BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN044F20

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006445107.1|  hypothetical protein CICLE_v10023111mg             136   1e-37   Citrus clementina [clementine]
ref|XP_004150067.1|  PREDICTED: uncharacterized protein LOC101205849    135   2e-37   Cucumis sativus [cucumbers]
ref|XP_008337927.1|  PREDICTED: uncharacterized protein LOC103400976    134   5e-37   
ref|XP_007220499.1|  hypothetical protein PRUPE_ppa014128mg             134   5e-37   Prunus persica
ref|XP_009343525.1|  PREDICTED: uncharacterized protein LOC103935481    134   6e-37   Pyrus x bretschneideri [bai li]
ref|XP_007139908.1|  hypothetical protein PHAVU_008G068800g             134   9e-37   Phaseolus vulgaris [French bean]
ref|XP_008460976.1|  PREDICTED: uncharacterized protein LOC103499701    133   1e-36   Cucumis melo [Oriental melon]
ref|XP_010107604.1|  hypothetical protein L484_006549                   133   1e-36   Morus notabilis
ref|XP_002262805.1|  PREDICTED: uncharacterized protein LOC100258376    132   2e-36   Vitis vinifera
emb|CBI40290.3|  unnamed protein product                                135   2e-36   Vitis vinifera
ref|XP_004234385.1|  PREDICTED: uncharacterized protein LOC101248174    132   2e-36   Solanum lycopersicum
dbj|BAJ89894.1|  predicted protein                                      132   4e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN83614.1|  hypothetical protein VITISV_007756                     132   4e-36   Vitis vinifera
ref|XP_010255458.1|  PREDICTED: uncharacterized protein LOC104596128    131   5e-36   Nelumbo nucifera [Indian lotus]
ref|XP_003578644.1|  PREDICTED: uncharacterized protein LOC100843307    131   7e-36   Brachypodium distachyon [annual false brome]
ref|XP_002462833.1|  hypothetical protein SORBIDRAFT_02g032740          131   8e-36   Sorghum bicolor [broomcorn]
ref|XP_003552372.1|  PREDICTED: uncharacterized protein LOC100795291    131   9e-36   Glycine max [soybeans]
ref|XP_008793662.1|  PREDICTED: uncharacterized protein LOC103709911    131   1e-35   Phoenix dactylifera
gb|EPS61470.1|  hypothetical protein M569_13329                         130   1e-35   Genlisea aurea
ref|XP_009595665.1|  PREDICTED: uncharacterized protein LOC104091925    130   1e-35   Nicotiana tomentosiformis
gb|ABK96487.1|  unknown                                                 130   1e-35   Populus trichocarpa x Populus deltoides
ref|XP_010921950.1|  PREDICTED: uncharacterized protein LOC105045386    130   1e-35   Elaeis guineensis
ref|XP_004957636.1|  PREDICTED: uncharacterized protein LOC101772363    130   1e-35   Setaria italica
ref|NP_001063925.1|  Os09g0560300                                       130   1e-35   
ref|XP_011035729.1|  PREDICTED: uncharacterized protein LOC105133426    130   1e-35   Populus euphratica
ref|NP_001237813.1|  uncharacterized protein LOC100306629               130   2e-35   Glycine max [soybeans]
ref|XP_010931938.1|  PREDICTED: uncharacterized protein LOC105052715    130   2e-35   Elaeis guineensis
ref|XP_002511818.1|  conserved hypothetical protein                     130   2e-35   
ref|XP_011076191.1|  PREDICTED: uncharacterized protein LOC105160492    130   3e-35   Sesamum indicum [beniseed]
gb|KDP28666.1|  hypothetical protein JCGZ_14437                         129   3e-35   Jatropha curcas
gb|EYU25080.1|  hypothetical protein MIMGU_mgv1a017303mg                129   6e-35   Erythranthe guttata [common monkey flower]
ref|XP_007051891.1|  Uncharacterized protein TCM_005394                 129   7e-35   Theobroma cacao [chocolate]
gb|ABK93749.1|  unknown                                                 129   8e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011023390.1|  PREDICTED: uncharacterized protein LOC105124901    128   2e-34   Populus euphratica
ref|XP_010055187.1|  PREDICTED: uncharacterized protein LOC104443472    127   2e-34   
gb|KHG20156.1|  hypothetical protein F383_08358                         127   3e-34   Gossypium arboreum [tree cotton]
ref|XP_009418791.1|  PREDICTED: uncharacterized protein LOC103998908    127   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB24676.1|  hypothetical protein B456_004G156900                    127   4e-34   Gossypium raimondii
ref|XP_008670378.1|  PREDICTED: uncharacterized protein LOC100275447    126   5e-34   Zea mays [maize]
ref|XP_006396258.1|  hypothetical protein EUTSA_v10029049mg             128   6e-34   
ref|XP_004306815.1|  PREDICTED: uncharacterized protein LOC101311609    125   1e-33   Fragaria vesca subsp. vesca
ref|XP_006411842.1|  hypothetical protein EUTSA_v10026679mg             125   1e-33   Eutrema salsugineum [saltwater cress]
ref|XP_009111473.1|  PREDICTED: uncharacterized protein LOC103836910    125   2e-33   Brassica rapa
ref|XP_003623880.1|  hypothetical protein MTR_7g076630                  125   2e-33   Medicago truncatula
gb|ACG37342.1|  hypothetical protein                                    124   3e-33   Zea mays [maize]
ref|XP_009138535.1|  PREDICTED: uncharacterized protein LOC103862588    124   3e-33   Brassica rapa
emb|CDX74341.1|  BnaA03g27060D                                          124   3e-33   
emb|CDY51150.1|  BnaA09g51850D                                          124   3e-33   Brassica napus [oilseed rape]
ref|XP_004492703.1|  PREDICTED: uncharacterized protein LOC101495413    124   3e-33   Cicer arietinum [garbanzo]
ref|XP_009134541.1|  PREDICTED: uncharacterized protein LOC103858862    124   3e-33   Brassica rapa
emb|CDY31618.1|  BnaA03g54340D                                          124   4e-33   Brassica napus [oilseed rape]
ref|XP_009412459.1|  PREDICTED: uncharacterized protein LOC103993943    124   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX72659.1|  BnaC07g46810D                                          126   4e-33   
ref|NP_567180.1|  uncharacterized protein                               124   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010671874.1|  PREDICTED: uncharacterized protein LOC104888549    123   7e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM63027.1|  unknown                                                 123   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419607.1|  PREDICTED: uncharacterized protein LOC104705321    122   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010427229.1|  PREDICTED: uncharacterized protein LOC104712104    122   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010544378.1|  PREDICTED: uncharacterized protein LOC104817018    121   4e-32   Tarenaya hassleriana [spider flower]
gb|KCW71666.1|  hypothetical protein EUGRSUZ_E00186                     121   5e-32   Eucalyptus grandis [rose gum]
emb|CBI31783.3|  unnamed protein product                                120   8e-32   Vitis vinifera
ref|XP_006289505.1|  hypothetical protein CARUB_v10003039mg             120   1e-31   Capsella rubella
ref|XP_002872939.1|  hypothetical protein ARALYDRAFT_490509             120   1e-31   
emb|CDX91903.1|  BnaC03g32050D                                          120   2e-31   
emb|CDP17713.1|  unnamed protein product                                116   1e-29   Coffea canephora [robusta coffee]
emb|CDP05217.1|  unnamed protein product                                111   2e-28   Coffea canephora [robusta coffee]
gb|ABK25770.1|  unknown                                                 102   2e-24   Picea sitchensis
ref|XP_001765323.1|  predicted protein                                98.6    3e-23   
ref|XP_002979230.1|  hypothetical protein SELMODRAFT_59905            86.7    9e-19   
ref|XP_010094846.1|  hypothetical protein L484_016428                 86.3    2e-18   
ref|XP_006843419.1|  hypothetical protein AMTR_s00053p00144400        85.9    3e-18   
gb|AFK44921.1|  unknown                                               85.9    6e-18   Lotus japonicus
gb|ACG27383.1|  hypothetical protein                                  84.0    7e-18   Zea mays [maize]
ref|XP_006853520.1|  hypothetical protein AMTR_s00032p00223370        84.3    1e-17   
tpg|DAA62558.1|  TPA: hypothetical protein ZEAMMB73_780886            84.7    1e-17   
ref|XP_006386595.1|  hypothetical protein POPTR_0002s15720g           82.8    3e-17   
ref|XP_006375328.1|  hypothetical protein POPTR_0014s07560g           83.2    3e-17   
emb|CDY07208.1|  BnaCnng02230D                                        82.8    1e-16   
ref|XP_006847395.1|  hypothetical protein AMTR_s00153p00026460        80.5    2e-16   
gb|KHN20177.1|  hypothetical protein glysoja_049547                   67.8    1e-11   Glycine soja [wild soybean]
ref|XP_002504370.1|  hypothetical protein MICPUN_113359               63.2    5e-10   Micromonas commoda
ref|XP_011073182.1|  PREDICTED: uncharacterized protein LOC105158...  61.6    6e-09   
gb|KIK12294.1|  hypothetical protein PISMIDRAFT_689606                59.7    9e-09   Pisolithus microcarpus 441
ref|XP_011098759.1|  PREDICTED: uncharacterized protein LOC105177...  60.8    9e-09   Sesamum indicum [beniseed]
gb|EPT01938.1|  hypothetical protein FOMPIDRAFT_1048229               59.3    2e-08   Fomitopsis pinicola FP-58527 SS1
gb|KDR77088.1|  hypothetical protein GALMADRAFT_428104                58.9    2e-08   Galerina marginata CBS 339.88
ref|XP_008045094.1|  hypothetical protein TRAVEDRAFT_136464           58.2    3e-08   Trametes versicolor FP-101664 SS1
emb|CBJ32950.1|  conserved unknown protein                            58.2    3e-08   Ectocarpus siliculosus
gb|KIO24099.1|  hypothetical protein M407DRAFT_244560                 57.8    4e-08   Tulasnella calospora MUT 4182
gb|KIR42473.1|  hypothetical protein I313_01698                       57.4    5e-08   Cryptococcus gattii VGII Ram5
gb|KGB75375.1|  hypothetical protein CNBG_1213                        57.4    6e-08   Cryptococcus gattii VGII R265
gb|KIJ64842.1|  hypothetical protein HYDPIDRAFT_89469                 57.0    8e-08   Hydnomerulius pinastri MD-312
gb|KIM57712.1|  hypothetical protein SCLCIDRAFT_1219229               56.6    1e-07   Scleroderma citrinum Foug A
ref|XP_007267255.1|  hypothetical protein FOMMEDRAFT_57277            56.2    1e-07   Fomitiporia mediterranea MF3/22
ref|XP_009550994.1|  hypothetical protein HETIRDRAFT_389067           55.8    2e-07   Heterobasidion irregulare TC 32-1
emb|CEL53244.1|  hypothetical protein RSOLAG1IB_06210                 55.5    3e-07   Rhizoctonia solani AG-1 IB
tpg|DAA62560.1|  TPA: hypothetical protein ZEAMMB73_780886            54.3    3e-07   
gb|AFR92845.2|  hypothetical protein CNAG_00715                       54.7    5e-07   Cryptococcus neoformans var. grubii H99
ref|XP_003307133.1|  hypothetical protein PGTG_00083                  54.3    9e-07   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_007367397.1|  hypothetical protein DICSQDRAFT_148244           53.5    1e-06   Dichomitus squalens LYAD-421 SS1
gb|EMS21057.1|  hypothetical protein RHTO_02315                       53.9    1e-06   Rhodotorula toruloides NP11
emb|CCJ28377.1|  unnamed protein product                              52.8    2e-06   Pneumocystis jirovecii
gb|ERZ97553.1|  hypothetical protein GLOINDRAFT_293150                53.1    2e-06   
ref|XP_007872417.1|  hypothetical protein PNEG_00529                  52.8    2e-06   Pneumocystis murina B123
ref|XP_007510314.1|  predicted protein                                52.8    3e-06   Bathycoccus prasinos
ref|XP_011073184.1|  PREDICTED: uncharacterized protein LOC105158...  53.9    3e-06   
gb|KDQ31463.1|  hypothetical protein PLEOSDRAFT_1088781               52.4    3e-06   Pleurotus ostreatus PC15
gb|KIK82026.1|  hypothetical protein PAXRUDRAFT_832452                52.0    4e-06   Paxillus rubicundulus Ve08.2h10
ref|XP_011098765.1|  PREDICTED: uncharacterized protein LOC105177...  53.1    5e-06   Sesamum indicum [beniseed]
gb|KIK33832.1|  hypothetical protein CY34DRAFT_26975                  52.0    5e-06   Suillus luteus UH-Slu-Lm8-n1
ref|XP_007350412.1|  hypothetical protein AURDEDRAFT_68632            51.6    5e-06   
gb|KDQ09204.1|  hypothetical protein BOTBODRAFT_37286                 51.2    9e-06   Botryobasidium botryosum FD-172 SS1
emb|CDH60104.1|  hypothetical protein RO3G_15305                      50.8    1e-05   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005535435.1|  hypothetical protein CYME_CMD068C                50.8    1e-05   Cyanidioschyzon merolae strain 10D
emb|CCF52708.1|  uncharacterized protein UHOR_04863                   50.1    2e-05   Ustilago hordei
gb|KDQ56755.1|  hypothetical protein JAAARDRAFT_300579                50.1    2e-05   Jaapia argillacea MUCL 33604
gb|ETS61972.1|  hypothetical protein PaG_03522                        50.1    2e-05   Moesziomyces aphidis DSM 70725
gb|EJU01368.1|  hypothetical protein DACRYDRAFT_107922                51.2    2e-05   Dacryopinax primogenitus
ref|XP_006457761.1|  hypothetical protein AGABI2DRAFT_133629          50.1    3e-05   Agaricus bisporus var. bisporus H97
emb|CDS13108.1|  hypothetical protein LRAMOSA05291                    50.1    3e-05   Lichtheimia ramosa
ref|XP_003064826.1|  predicted protein                                49.7    3e-05   Micromonas pusilla CCMP1545
gb|KFH65611.1|  hypothetical protein MVEG_09087                       49.3    4e-05   Mortierella verticillata NRRL 6337
ref|XP_001840527.2|  hypothetical protein CC1G_07257                  50.1    4e-05   Coprinopsis cinerea okayama7#130
gb|KII91964.1|  hypothetical protein PLICRDRAFT_173745                49.3    4e-05   Plicaturopsis crispa FD-325 SS-3
emb|CEF99325.1|  unnamed product                                      49.3    4e-05   Ostreococcus tauri
gb|KII85719.1|  hypothetical protein PLICRDRAFT_178751                49.7    4e-05   Plicaturopsis crispa FD-325 SS-3
gb|KIJ28564.1|  hypothetical protein M422DRAFT_235617                 49.3    5e-05   Sphaerobolus stellatus SS14
emb|CDI53939.1|  conserved hypothetical protein                       49.3    5e-05   Melanopsichium pennsylvanicum 4
gb|EST05386.1|  hypothetical protein PSEUBRA_SCAF6g00927              48.9    7e-05   Kalmanozyma brasiliensis GHG001
ref|XP_007379548.1|  hypothetical protein PUNSTDRAFT_81119            48.5    7e-05   Punctularia strigosozonata HHB-11173 SS5
dbj|GAC75901.1|  hypothetical protein PANT_19d00008                   49.7    7e-05   Moesziomyces antarcticus T-34
emb|CBQ73509.1|  conserved hypothetical protein                       48.5    7e-05   Sporisorium reilianum SRZ2
ref|XP_002297069.1|  predicted protein                                48.5    8e-05   Thalassiosira pseudonana CCMP1335
ref|XP_007303281.1|  hypothetical protein STEHIDRAFT_78104            48.1    1e-04   Stereum hirsutum FP-91666 SS1
dbj|GAK68423.1|  conserved hypothetical protein                       49.3    1e-04   Moesziomyces antarcticus
gb|EIE90594.1|  hypothetical protein RO3G_15305                       48.1    1e-04   Rhizopus delemar RA 99-880
ref|XP_011389522.1|  hypothetical protein UMAG_10628                  48.1    1e-04   Ustilago maydis 521
ref|XP_007394963.1|  hypothetical protein PHACADRAFT_194711           48.5    1e-04   Phanerochaete carnosa HHB-10118-sp
gb|EMT09414.1|  hypothetical protein F775_00254                       49.7    1e-04   
gb|KIK56364.1|  hypothetical protein GYMLUDRAFT_47140                 47.8    1e-04   Gymnopus luxurians FD-317 M1
emb|CEG65756.1|  hypothetical protein RMATCC62417_02471               47.8    2e-04   Rhizopus microsporus
emb|CEG79291.1|  hypothetical protein RMATCC62417_13776               47.4    2e-04   Rhizopus microsporus
ref|XP_007878647.1|  hypothetical protein PFL1_02944                  47.0    3e-04   Anthracocystis flocculosa PF-1
emb|CEP16694.1|  hypothetical protein                                 46.2    6e-04   Parasitella parasitica
ref|XP_006957094.1|  hypothetical protein WALSEDRAFT_59753            46.2    6e-04   Wallemia mellicola CBS 633.66
emb|CCG84559.1|  protein of unknown function                          45.8    7e-04   Taphrina deformans PYCC 5710



