV  124

Query  384  VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            +GSHG GA+ RA LGSVS+YC +HA C V++V++P
Sbjct  125  LGSHGRGAVGRAFLGSVSNYCVNHAKCPVLVVRQP  159



>ref|XP_007031134.1| USP-like protein isoform 3 [Theobroma cacao]
 gb|EOY11636.1| USP-like protein isoform 3 [Theobroma cacao]
Length=166

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            +ADIL  ++     +AA VIE+AK +C  ++ D+    +  GD R+V+C+  EK +A +L
Sbjct  64   SADILATMEKYSNDVAACVIEKAKRMCREQA-DEVEVRVESGDPRDVICQVAEKINADVL  122

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            V+GSHGYG IKRA LGSVS++CA +  C V+IVKKPK
Sbjct  123  VMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVKKPK  159



>ref|XP_009593917.1| PREDICTED: uncharacterized protein LOC104090515 isoform X1 [Nicotiana 
tomentosiformis]
Length=155

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +3

Query  246  AARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVL  425
            AAR++ RA E+C  K V      I+EGD +N+LCE  EK +  +L VGS G G IKRA L
Sbjct  70   AARILARASEMCKDKMVKAETL-ILEGDPKNMLCEATEKMNIDLLAVGSRGLGQIKRAFL  128

Query  426  GSVSDYCAHHAHCTVMIVKKPKH  494
            GSVSDYCAHHA C ++IVK  K 
Sbjct  129  GSVSDYCAHHAKCPMLIVKPTKE  151



>gb|KDO76973.1| hypothetical protein CISIN_1g031713mg [Citrus sinensis]
Length=154

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 65/99 (66%), Gaps = 3/99 (3%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSV-DDPMFEIMEGDARNVLCETVEKHHA  371
            A   D+L  +  + KK A  ++ RAKEICA   V  + M E+  GD +NV+CE  EKH  
Sbjct  56   AAPPDLLMSIQENQKKAALALLGRAKEICAKHGVVAETMTEM--GDPKNVICEAAEKHKI  113

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
             +L+VGSH  G I+RA LGSVS+YC H+A C V++V+KP
Sbjct  114  QLLIVGSHSRGPIQRAFLGSVSNYCVHNAKCPVLVVRKP  152



>ref|XP_010464931.1| PREDICTED: universal stress protein A-like protein isoform X5 
[Camelina sativa]
Length=168

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            ++ ++  V    ++ +A ++ RA +IC +K +      ++EG+A+ ++CE VEK H  +L
Sbjct  68   SSTMIESVKKAQQETSAALLSRALQICRAKQIRTETL-VLEGEAKEMICEAVEKMHVDLL  126

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            +VGS G G IKRA +GSVSDYCAHHA+C ++IVK PK
Sbjct  127  IVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKPPK  163



>ref|XP_007031133.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY11635.1| Adenine nucleotide alpha hydrolases-like superfamily protein 
isoform 2 [Theobroma cacao]
Length=173

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            +ADIL  ++     +AA VIE+AK +C  ++ D+    +  GD R+V+C+  EK +A +L
Sbjct  71   SADILATMEKYSNDVAACVIEKAKRMCREQA-DEVEVRVESGDPRDVICQVAEKINADVL  129

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            V+GSHGYG IKRA LGSVS++CA +  C V+IVKKPK
Sbjct  130  VMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVKKPK  166



>ref|XP_010464930.1| PREDICTED: universal stress protein A-like protein isoform X4 
[Camelina sativa]
Length=169

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            ++ ++  V    ++ +A ++ RA +IC +K +      ++EG+A+ ++CE VEK H  +L
Sbjct  69   SSTMIESVKKAQQETSAALLSRALQICRAKQIRTETL-VLEGEAKEMICEAVEKMHVDLL  127

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            +VGS G G IKRA +GSVSDYCAHHA+C ++IVK PK
Sbjct  128  IVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKPPK  164



>ref|XP_010464927.1| PREDICTED: uncharacterized protein LOC104745401 isoform X1 [Camelina 
sativa]
 ref|XP_010464929.1| PREDICTED: uncharacterized protein LOC104745401 isoform X3 [Camelina 
sativa]
Length=206

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            ++ ++  V    ++ +A ++ RA +IC +K +      ++EG+A+ ++CE VEK H  +L
Sbjct  106  SSTMIESVKKAQQETSAALLSRALQICRAKQIRTETL-VLEGEAKEMICEAVEKMHVDLL  164