>ref|XP_006445107.1| hypothetical protein CICLE_v10023111mg [Citrus clementina]
 ref|XP_006491045.1| PREDICTED: uncharacterized protein LOC102609155 [Citrus sinensis]
 gb|ESR58347.1| hypothetical protein CICLE_v10023111mg [Citrus clementina]
 gb|KDO86063.1| hypothetical protein CISIN_1g034746mg [Citrus sinensis]
 gb|KDO86064.1| hypothetical protein CISIN_1g034746mg [Citrus sinensis]
Length=85

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M GGPNCRP HWKRNTAIAMAGI LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  17   FRAKVWSMPGGPNCRPKHWKRNTAIAMAGIFLICIPIAMKSAELEQRPHHPVRPIPSQLW  76

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  77   CKNFGTKDY  85



>ref|XP_004150067.1| PREDICTED: uncharacterized protein LOC101205849 [Cucumis sativus]
 ref|XP_004165121.1| PREDICTED: uncharacterized LOC101205849 [Cucumis sativus]
 gb|KGN61825.1| hypothetical protein Csa_2G249800 [Cucumis sativus]
Length=83

 Score =   135 bits (339),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HWKRNTAIAMAGIVLICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  15   FRAKVWSMSGGPYCRPKHWKRNTAIAMAGIVLICIPIAMKSAELEQRPHHPVRPIPSQLW  74

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  75   CKNFGNKEY  83



>ref|XP_008337927.1| PREDICTED: uncharacterized protein LOC103400976 [Malus domestica]
 ref|XP_008337998.1| PREDICTED: uncharacterized protein LOC103400976 [Malus domestica]
 ref|XP_008375913.1| PREDICTED: uncharacterized protein LOC103439139 [Malus domestica]
Length=85

 Score =   134 bits (337),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HWKRNTAIAMAGI L+CIPIAMKSA+LEQRPHNPVRPIPSQLW
Sbjct  17   FRAKVWSMSGGPYCRPKHWKRNTAIAMAGIFLVCIPIAMKSAELEQRPHNPVRPIPSQLW  76

Query  257  CKNFGTKEY  283
            CKNFG K+Y
Sbjct  77   CKNFGKKDY  85



>ref|XP_007220499.1| hypothetical protein PRUPE_ppa014128mg [Prunus persica]
 ref|XP_008232771.1| PREDICTED: uncharacterized protein LOC103331874 [Prunus mume]
 ref|XP_008232772.1| PREDICTED: uncharacterized protein LOC103331874 [Prunus mume]
 ref|XP_008232774.1| PREDICTED: uncharacterized protein LOC103331874 [Prunus mume]
 gb|EMJ21698.1| hypothetical protein PRUPE_ppa014128mg [Prunus persica]
Length=84

 Score =   134 bits (337),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HWKRNTAIAMAGI L+CIPIAMKSA+LEQRPHNPVRPIPSQLW
Sbjct  16   FRAKVWSMSGGPYCRPKHWKRNTAIAMAGIFLVCIPIAMKSAELEQRPHNPVRPIPSQLW  75

Query  257  CKNFGTKEY  283
            CKNFG K+Y
Sbjct  76   CKNFGNKDY  84



>ref|XP_009343525.1| PREDICTED: uncharacterized protein LOC103935481 [Pyrus x bretschneideri]
 ref|XP_009343601.1| PREDICTED: uncharacterized protein LOC103935556 [Pyrus x bretschneideri]
 ref|XP_009343605.1| PREDICTED: uncharacterized protein LOC103935559 [Pyrus x bretschneideri]
Length=85

 Score =   134 bits (337),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HWKRNTAIAMAGI L+CIPIAMKSA+LEQRPHNPVRPIPSQLW
Sbjct  17   FRAKVWSMSGGPYCRPKHWKRNTAIAMAGIFLVCIPIAMKSAELEQRPHNPVRPIPSQLW  76

Query  257  CKNFGTKEY  283
            CKNFG K+Y
Sbjct  77   CKNFGKKDY  85



>ref|XP_007139908.1| hypothetical protein PHAVU_008G068800g [Phaseolus vulgaris]
 gb|ESW11902.1| hypothetical protein PHAVU_008G068800g [Phaseolus vulgaris]
Length=84

 Score =   134 bits (336),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP+CRP HWKRNTAIAM G+VL+CIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  15   FRTKVWSMTGGPHCRPKHWKRNTAIAMLGVVLVCIPIAMKSAELEQRPHHPVRPIPSQLW  74

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  75   CKNFGTKDY  83



>ref|XP_008460976.1| PREDICTED: uncharacterized protein LOC103499701 [Cucumis melo]
Length=83

 Score =   133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTAIAMAGIVLICIPIAMKSA+LEQRPH+P+RPIPSQLW
Sbjct  15   FRAKVWSMSGGPYCRPKHWRRNTAIAMAGIVLICIPIAMKSAELEQRPHHPIRPIPSQLW  74

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  75   CKNFGNKEY  83



>ref|XP_010107604.1| hypothetical protein L484_006549 [Morus notabilis]
 gb|EXC16343.1| hypothetical protein L484_006549 [Morus notabilis]
Length=91

 Score =   133 bits (335),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR+KVW+M+GGP CRP HWKRNTAIAMAGI LICIPIAMKSA+LEQRPH PVRPIPSQLW
Sbjct  16   FRSKVWSMSGGPYCRPKHWKRNTAIAMAGIFLICIPIAMKSAELEQRPHYPVRPIPSQLW  75

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  76   CKNFGTKDY  84



>ref|XP_002262805.1| PREDICTED: uncharacterized protein LOC100258376 [Vitis vinifera]
Length=80

 Score =   132 bits (333),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGPNCRP HWKRNTAIAM G+ LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  12   FRTKVWSMTGGPNCRPKHWKRNTAIAMFGVFLICIPIAMKSAELEQRPHHPVRPIPSQLW  71

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  72   CKNFGNKEY  80



>emb|CBI40290.3| unnamed protein product [Vitis vinifera]
Length=185

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRP HWKRNTAIAMAG+ LICIPIAMKSA+LEQRPH P+RPIPSQLW
Sbjct  117  FRTKVWSMTGGPYCRPKHWKRNTAIAMAGVFLICIPIAMKSAELEQRPHQPIRPIPSQLW  176

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  177  CKNFGNKEY  185



>ref|XP_004234385.1| PREDICTED: uncharacterized protein LOC101248174 [Solanum lycopersicum]
 ref|XP_006353315.1| PREDICTED: uncharacterized protein LOC102598965 [Solanum tuberosum]
Length=81

 Score =   132 bits (332),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+M+GGP CRPVHWKRNTAIA+AGIVL+CIP+A+KSA+LEQRPH PVRPIPSQLW
Sbjct  13   FRTKVWSMSGGPYCRPVHWKRNTAIALAGIVLVCIPVALKSAELEQRPHLPVRPIPSQLW  72

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  73   CKNFGTKDY  81



>dbj|BAJ89894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=83

 Score =   132 bits (331),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRPVHW+RNTAIAM GI L+CIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  15   FRQKVWSMTGGPYCRPVHWRRNTAIAMVGIFLVCIPIAMKSAELEQRPHHPVRPIPSQLW  74

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  75   CKNFGKKEY  83



>emb|CAN83614.1| hypothetical protein VITISV_007756 [Vitis vinifera]
Length=83

 Score =   132 bits (331),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRP HWKRNTAIAMAG+ LICIPIAMKSA+LEQRPH P+RPIPSQLW
Sbjct  15   FRTKVWSMTGGPYCRPKHWKRNTAIAMAGVFLICIPIAMKSAELEQRPHQPIRPIPSQLW  74

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  75   CKNFGNKEY  83



>ref|XP_010255458.1| PREDICTED: uncharacterized protein LOC104596128 [Nelumbo nucifera]
Length=85

 Score =   131 bits (330),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+MTGGP CRP HWKRNTAIAM G+ LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  17   FRAKVWSMTGGPYCRPKHWKRNTAIAMFGVFLICIPIAMKSAELEQRPHHPVRPIPSQLW  76

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  77   CKNFGNKEY  85



>ref|XP_003578644.1| PREDICTED: uncharacterized protein LOC100843307 [Brachypodium 
distachyon]
Length=80

 Score =   131 bits (329),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRPVHW+RNTAIAM GI L+CIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  12   FRQKVWSMTGGPYCRPVHWRRNTAIAMFGIFLVCIPIAMKSAELEQRPHHPVRPIPSQLW  71

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  72   CKNFGKKEY  80



>ref|XP_002462833.1| hypothetical protein SORBIDRAFT_02g032740 [Sorghum bicolor]
 ref|XP_008653019.1| PREDICTED: uncharacterized protein LOC100303970 [Zea mays]
 gb|ACG25618.1| hypothetical protein [Zea mays]
 gb|ACG32350.1| hypothetical protein [Zea mays]
 gb|ACG48539.1| hypothetical protein [Zea mays]
 gb|ACL53921.1| unknown [Zea mays]
 gb|EER99354.1| hypothetical protein SORBIDRAFT_02g032740 [Sorghum bicolor]
 tpg|DAA62559.1| TPA: hypothetical protein ZEAMMB73_780886 [Zea mays]
Length=82

 Score =   131 bits (329),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRPVHW+RNTAIAM G+ LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  14   FRQKVWSMTGGPYCRPVHWRRNTAIAMFGVFLICIPIAMKSAELEQRPHHPVRPIPSQLW  73

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  74   CKNFGKKEY  82



>ref|XP_003552372.1| PREDICTED: uncharacterized protein LOC100795291 [Glycine max]
Length=88

 Score =   131 bits (329),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+M+GGP CRP HWKRNTAIAM G+VLICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  17   FRNKVWSMSGGPYCRPKHWKRNTAIAMVGVVLICIPIAMKSAELEQRPHHPVRPIPSQLW  76

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  77   CKNFGTKDY  85



>ref|XP_008793662.1| PREDICTED: uncharacterized protein LOC103709911 [Phoenix dactylifera]
Length=88

 Score =   131 bits (329),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRP HWKRNTAIAM GI L+CIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  20   FRTKVWSMTGGPYCRPKHWKRNTAIAMFGIFLVCIPIAMKSAELEQRPHHPVRPIPSQLW  79

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  80   CKNFGNKEY  88



>gb|EPS61470.1| hypothetical protein M569_13329 [Genlisea aurea]
Length=82

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW++TGGP CRP HWKRNTAIAMAGIVLICIPIAMKSA+LEQRPH PVRPIPSQ+W
Sbjct  14   FRQKVWSLTGGPYCRPKHWKRNTAIAMAGIVLICIPIAMKSAELEQRPHLPVRPIPSQIW  73

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  74   CKNFGNKEY  82



>ref|XP_009595665.1| PREDICTED: uncharacterized protein LOC104091925 [Nicotiana tomentosiformis]
 ref|XP_009768719.1| PREDICTED: uncharacterized protein LOC104219700 [Nicotiana sylvestris]
Length=81

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTAIA+AGIVLICIP+A+KSA+LEQRPH PVRPIPSQLW
Sbjct  13   FRAKVWSMSGGPYCRPKHWQRNTAIALAGIVLICIPVALKSAELEQRPHLPVRPIPSQLW  72

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  73   CKNFGTKDY  81



>gb|ABK96487.1| unknown [Populus trichocarpa x Populus deltoides]
Length=91

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTAIAM G+ LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  19   FRAKVWSMSGGPYCRPKHWRRNTAIAMFGVFLICIPIAMKSAELEQRPHHPVRPIPSQLW  78

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  79   CKNFGTKDY  87



>ref|XP_010921950.1| PREDICTED: uncharacterized protein LOC105045386 [Elaeis guineensis]
 ref|XP_010921951.1| PREDICTED: uncharacterized protein LOC105045386 [Elaeis guineensis]
Length=84