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            +VGS G G IKRA +GSVSDYCAHHA+C ++IVK PK 
Sbjct  165  IVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKPPKE  202



>ref|XP_006407394.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
 gb|ESQ48847.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
Length=194

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
             ++ ++  V    +K +A ++ RA ++C +K +      ++EGDA++++C+ VE+ H  +
Sbjct  95   ASSSMIEAVKKSQQKASAALLSRALQMCRAKQIRTETL-VLEGDAKDMICQAVEQMHVDL  153

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            L VGS G G IKRA LGSVSDYCAHHA C ++IVK PK
Sbjct  154  LAVGSRGLGKIKRAFLGSVSDYCAHHAKCPILIVKPPK  191



>ref|XP_006407393.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
 gb|ESQ48846.1| hypothetical protein EUTSA_v10021565mg [Eutrema salsugineum]
Length=193

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +3

Query  198  GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI  377
             ++ ++  V    +K +A ++ RA ++C +K +      ++EGDA++++C+ VE+ H  +
Sbjct  94   ASSSMIEAVKKSQQKASAALLSRALQMCRAKQIRTETL-VLEGDAKDMICQAVEQMHVDL  152

Query  378  LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            L VGS G G IKRA LGSVSDYCAHHA C ++IVK PK
Sbjct  153  LAVGSRGLGKIKRAFLGSVSDYCAHHAKCPILIVKPPK  190



>ref|XP_010464928.1| PREDICTED: universal stress protein A-like protein isoform X2 
[Camelina sativa]
Length=185

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL  380
            ++ ++  V    ++ +A ++ RA +IC +K +      ++EG+A+ ++CE VEK H  +L
Sbjct  85   SSTMIESVKKAQQETSAALLSRALQICRAKQIRTETL-VLEGEAKEMICEAVEKMHVDLL  143

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK  491
            +VGS G G IKRA +GSVSDYCAHHA+C ++IVK PK
Sbjct  144  IVGSRGLGKIKRAFIGSVSDYCAHHANCPILIVKPPK  180



>ref|XP_011007726.1| PREDICTED: universal stress protein A-like protein [Populus euphratica]
Length=161

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 68/96 (71%), Gaps = 3/96 (3%)
 Frame = +3

Query  204  ADILPHVDSDLKKIAARVIERAKEICASKSVD-DPMFEIMEGDARNVLCETVEKHHASIL  380
            AD++  +  + KKIA  ++++AK+ICA   VD + M EI  GD +  +CE VEK +  +L
Sbjct  66   ADLVASIQENRKKIALMLLDKAKDICARHGVDVEIMTEI--GDPKEAICEAVEKLNIQLL  123

Query  381  VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            V+GSHG G ++RA LGSVS+YC H+A C V++VKKP
Sbjct  124  VLGSHGRGPVQRAFLGSVSNYCVHNAKCPVLVVKKP  159



>gb|KJB45407.1| hypothetical protein B456_007G304500 [Gossypium raimondii]
Length=167

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 70/102 (69%), Gaps = 2/102 (2%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIM--EGDARNVLCETVEKHHAS  374
            + D+L  +D     +A+ +IE+AK++C  +  ++   E++   GD R+V+C+  +K HA 
Sbjct  60   SPDMLASIDKCRNDLASSIIEKAKKMCREQGDNEVKVEVIIETGDPRDVICQAADKIHAD  119

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            +LV+GSHGYG IKRA LGSVS++CA +  C V+IVKKPK  +
Sbjct  120  VLVMGSHGYGLIKRAFLGSVSNHCAQNVKCPVLIVKKPKSSS  161



>ref|XP_011094181.1| PREDICTED: uncharacterized protein C167.05-like [Sesamum indicum]
Length=178

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +3

Query  246  AARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVL  425
            AAR++ RA EIC  K   +    I+EGD ++ +C  VE+   ++LVVGS G G IKRA L
Sbjct  93   AARILSRAFEICRDKLSLNAKTLILEGDPKDKICRAVEEMDINLLVVGSRGLGQIKRAFL  152

Query  426  GSVSDYCAHHAHCTVMIVKKPKHKT  500
            GSVSDYCAHHA C V++VK P+ +T
Sbjct  153  GSVSDYCAHHAKCPVLVVKPPRKRT  177