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRP HWKRNTAIAM GI L+CIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  16   FRTKVWSMTGGPYCRPKHWKRNTAIAMFGIFLVCIPIAMKSAELEQRPHHPVRPIPSQLW  75

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  76   CKNFGNKEY  84



>ref|XP_004957636.1| PREDICTED: uncharacterized protein LOC101772363 [Setaria italica]
Length=82

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRPVHW+RNTAIAM G+ L+CIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  14   FRQKVWSMTGGPYCRPVHWRRNTAIAMFGVFLVCIPIAMKSAELEQRPHHPVRPIPSQLW  73

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  74   CKNFGKKEY  82



>ref|NP_001063925.1| Os09g0560300 [Oryza sativa Japonica Group]
 dbj|BAD45960.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD46075.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25839.1| Os09g0560300 [Oryza sativa Japonica Group]
 dbj|BAG94101.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99526.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC85050.1| hypothetical protein OsI_32383 [Oryza sativa Indica Group]
 gb|EEE70216.1| hypothetical protein OsJ_30330 [Oryza sativa Japonica Group]
Length=83

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRPVHW+RNTAIAM G+ L+CIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  15   FRQKVWSMTGGPYCRPVHWRRNTAIAMFGVFLVCIPIAMKSAELEQRPHHPVRPIPSQLW  74

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  75   CKNFGKKEY  83



>ref|XP_011035729.1| PREDICTED: uncharacterized protein LOC105133426 [Populus euphratica]
 ref|XP_011035737.1| PREDICTED: uncharacterized protein LOC105133426 [Populus euphratica]
 ref|XP_011035747.1| PREDICTED: uncharacterized protein LOC105133426 [Populus euphratica]
Length=91

 Score =   130 bits (328),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTAIAM G+ LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  19   FRAKVWSMSGGPYCRPKHWRRNTAIAMFGVFLICIPIAMKSAELEQRPHHPVRPIPSQLW  78

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  79   CKNFGTKDY  87



>ref|NP_001237813.1| uncharacterized protein LOC100306629 [Glycine max]
 gb|ACU14905.1| unknown [Glycine max]
 gb|KHN29388.1| hypothetical protein glysoja_005112 [Glycine soja]
Length=90

 Score =   130 bits (328),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+M+GGP CRP HWKRNTAIAM G+VLICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  17   FRNKVWSMSGGPYCRPKHWKRNTAIAMFGVVLICIPIAMKSAELEQRPHHPVRPIPSQLW  76

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  77   CKNFGTKDY  85



>ref|XP_010931938.1| PREDICTED: uncharacterized protein LOC105052715 [Elaeis guineensis]
Length=86

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRP HWKRNTAIAM GI L+CIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  18   FRTKVWSMTGGPYCRPKHWKRNTAIAMFGIFLVCIPIAMKSAELEQRPHHPVRPIPSQLW  77

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  78   CKNFGNKEY  86



>ref|XP_002511818.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50487.1| conserved hypothetical protein [Ricinus communis]
Length=88

 Score =   130 bits (327),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M GGP CRP HW+RNTAIAMAG+ L+CIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  16   FRAKVWSMPGGPYCRPKHWRRNTAIAMAGLFLVCIPIAMKSAELEQRPHHPVRPIPSQLW  75

Query  257  CKNFGTKEY  283
            CKNFG+K+Y
Sbjct  76   CKNFGSKDY  84



>ref|XP_011076191.1| PREDICTED: uncharacterized protein LOC105160492 [Sesamum indicum]
Length=86

 Score =   130 bits (326),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+MTGGP CRP HWKRNTA AMAGIVLICIPIAMKSA+LEQRPH PV PIPSQ+W
Sbjct  18   FRAKVWSMTGGPYCRPKHWKRNTAFAMAGIVLICIPIAMKSAELEQRPHLPVHPIPSQIW  77

Query  257  CKNFGTKEY  283
            CKNFG K+Y
Sbjct  78   CKNFGNKDY  86



>gb|KDP28666.1| hypothetical protein JCGZ_14437 [Jatropha curcas]
Length=90

 Score =   129 bits (325),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+M+GGP CRP HW+RNTAIAMA + LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  18   FRGKVWSMSGGPYCRPKHWRRNTAIAMASVFLICIPIAMKSAELEQRPHHPVRPIPSQLW  77

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  78   CKNFGTKDY  86



>gb|EYU25080.1| hypothetical protein MIMGU_mgv1a017303mg [Erythranthe guttata]
Length=83

 Score =   129 bits (323),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+MTGGPNCRP HWKRNTA AM GIVLICIPIA+KSA+LE+RPH PVRPIPSQ+W
Sbjct  15   FRAKVWSMTGGPNCRPKHWKRNTAFAMVGIVLICIPIAIKSAELERRPHLPVRPIPSQIW  74

Query  257  CKNFGTKEY  283
            CKNFG K+Y
Sbjct  75   CKNFGNKDY  83



>ref|XP_007051891.1| Uncharacterized protein TCM_005394 [Theobroma cacao]
 gb|EOX96048.1| Uncharacterized protein TCM_005394 [Theobroma cacao]
Length=83

 Score =   129 bits (323),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+M+GGP CRP HW+RNTAIAM G+VLICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  15   FRKKVWSMSGGPYCRPKHWRRNTAIAMFGVVLICIPIAMKSAELEQRPHHPVRPIPSQLW  74

Query  257  CKNFGTKEY  283
            CKNFG K+Y
Sbjct  75   CKNFGKKDY  83



>gb|ABK93749.1| unknown [Populus trichocarpa]
Length=91

 Score =   129 bits (323),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTAIAM G+ LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  19   FRAKVWSMSGGPYCRPKHWRRNTAIAMFGVFLICIPIAMKSAELEQRPHHPVRPIPSQLW  78

Query  257  CKNFGTKEY  283
            CKNFG K+Y
Sbjct  79   CKNFGNKDY  87



>ref|XP_011023390.1| PREDICTED: uncharacterized protein LOC105124901 [Populus euphratica]
Length=90

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTAIAM G+ LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  18   FRAKVWSMSGGPYCRPKHWRRNTAIAMFGVFLICIPIAMKSAELEQRPHHPVRPIPSQLW  77

Query  257  CKNFGTKEY  283
            CKNF TK+Y
Sbjct  78   CKNFRTKDY  86



>ref|XP_010055187.1| PREDICTED: uncharacterized protein LOC104443472 [Eucalyptus grandis]
 ref|XP_010055188.1| PREDICTED: uncharacterized protein LOC104443472 [Eucalyptus grandis]
Length=85

 Score =   127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HWKRNTAIAM G+ L+CIPIAM SA+LEQRPH PVRPIPSQLW
Sbjct  17   FRAKVWSMSGGPYCRPKHWKRNTAIAMFGVFLVCIPIAMTSAKLEQRPHQPVRPIPSQLW  76

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  77   CKNFGNKEY  85



>gb|KHG20156.1| hypothetical protein F383_08358 [Gossypium arboreum]
 gb|KJB09852.1| hypothetical protein B456_001G170800 [Gossypium raimondii]
 gb|KJB09853.1| hypothetical protein B456_001G170800 [Gossypium raimondii]
Length=82

 Score =   127 bits (319),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+M+GGP CRP HW+RNTAIAM G+ LICIPIAMKSA+LEQRPH PVRPIPSQLW
Sbjct  14   FRTKVWSMSGGPYCRPKHWRRNTAIAMFGVFLICIPIAMKSAELEQRPHQPVRPIPSQLW  73

Query  257  CKNFGTKEY  283
            CKNFG K+Y
Sbjct  74   CKNFGNKDY  82



>ref|XP_009418791.1| PREDICTED: uncharacterized protein LOC103998908 [Musa acuminata 
subsp. malaccensis]
Length=87

 Score =   127 bits (318),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRP HWKRNTAIAM G  L+CIPIAMKSA+LEQRPH PVRPIPSQLW
Sbjct  19   FRNKVWSMTGGPYCRPKHWKRNTAIAMFGAFLVCIPIAMKSAELEQRPHYPVRPIPSQLW  78

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  79   CKNFGKKEY  87



>gb|KJB24676.1| hypothetical protein B456_004G156900 [Gossypium raimondii]
 gb|KJB24677.1| hypothetical protein B456_004G156900 [Gossypium raimondii]
Length=83

 Score =   127 bits (318),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+M+GGP CRP HW+RNTAIAM G+ LICIPIAMKSA+LEQRPH PVRPIPSQLW
Sbjct  15   FREKVWSMSGGPYCRPKHWRRNTAIAMFGVFLICIPIAMKSAELEQRPHQPVRPIPSQLW  74

Query  257  CKNFGTKEY  283
            CKNFG K+Y
Sbjct  75   CKNFGNKDY  83



>ref|XP_008670378.1| PREDICTED: uncharacterized protein LOC100275447 [Zea mays]
 gb|ACG28118.1| hypothetical protein [Zea mays]
 tpg|DAA40756.1| TPA: hypothetical protein ZEAMMB73_702631 [Zea mays]
Length=81

 Score =   126 bits (317),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRPVHW+RNTAIAM G+ LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  14   FRQKVWSMTGGPYCRPVHWRRNTAIAMFGVFLICIPIAMKSAELEQRPHHPVRPIPSQLW  73

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  74   CKNFG-KEY  81



>ref|XP_006396258.1| hypothetical protein EUTSA_v10029049mg [Eutrema salsugineum]
 gb|ESQ37711.1| hypothetical protein EUTSA_v10029049mg [Eutrema salsugineum]
Length=141

 Score =   128 bits (321),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTAIAM G+ L+CIPIAMKSA+LEQRPH PVRPIPSQ+W
Sbjct  68   FRAKVWSMSGGPYCRPKHWRRNTAIAMFGVFLVCIPIAMKSAELEQRPHMPVRPIPSQIW  127

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  128  CKNFGTKD  135



>ref|XP_004306815.1| PREDICTED: uncharacterized protein LOC101311609 [Fragaria vesca 
subsp. vesca]
Length=86

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HWKRNTAIAM G+ L+CIPIAMKSA+LEQRPH+PVRPIPSQ+W
Sbjct  17   FRAKVWSMSGGPYCRPKHWKRNTAIAMFGVFLVCIPIAMKSAELEQRPHHPVRPIPSQMW  76

Query  257  CKNFGTKE  280
            CKNFG K+
Sbjct  77   CKNFGKKD  84



>ref|XP_006411842.1| hypothetical protein EUTSA_v10026679mg [Eutrema salsugineum]
 gb|ESQ53295.1| hypothetical protein EUTSA_v10026679mg [Eutrema salsugineum]
Length=88

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTAIAM G+ L+CIPIAMKSA+LEQRPH PVRPIPSQ+W
Sbjct  15   FRAKVWSMSGGPYCRPKHWRRNTAIAMFGVFLVCIPIAMKSAELEQRPHMPVRPIPSQIW  74

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  75   CKNFGTKD  82



>ref|XP_009111473.1| PREDICTED: uncharacterized protein LOC103836910 [Brassica rapa]
Length=85

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTA+AM G+ L+CIPIAMKSA+LEQRPH PVRPIPSQ+W
Sbjct  12   FRAKVWSMSGGPYCRPKHWRRNTALAMLGVFLVCIPIAMKSAELEQRPHMPVRPIPSQIW  71

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  72   CKNFGTKD  79



>ref|XP_003623880.1| hypothetical protein MTR_7g076630 [Medicago truncatula]
 gb|AES80098.1| transmembrane protein, putative [Medicago truncatula]
 gb|AFK34892.1| unknown [Medicago truncatula]
Length=90

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP+CRP HWKRNTAIAM GIVL+CIPI   SA+LEQRPH+PVRPIPSQ+W
Sbjct  18   FRYKVWSMTGGPHCRPKHWKRNTAIAMFGIVLVCIPIFKLSAKLEQRPHHPVRPIPSQMW  77

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  78   CKNFGTKDY  86



>gb|ACG37342.1| hypothetical protein [Zea mays]
Length=81

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 63/69 (91%), Gaps = 1/69 (1%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRPVHW+ NTAIAM G+ LICIPIAMKSA+LEQRPH+PVRPIPSQLW
Sbjct  14   FRQKVWSMTGGPYCRPVHWRHNTAIAMFGVFLICIPIAMKSAELEQRPHHPVRPIPSQLW  73

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  74   CKNFG-KEY  81



>ref|XP_009138535.1| PREDICTED: uncharacterized protein LOC103862588 [Brassica rapa]
Length=87

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTA AM G+ L+CIPIAMKSA+LEQRPH PVRPIPSQ+W
Sbjct  14   FRAKVWSMSGGPYCRPKHWRRNTAFAMFGVFLVCIPIAMKSAELEQRPHMPVRPIPSQIW  73

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  74   CKNFGTKD  81



>emb|CDX74341.1| BnaA03g27060D [Brassica napus]
Length=84

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTA AM G+ L+CIPIAMKSA+LEQRPH PVRPIPSQ+W
Sbjct  11   FRAKVWSMSGGPYCRPKHWRRNTAFAMLGVFLVCIPIAMKSAELEQRPHMPVRPIPSQIW  70

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  71   CKNFGTKD  78



>emb|CDY51150.1| BnaA09g51850D [Brassica napus]
Length=85

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTA AM G+ L+CIPIAMKSA+LEQRPH PVRPIPSQ+W
Sbjct  12   FRAKVWSMSGGPYCRPKHWRRNTAFAMLGVFLVCIPIAMKSAELEQRPHMPVRPIPSQIW  71

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  72   CKNFGTKD  79



>ref|XP_004492703.1| PREDICTED: uncharacterized protein LOC101495413 [Cicer arietinum]
Length=84

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGPNCRP HWKRNTAIAM G+ L+CIPI   SA+LEQRPH+PVRPIPSQ+W
Sbjct  15   FRYKVWSMTGGPNCRPKHWKRNTAIAMFGVFLVCIPIFKLSAKLEQRPHHPVRPIPSQMW  74

Query  257  CKNFGTKEY  283
            CKNFGTK+Y
Sbjct  75   CKNFGTKDY  83



>ref|XP_009134541.1| PREDICTED: uncharacterized protein LOC103858862 [Brassica rapa]
 ref|XP_009134542.1| PREDICTED: uncharacterized protein LOC103858862 [Brassica rapa]
Length=86

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTA AM G+ L+CIPIAMKSA+LEQRPH PVRPIPSQ+W
Sbjct  13   FRAKVWSMSGGPYCRPKHWRRNTAFAMLGVFLVCIPIAMKSAELEQRPHMPVRPIPSQIW  72

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  73   CKNFGTKD  80



>emb|CDY31618.1| BnaA03g54340D [Brassica napus]
Length=87

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTA AM G+ L+CIPIAMKSA+LEQRPH PVRPIPSQ+W
Sbjct  14   FRAKVWSMSGGPYCRPKHWRRNTAFAMFGVFLVCIPIAMKSAELEQRPHMPVRPIPSQIW  73

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  74   CKNFGTKD  81



>ref|XP_009412459.1| PREDICTED: uncharacterized protein LOC103993943 [Musa acuminata 
subsp. malaccensis]
Length=89

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+MTGGP CRP HWKRNTAIA  G  L+CIPIA+KSA+LEQRPH PVRPIPSQLW
Sbjct  21   FRTKVWSMTGGPYCRPKHWKRNTAIAFLGAFLVCIPIAIKSAELEQRPHYPVRPIPSQLW  80

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  81   CKNFGKKEY  89



>emb|CDX72659.1| BnaC07g46810D [Brassica napus]
Length=144

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTA AM G+ L+CIPIAMKSA+LEQRPH PVRPIPSQ+W
Sbjct  71   FRAKVWSMSGGPYCRPKHWRRNTAFAMFGVFLVCIPIAMKSAELEQRPHMPVRPIPSQIW  130

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  131  CKNFGTKD  138



>ref|NP_567180.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36198.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14178.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43294.1| unknown protein [Arabidopsis thaliana]
 gb|AEE81905.1| uncharacterized protein AT4G00585 [Arabidopsis thaliana]
Length=88

 Score =   124 bits (310),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+MTGGPNCRP HW+RNTAIAM G+ L+CIPIA  SA+LEQRPH PVRPIPSQ+W
Sbjct  15   FRAKVWSMTGGPNCRPKHWRRNTAIAMFGVFLVCIPIAKLSAKLEQRPHMPVRPIPSQIW  74

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  75   CKNFGTKD  82



>ref|XP_010671874.1| PREDICTED: uncharacterized protein LOC104888549 [Beta vulgaris 
subsp. vulgaris]
Length=84

 Score =   123 bits (309),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+M+GGP CRP HW+RNTA A+ GI L+C+PIA+KSAQLEQRPH PVRPIPSQ+W
Sbjct  16   FRTKVWSMSGGPYCRPKHWRRNTAFALFGIFLVCVPIAVKSAQLEQRPHEPVRPIPSQMW  75

Query  257  CKNFGTKEY  283
            CKNFG KEY
Sbjct  76   CKNFGNKEY  84



>gb|AAM63027.1| unknown [Arabidopsis thaliana]
Length=88

 Score =   123 bits (309),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+MTGGPNCRP HW+RNTAIAM G+ L+CIPIA  SA+LEQRPH PVRPIPSQ+W
Sbjct  15   FRAKVWSMTGGPNCRPKHWRRNTAIAMFGVFLVCIPIAKLSAKLEQRPHMPVRPIPSQIW  74

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  75   CKNFGTKD  82



>ref|XP_010419607.1| PREDICTED: uncharacterized protein LOC104705321 [Camelina sativa]
 ref|XP_010419608.1| PREDICTED: uncharacterized protein LOC104705321 [Camelina sativa]
 ref|XP_010456263.1| PREDICTED: uncharacterized protein LOC104737718 [Camelina sativa]
Length=90

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGPNCRP HW+RNTAIAM G+ L+CIPIA  SA+LEQRPH PVRPIPSQ+W
Sbjct  17   FRAKVWSMSGGPNCRPKHWRRNTAIAMFGVFLVCIPIAKLSAKLEQRPHMPVRPIPSQMW  76

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  77   CKNFGTKD  84



>ref|XP_010427229.1| PREDICTED: uncharacterized protein LOC104712104 [Camelina sativa]
Length=90

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGPNCRP HW+RNTAIAM G+ L+CIPIA  SA+LEQRPH PVRPIPSQ+W
Sbjct  17   FRAKVWSMSGGPNCRPKHWRRNTAIAMFGVFLVCIPIAKLSAKLEQRPHMPVRPIPSQMW  76

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  77   CKNFGTKD  84



>ref|XP_010544378.1| PREDICTED: uncharacterized protein LOC104817018 [Tarenaya hassleriana]
Length=86

 Score =   121 bits (304),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR+KVW+M GG  CRP HW+RNTAIAM G+ L+CIPIAMKSA+LEQRPH PVRPIPSQLW
Sbjct  13   FRSKVWSMPGGAYCRPKHWRRNTAIAMFGVFLVCIPIAMKSAELEQRPHMPVRPIPSQLW  72

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  73   CKNFGTKD  80



>gb|KCW71666.1| hypothetical protein EUGRSUZ_E00186 [Eucalyptus grandis]
Length=91

 Score =   121 bits (304),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 6/75 (8%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLE------QRPHNPVRP  238
            FRAKVW+M+GGP CRP HWKRNTAIAM G+ L+CIPIAM SA+LE      QRPH PVRP
Sbjct  17   FRAKVWSMSGGPYCRPKHWKRNTAIAMFGVFLVCIPIAMTSAKLENSAFLQQRPHQPVRP  76