>gb|ABK21527.1| unknown [Picea sitchensis]
Length=177

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 63/85 (74%), Gaps = 3/85 (4%)
 Frame = +3

Query  237  KKIAARVIERAKEICASKSVDDPMFEIME-GDARNVLCETVEKHHASILVVGSHGYGAIK  413
            KKI+  ++ RAKEICA K+V+  +  +ME GD +  +C+ VEK    +L++GSHGYG +K
Sbjct  94   KKISEALLGRAKEICAQKNVNAKI--VMEIGDPKEAICDAVEKMKVDLLIIGSHGYGMVK  151

Query  414  RAVLGSVSDYCAHHAHCTVMIVKKP  488
            RA+LGSVS+YC  HA C V++V+KP
Sbjct  152  RALLGSVSNYCVQHAKCPVLVVRKP  176



>gb|KHG27977.1| hypothetical protein F383_14126 [Gossypium arboreum]
Length=161

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 71/102 (70%), Gaps = 3/102 (3%)
 Frame = +3

Query  195  AGAADILPHVDSDLKKIAARVIERAKEICASKSVD-DPMFEIMEGDARNVLCETVEKHHA  371
            A   D++  V  + KK+A  ++E+AK ICA++ V+ + M E+  GD +  +CE VEK + 
Sbjct  61   APPVDLINTVQENQKKLALALLEKAKGICANRGVNAETMTEV--GDPKEKICEAVEKLNI  118

Query  372  SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK  497
             +L++GSHG GAI+RA LGSVS++C H+A C V++V+KP  K
Sbjct  119  ELLILGSHGRGAIQRAFLGSVSNHCVHNAKCPVLVVRKPDWK  160



>ref|XP_009795288.1| PREDICTED: uncharacterized protein LOC104242017 [Nicotiana sylvestris]
Length=227

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 4/92 (4%)
 Frame = +3

Query  246  AARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVL  425
            AAR++ RA E+C  K +      I+EGD +N+LCE  EK +  +L VGS G G IKRA L
Sbjct  138  AARILARASEMCKDKMIKAETL-ILEGDPKNILCEATEKMNIDLLAVGSRGLGQIKRAFL  196

Query  426  GSVSDYCAHHAHCTVMIVKKPKHKT*LVADII  521
            GSVSDYCAHHA C ++IVK  K+   LV +++
Sbjct  197  GSVSDYCAHHAKCPLLIVKPTKN---LVQEVV  225



>gb|KHG14939.1| hypothetical protein F383_18523 [Gossypium arboreum]
Length=171

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = +3

Query  201  AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIM--EGDARNVLCETVEKHHAS  374
            +AD+L  VD     +A  +IE+AK +C  K  D+   E++   GD R+V+C   E  +A 
Sbjct  64   SADVLATVDKYSNDVANCIIEKAKRMCREKGDDEVKVEVIIESGDPRDVICRVAENINAD  123

Query  375  ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT  500
            +LV+GSHGYG I+RA LGSVS++CA +  C V+IVKKPK  +
Sbjct  124  VLVMGSHGYGLIQRAFLGSVSNHCAQNVKCPVLIVKKPKSSS  165



>ref|XP_010938295.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=170

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +3

Query  207  DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVV  386
            +++  +D   K +A  +I+RAK IC   S       +  GDAR+V+CE V+K  A +LV+
Sbjct  75   EVIASMDRYSKVLADSIIQRAKNICLDYSNIKVEATVSAGDARDVICEMVQKLGAELLVM  134

Query  387  GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH  494
            GSHGYG IKR +LGSVSDYC+ +A C V+IVK+P +
Sbjct  135  GSHGYGFIKRTLLGSVSDYCSRNAKCPVLIVKRPAN  170



>ref|XP_010921510.1| PREDICTED: universal stress protein A-like protein [Elaeis guineensis]
Length=167

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +3

Query  207  DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVV  386
            ++   +D   K +A  V+ERA+ IC   S      ++  GDAR+V+CE  +K  A +LV+
Sbjct  72   EVTASIDKYSKDLAVSVMERARNICKDYSNMKVEEKVCVGDARDVICEMAQKLGADLLVM  131

Query  387  GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP  488
            GSHGYG IKRA LGSVSDYCA +A C V+IVK+P
Sbjct  132  GSHGYGFIKRAFLGSVSDYCARNAKCPVLIVKRP  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520