Query  239  IPSQLWCKNFGTKEY  283
            IPSQLWCKNFG KEY
Sbjct  77   IPSQLWCKNFGNKEY  91



>emb|CBI31783.3| unnamed protein product [Vitis vinifera]
Length=62

 Score =   120 bits (301),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  98   MTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNFGTK  277
            MTGGPNCRP HWKRNTAIAM G+ LICIPIAMKSA+LEQRPH+PVRPIPSQLWCKNFG K
Sbjct  1    MTGGPNCRPKHWKRNTAIAMFGVFLICIPIAMKSAELEQRPHHPVRPIPSQLWCKNFGNK  60

Query  278  EY  283
            EY
Sbjct  61   EY  62



>ref|XP_006289505.1| hypothetical protein CARUB_v10003039mg [Capsella rubella]
 gb|EOA22403.1| hypothetical protein CARUB_v10003039mg [Capsella rubella]
Length=88

 Score =   120 bits (302),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTAIAM G+ L+CIPIA  SA+LEQRPH PVRPIPSQ+W
Sbjct  15   FRAKVWSMSGGPYCRPKHWRRNTAIAMFGVFLVCIPIAQLSAKLEQRPHMPVRPIPSQIW  74

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  75   CKNFGTKD  82



>ref|XP_002872939.1| hypothetical protein ARALYDRAFT_490509 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49198.1| hypothetical protein ARALYDRAFT_490509 [Arabidopsis lyrata subsp. 
lyrata]
Length=88

 Score =   120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+RNTAIAM G+ L+CIPIA  SA+LEQRPH PVRPIPSQ+W
Sbjct  15   FRAKVWSMSGGPYCRPKHWRRNTAIAMFGVFLVCIPIAKLSAKLEQRPHMPVRPIPSQIW  74

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  75   CKNFGTKD  82



>emb|CDX91903.1| BnaC03g32050D [Brassica napus]
Length=99

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FRAKVW+M+GGP CRP HW+ NTA AM G+ L+CIPIAMKSA+LEQ PH PVRPIPSQ+W
Sbjct  9    FRAKVWSMSGGPYCRPKHWRHNTAFAMLGVFLVCIPIAMKSAELEQMPHMPVRPIPSQIW  68

Query  257  CKNFGTKE  280
            CKNFGTK+
Sbjct  69   CKNFGTKD  76



>emb|CDP17713.1| unnamed protein product [Coffea canephora]
Length=116

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            FR KVW+M GGP  RP HWKRNT I MAG  L+CIPIAM S +LEQRPH PVRPIPSQLW
Sbjct  48   FRTKVWSMPGGPYYRPKHWKRNTTIPMAGAFLLCIPIAMISVELEQRPHMPVRPIPSQLW  107

Query  257  CKNFGTKEY  283
            CKNFG K+Y
Sbjct  108  CKNFGEKDY  116



>emb|CDP05217.1| unnamed protein product [Coffea canephora]
Length=62

 Score =   111 bits (278),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  98   MTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNFGTK  277
            M GGP CRP HWKRNTAIAMAG+ L+CIPIAM S QLEQRPH PVRPIPSQLWCKNFG K
Sbjct  1    MPGGPYCRPKHWKRNTAIAMAGVFLLCIPIAMISVQLEQRPHMPVRPIPSQLWCKNFGKK  60

Query  278  EY  283
            +Y
Sbjct  61   DY  62



>gb|ABK25770.1| unknown [Picea sitchensis]
Length=85

 Score =   102 bits (253),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +   VW++TGG  CRP HW+RNTAIA+AGI L+CIPIA+KSA+LEQRPH PV PIPSQ W
Sbjct  16   YPTNVWSLTGGWFCRPKHWRRNTAIALAGIFLVCIPIAVKSAELEQRPHYPVHPIPSQKW  75

Query  257  CKNF  268
            CKNF
Sbjct  76   CKNF  79



>ref|XP_001765323.1| predicted protein [Physcomitrella patens]
 gb|EDQ69786.1| predicted protein [Physcomitrella patens]
Length=84

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+ TGG  C P  W+RNT IA AGI  +CIPIAMKSAQLEQRP  PVRP+PSQ+W
Sbjct  13   YPTQVWSPTGGWWCHPKLWRRNTVIAFAGIFAVCIPIAMKSAQLEQRPLMPVRPVPSQMW  72

Query  257  CKNFGTKE  280
            CKNFG KE
Sbjct  73   CKNFGDKE  80



>ref|XP_002979230.1| hypothetical protein SELMODRAFT_59905, partial [Selaginella moellendorffii]
 ref|XP_002990304.1| hypothetical protein SELMODRAFT_49858, partial [Selaginella moellendorffii]
 gb|EFJ08573.1| hypothetical protein SELMODRAFT_49858, partial [Selaginella moellendorffii]
 gb|EFJ19638.1| hypothetical protein SELMODRAFT_59905, partial [Selaginella moellendorffii]
Length=69

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            +WT  GGP C P +W+RNTA+ + GI LICIPIA  SA+LEQRP  P  PIPSQLWCKNF
Sbjct  1    IWTPFGGPYCNPRNWRRNTALTLLGIFLICIPIARLSARLEQRPVPPHFPIPSQLWCKNF  60

Query  269  G  271
            G
Sbjct  61   G  61



>ref|XP_010094846.1| hypothetical protein L484_016428 [Morus notabilis]
 gb|EXB57375.1| hypothetical protein L484_016428 [Morus notabilis]
Length=89

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLE  211
            FR+KVW+M+GGP CRP HWKRNTAIAMAGI LICIPIAMKSA+LE
Sbjct  16   FRSKVWSMSGGPYCRPKHWKRNTAIAMAGIFLICIPIAMKSAELE  60



>ref|XP_006843419.1| hypothetical protein AMTR_s00053p00144400 [Amborella trichopoda]
 gb|ERN05094.1| hypothetical protein AMTR_s00053p00144400 [Amborella trichopoda]
Length=87

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQ  214
            +R KVW+MTGGP CRP +WKRNTAIAMAGIVLICIP+AMKSA+LE+
Sbjct  15   YRTKVWSMTGGPYCRPKYWKRNTAIAMAGIVLICIPLAMKSAELEE  60



>gb|AFK44921.1| unknown [Lotus japonicus]
Length=116

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -1

Query  286  LVFFRPEVLAPELRGNWPDRIMGPLLELGGFHGDGNANENDSCHGDGGIAFPVHGPAIRS  107
             V FRP++LAPEL  +W +R+M  LLEL G   DG+ANE D+ HGDGG+  PV G  +R+
Sbjct  20   FVVFRPKILAPELGRDWANRVMWSLLELSGKLEDGDANEEDTEHGDGGVTLPVLGTTVRA  79

Query  106  AGHGPDLGPEVAG  68
             GH P L PE+A 
Sbjct  80   TGHTPYLVPEIAA  92



>gb|ACG27383.1| hypothetical protein [Zea mays]
Length=58

 Score = 84.0 bits (206),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLE  211
            FR KVW+MTGGP CRPVHW+RNTAIAM G+ LICIPIAMKSA+LE
Sbjct  14   FRQKVWSMTGGPYCRPVHWRRNTAIAMFGVFLICIPIAMKSAELE  58



>ref|XP_006853520.1| hypothetical protein AMTR_s00032p00223370 [Amborella trichopoda]
 gb|ERN14987.1| hypothetical protein AMTR_s00032p00223370 [Amborella trichopoda]
Length=91

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLE  211
            +R KVW+MTGGP C+P +WKRNTAIAMAGIVLICIPIAMKSA+LE
Sbjct  29   YRTKVWSMTGGPYCKPKYWKRNTAIAMAGIVLICIPIAMKSAELE  73



>tpg|DAA62558.1| TPA: hypothetical protein ZEAMMB73_780886 [Zea mays]
Length=105

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLE  211
            FR KVW+MTGGP CRPVHW+RNTAIAM G+ LICIPIAMKSA+LE
Sbjct  14   FRQKVWSMTGGPYCRPVHWRRNTAIAMFGVFLICIPIAMKSAELE  58



>ref|XP_006386595.1| hypothetical protein POPTR_0002s15720g [Populus trichocarpa]
 gb|ERP64392.1| hypothetical protein POPTR_0002s15720g [Populus trichocarpa]
Length=68

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLE  211
            FRAKVW+M+GGP CRP HW+RNTAIAM G+ LICIPIAMKSA+LE
Sbjct  19   FRAKVWSMSGGPYCRPKHWRRNTAIAMFGVFLICIPIAMKSAELE  63



>ref|XP_006375328.1| hypothetical protein POPTR_0014s07560g [Populus trichocarpa]
 gb|ERP53125.1| hypothetical protein POPTR_0014s07560g [Populus trichocarpa]
Length=85

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLE  211
            FRAKVW+M+GGP CRP HW+RNTAIAM G+ LICIPIAMKSA+LE
Sbjct  19   FRAKVWSMSGGPYCRPKHWRRNTAIAMFGVFLICIPIAMKSAELE  63



>emb|CDY07208.1| BnaCnng02230D [Brassica napus]
Length=133

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLE  211
            FRAKVW+M+GGP CRP HW+RNTA AM G+ L+CIPIAMKSA+LE
Sbjct  12   FRAKVWSMSGGPYCRPKHWRRNTAFAMLGVFLVCIPIAMKSAELE  56



>ref|XP_006847395.1| hypothetical protein AMTR_s00153p00026460 [Amborella trichopoda]
 gb|ERN08976.1| hypothetical protein AMTR_s00153p00026460 [Amborella trichopoda]
Length=83

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +2

Query  80   RAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLE  211
            R KVW+MTGGP CRP +WKRNTAIAMAGIVLICIP+AMKS +LE
Sbjct  16   RTKVWSMTGGPYCRPKYWKRNTAIAMAGIVLICIPLAMKSTELE  59



>gb|KHN20177.1| hypothetical protein glysoja_049547 [Glycine soja]
Length=79

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLE  211
            FR KVW M+ GP CRP HWK NT+IA   IVLI IPIAMKSA+LE
Sbjct  17   FRNKVWRMSDGPYCRPKHWKHNTSIATVCIVLIYIPIAMKSAKLE  61



>ref|XP_002504370.1| hypothetical protein MICPUN_113359 [Micromonas sp. RCC299]
 gb|ACO65628.1| hypothetical protein MICPUN_113359 [Micromonas sp. RCC299]
Length=78

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  83   AKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCK  262
            +KVW+  GG    P HWKRNTA+    + +    I   S +LEQRP  P R IPSQ WCK
Sbjct  10   SKVWSPAGGWFADPKHWKRNTAMGFGVLAVASAMIFNYSRKLEQRPLAPTRRIPSQAWCK  69

Query  263  NF  268
            NF
Sbjct  70   NF  71



>ref|XP_011073182.1| PREDICTED: uncharacterized protein LOC105158214 isoform X1 [Sesamum 
indicum]
 ref|XP_011073183.1| PREDICTED: uncharacterized protein LOC105158214 isoform X1 [Sesamum 
indicum]
Length=161

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  268  EVLAPELRGNWPDRIMGPLLELGGFHGDGNANENDSCHGDGGIAFPVHG  122
            EVLAP+L GNW +  M  LLEL  FHGDGNA++ND+ HG+  IA PV G
Sbjct  27   EVLAPDLGGNWMNWKMWTLLELDRFHGDGNADQNDASHGECSIALPVLG  75



>gb|KIK12294.1| hypothetical protein PISMIDRAFT_689606, partial [Pisolithus microcarpus 
441]
Length=79

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+ +GG   RP +WK NTAI  AGI+ +   +   SA+ E R   P RPIPS +W K F
Sbjct  12   VWSPSGGWWSRPANWKSNTAITFAGILAVAYGVWTVSAEREVRHVKPDRPIPSMMWAKQF  71

Query  269  GTKE  280
              +E
Sbjct  72   RDQE  75



>ref|XP_011098759.1| PREDICTED: uncharacterized protein LOC105177332 isoform X1 [Sesamum 
indicum]
Length=161

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  268  EVLAPELRGNWPDRIMGPLLELGGFHGDGNANENDSCHGDGGIAFPVHG  122
            EVLAP+L GNW +  M  LLEL  FHGDGNA++ND  HG+ GIA P+ G
Sbjct  27   EVLAPDLGGNWMNWKMWTLLELDRFHGDGNADQNDVSHGECGIALPMLG  75



>gb|EPT01938.1| hypothetical protein FOMPIDRAFT_1048229 [Fomitopsis pinicola 
FP-58527 SS1]
Length=106

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VW+  GG   RP +WK NTAIA AGI+         SA+ E R   PVRPIPS LW K 
Sbjct  39   QVWSPAGGWWTRPSNWKSNTAIAFAGILTFVYAGWTYSAEKEVRYIEPVRPIPSMLWAKQ  98

Query  266  FGTKE  280
            +  ++
Sbjct  99   YRDRQ  103



>gb|KDR77088.1| hypothetical protein GALMADRAFT_428104 [Galerina marginata CBS 
339.88]
Length=85

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP +W  NTA+A  GI+ I   +   SA LE+R   P RPIPS LW K +
Sbjct  13   VWSPAGGWWTRPTNWATNTAVASVGILAISYWVWNISASLEKRTIQPTRPIPSMLWAKEY  72

Query  269  GTKE  280
              K+
Sbjct  73   TEKK  76



>ref|XP_008045094.1| hypothetical protein TRAVEDRAFT_136464, partial [Trametes versicolor 
FP-101664 SS1]
 gb|EIW51982.1| hypothetical protein TRAVEDRAFT_136464, partial [Trametes versicolor 
FP-101664 SS1]
Length=78

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VW+  GG   RP +WK NTAIA AGI+ +   +   SA  E+R   P RPIPS  W K 
Sbjct  11   EVWSPAGGWWTRPTNWKTNTAIAFAGILTVAYGVFTLSADKEKRLVQPSRPIPSMRWAKE  70

Query  266  F  268
            +
Sbjct  71   Y  71



>emb|CBJ32950.1| conserved unknown protein [Ectocarpus siliculosus]
Length=80

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            F   VW+  GG    P HWKRNT  A  GI L  I IA  S+  E+RP  P   IPSQ W
Sbjct  9    FPKHVWSPAGGWWVNPPHWKRNTGFAFVGIGLAFIAIARISSDRERRPIAPAFHIPSQRW  68

Query  257  CKN  265
            CK+
Sbjct  69   CKH  71



>gb|KIO24099.1| hypothetical protein M407DRAFT_244560 [Tulasnella calospora MUT 
4182]
Length=82

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VWT +GG   RP +W  NTAI  AG  L+   +   SA+ E R + PV+PIPS  W
Sbjct  9    YPKEVWTPSGGWWTRPTNWVANTAICTAGAALVTYVVWQYSAEKEWRHNAPVKPIPSMRW  68

Query  257  CKNFGTKE  280
             + F T E
Sbjct  69   ARQFKTGE  76



>gb|KIR42473.1| hypothetical protein I313_01698 [Cryptococcus gattii Ram5]
 gb|KIY59877.1| hypothetical protein I307_00952 [Cryptococcus gattii 99/473]
Length=80

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VWT +GG   RP +WK NTAI +AGI +    +   SA  E+R   P RPIPSQ+W
Sbjct  9    YPKEVWTPSGGWWSRPSNWKGNTAICIAGITIATFGVWRLSANREERHAAPTRPIPSQMW  68

Query  257  CKN  265
             + 
Sbjct  69   SRQ  71



>gb|KGB75375.1| hypothetical protein CNBG_1213 [Cryptococcus gattii R265]
 gb|KIR30791.1| hypothetical protein I309_00142 [Cryptococcus gattii LA55]
 gb|KIR35742.1| hypothetical protein I352_02020 [Cryptococcus gattii MMRL2647]
 gb|KIR72702.1| hypothetical protein I310_03303 [Cryptococcus gattii CA1014]
 gb|KIR95117.1| hypothetical protein I304_01444 [Cryptococcus gattii CBS 10090]
 gb|KIS00361.1| hypothetical protein L804_01773 [Cryptococcus gattii 2001/935-1]
Length=80

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VWT +GG   RP +WK NTAI +AGI +    +   SA  E+R   P RPIPSQ+W
Sbjct  9    YPKEVWTPSGGWWSRPSNWKGNTAICIAGITIATFGVWRLSANREERHAAPTRPIPSQMW  68

Query  257  CKN  265
             + 
Sbjct  69   SRQ  71



>gb|KIJ64842.1| hypothetical protein HYDPIDRAFT_89469, partial [Hydnomerulius 
pinastri MD-312]
Length=79

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +   VW+  GG   RP +W  NTAI MAGI  I   +   SA+ E R   P RPIPS +W
Sbjct  8    YPTHVWSPAGGWWTRPSNWASNTAITMAGIFAIAYGVWSVSAERETRHGLPDRPIPSMMW  67

Query  257  CKNF  268
             K F
Sbjct  68   AKQF  71



>gb|KIM57712.1| hypothetical protein SCLCIDRAFT_1219229 [Scleroderma citrinum 
Foug A]
Length=80

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VWT  GG   RP +W+ NTAI   GI+ I   +   SA+ E R   P RPIPS +W K F
Sbjct  13   VWTPAGGWWSRPANWQTNTAITFLGILAIAYGVWNVSAEREVRYIAPSRPIPSMMWAKQF  72

Query  269  GTKE  280
              +E
Sbjct  73   KDQE  76



>ref|XP_007267255.1| hypothetical protein FOMMEDRAFT_57277, partial [Fomitiporia mediterranea 
MF3/22]
 gb|EJD01839.1| hypothetical protein FOMMEDRAFT_57277, partial [Fomitiporia mediterranea 
MF3/22]
Length=76

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   RP +WK NTAI   GI+ I   +   SA  E R   P RPIPS LW
Sbjct  9    YPKEVWSPAGGWWTRPSNWKSNTAIVFGGILAITYGVWQLSASREWRHSPPSRPIPSMLW  68

Query  257  CKNF  268
             K +
Sbjct  69   AKQY  72



>ref|XP_009550994.1| hypothetical protein HETIRDRAFT_389067 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW77496.1| hypothetical protein HETIRDRAFT_389067 [Heterobasidion irregulare 
TC 32-1]
Length=82

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 36/68 (53%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   RP +WK NTAI   GI+ +   +   SA  E R   PVRPIPS  W
Sbjct  9    YPKEVWSPAGGWWTRPSNWKSNTAILFGGILAVTYGVWTLSADKEWRYVQPVRPIPSMKW  68

Query  257  CKNFGTKE  280
             K +   E
Sbjct  69   AKQYRDAE  76



>emb|CEL53244.1| hypothetical protein RSOLAG1IB_06210 [Rhizoctonia solani AG-1 
IB]
Length=84

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VWT +GG   RP +W  NT +  AGI  +   +   SA+LEQR   PV+ IPS LW + F
Sbjct  13   VWTPSGGWWTRPHNWVANTFVVTAGIATLTYGVWQYSAKLEQRHAEPVKWIPSMLWAREF  72



>tpg|DAA62560.1| TPA: hypothetical protein ZEAMMB73_780886 [Zea mays]
Length=26

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +2

Query  206  LEQRPHNPVRPIPSQLWCKNFGTKEY  283
            ++QRPH+PVRPIPSQLWCKNFG KEY
Sbjct  1    MQQRPHHPVRPIPSQLWCKNFGKKEY  26



>gb|AFR92845.2| hypothetical protein CNAG_00715 [Cryptococcus neoformans var. 
grubii H99]
Length=80

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VWT +GG   RP +WK NTAI + GI +    +   SA  E+R   P RPIPSQ+W
Sbjct  9    YPKEVWTPSGGWWTRPSNWKGNTAICIVGITIATFGVWRLSANREERHIAPTRPIPSQMW  68

Query  257  CKN  265
             + 
Sbjct  69   SRQ  71



>ref|XP_003307133.1| hypothetical protein PGTG_00083 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP74127.1| hypothetical protein PGTG_00083 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=97

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+ +GG   RP +W+ NTAI +AG  L+   +   SA  EQR   P R IPS LW
Sbjct  9    YPKEVWSPSGGWWTRPTNWRSNTAIIIAGSTLVFYSVFKLSANREQRMQAPNRWIPSMLW  68

Query  257  CKNF  268
             + F
Sbjct  69   AREF  72



>ref|XP_007367397.1| hypothetical protein DICSQDRAFT_148244 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF59934.1| hypothetical protein DICSQDRAFT_148244 [Dichomitus squalens LYAD-421 
SS1]
Length=81

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP +WK NTAIA AGI+ +   +   SA  E+R   P R IPS  W + +
Sbjct  13   VWSPAGGWWTRPSNWKSNTAIAFAGILTVAYGVFTVSADKERRLVEPSRAIPSMKWARQY  72



>gb|EMS21057.1| hypothetical protein RHTO_02315 [Rhodosporidium toruloides NP11]
 emb|CDR48210.1| RHTO0S16e03620g1_1 [Rhodosporidium toruloides]
Length=100

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VWT  GG    P +W+ NTA AM GI  +   I   SA+ E+R   P R IPS +W K 
Sbjct  19   EVWTPAGGWWTNPHNWRTNTAYAMLGIAFVGYGIFKFSAEHEERHTAPTRWIPSMMWAKQ  78

Query  266  FGTKE  280
            F   E
Sbjct  79   FKNGE  83



>emb|CCJ28377.1| unnamed protein product [Pneumocystis jirovecii]
Length=69

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +2

Query  101  TGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            +GG  C P  WK NTAI + G+ LI + I   SA+ E R   P R IPS +WCK  
Sbjct  9    SGGWWCYPKKWKSNTAICITGMSLIVLWIWKVSAEKEWRYRQPSRWIPSSMWCKQL  64



>gb|ERZ97553.1| hypothetical protein GLOINDRAFT_293150 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX79700.1| hypothetical protein RirG_003120 [Rhizophagus irregularis DAOM 
197198w]
 gb|EXX79701.1| hypothetical protein RirG_003120 [Rhizophagus irregularis DAOM 
197198w]
Length=86

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VW+  GG   RP +WK NT I   GIV++   +   SA+ E R + P + IPS +W K 
Sbjct  12   EVWSPAGGWWSRPANWKSNTTIITTGIVVLVGFVWKISAEREWRHNEPNQWIPSMMWSKQ  71

Query  266  FGTKEY  283
            F   EY
Sbjct  72   FKDGEY  77



>ref|XP_007872417.1| hypothetical protein PNEG_00529 [Pneumocystis murina B123]
 gb|EMR11516.1| hypothetical protein PNEG_00529 [Pneumocystis murina B123]
Length=77

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            F   VW+ +GG  C+P  WK NTAI +AGI LI   +   S + E R + P   IPS LW
Sbjct  8    FPKHVWSPSGGWWCQPRKWKSNTAICIAGISLIVFWVWKTSVEKEWRYNKPSGWIPSLLW  67

Query  257  CKNFGTKE  280
             K  G KE
Sbjct  68   SK--GLKE  73



>ref|XP_007510314.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18659.1| predicted protein [Bathycoccus prasinos]
Length=83

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = +2

Query  83   AKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWC  259
            ++VWT  GG    P HW+RNTAI    + +    +  +S ++E+RP  P   IPSQ+W 
Sbjct  16   SQVWTSYGGWFADPKHWRRNTAIGFGIVFVASAFVFNQSRKMEKRPQFPHHGIPSQMWA  74



>ref|XP_011073184.1| PREDICTED: uncharacterized protein LOC105158214 isoform X2 [Sesamum 
indicum]
Length=157

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  268  EVLAPELRGNWPDRIMGPLLELGGFHGDGNANENDSCHGDGGIAFPVHGPA  116
            +++  +L GNW +  M  LLEL  FHGDGNA++ND+ HG+  IA PV G  
Sbjct  23   KLITEDLGGNWMNWKMWTLLELDRFHGDGNADQNDASHGECSIALPVLGQT  73



>gb|KDQ31463.1| hypothetical protein PLEOSDRAFT_1088781 [Pleurotus ostreatus 
PC15]
Length=76

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 0/64 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   RP +WK NTA+A  GI+ +       SA  E R   P +PIPS  W
Sbjct  9    YPKEVWSPAGGWWVRPSNWKSNTAVAFGGILALTYATWNVSADHEHRSVQPSKPIPSMKW  68

Query  257  CKNF  268
             K +
Sbjct  69   AKQY  72



>gb|KIK82026.1| hypothetical protein PAXRUDRAFT_832452 [Paxillus rubicundulus 
Ve08.2h10]
Length=80

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+ +GG   RP +W  NT I M GI+ I   +   SA+ E R   P RPIPS +W K F
Sbjct  13   VWSPSGGWWTRPSNWASNTTITMIGILAIAYGVWNVSAERETRHILPDRPIPSMMWAKQF  72



>ref|XP_011098765.1| PREDICTED: uncharacterized protein LOC105177332 isoform X2 [Sesamum 
indicum]
Length=157

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  268  EVLAPELRGNWPDRIMGPLLELGGFHGDGNANENDSCHGDGGIAFPVHGPA  116
            +++  +L GNW +  M  LLEL  FHGDGNA++ND  HG+ GIA P+ G  
Sbjct  23   KLITEDLGGNWMNWKMWTLLELDRFHGDGNADQNDVSHGECGIALPMLGQT  73



>gb|KIK33832.1| hypothetical protein CY34DRAFT_26975 [Suillus luteus UH-Slu-Lm8-n1]
Length=79

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 32/60 (53%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP +W+ NT I  AGI  I   +   SA  E R   P RPIPS +W K +
Sbjct  13   VWSPAGGWWARPANWRSNTVITFAGIFAIAYGVWNVSADREVRHVQPNRPIPSMMWAKQY  72



>ref|XP_007350412.1| hypothetical protein AURDEDRAFT_68632, partial [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD41546.1| hypothetical protein AURDEDRAFT_68632, partial [Auricularia delicata 
TFB-10046 SS5]
Length=82

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP  WK NT I  AG  ++   +   SA+ EQR   P+RPIPS+ W   F
Sbjct  12   VWSPAGGWWTRPRAWKSNTLILAAGAGVLVYGVWTYSAKHEQRTRAPMRPIPSRHWAAEF  71



>gb|KDQ09204.1| hypothetical protein BOTBODRAFT_37286 [Botryobasidium botryosum 
FD-172 SS1]
Length=83

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VW+ +GG   RP +W  NTAI   GI +        SA+ E R   PV+PIPS LW + 
Sbjct  12   QVWSPSGGWWTRPTNWVSNTAICTFGIAIATYGAWSISAEKEWRHAAPVKPIPSMLWARQ  71

Query  266  FGTKE  280
            F   E
Sbjct  72   FKEGE  76



>emb|CDH60104.1| hypothetical protein RO3G_15305 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=76

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 0/65 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VW+  GG   +P  WK NT IA  G+ +    +   SA  EQR   P R IPS +W K 
Sbjct  12   EVWSPAGGWWAQPKAWKSNTLIAGFGLAVTVAAVWKVSADKEQRYQQPTRWIPSMMWAKQ  71

Query  266  FGTKE  280
            F  ++
Sbjct  72   FKDQQ  76



>ref|XP_005535435.1| hypothetical protein CYME_CMD068C [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM79149.1| hypothetical protein CYME_CMD068C [Cyanidioschyzon merolae strain 
10D]
Length=85

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCK  262
             VW+  GG    P  W+RNTA+A  G+VL+  PI + S ++ +RP +  R IP + W K
Sbjct  12   DVWSPAGGWWPHPRAWRRNTAVAAFGLVLVLTPIFIYSERISERPEDAARQIPWRPWVK  70



>emb|CCF52708.1| uncharacterized protein UHOR_04863 [Ustilago hordei]
Length=82

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 34/68 (50%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   RP +W  NTAI   GI L    +   SA  E R + P +PIPS  W
Sbjct  9    YPKEVWSPAGGWWTRPSNWATNTAICAVGIALATYGVWKYSADREWRHNAPTKPIPSMKW  68

Query  257  CKNFGTKE  280
             + F   E
Sbjct  69   ARQFKEGE  76



>gb|KDQ56755.1| hypothetical protein JAAARDRAFT_300579 [Jaapia argillacea MUCL 
33604]
Length=78

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPS  247
            +VW+ +GG   RP +WK NTAIA AGI ++       SA  E R + P +PIPS
Sbjct  12   QVWSPSGGWWTRPSNWKANTAIAFAGIAVVGYATFTLSADKEWRHNEPAKPIPS  65



>gb|ETS61972.1| hypothetical protein PaG_03522 [Pseudozyma aphidis DSM 70725]
Length=82

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 38/78 (49%), Gaps = 6/78 (8%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VWT  GG   RP +W  NTA+   GI L    +   SA  E R + P +PIPS  W
Sbjct  9    YPKEVWTPAGGWWTRPNNWVSNTAVCAVGIALATYGVWTYSADREWRHNAPTKPIPSMNW  68

Query  257  CKNFGTKEY*FCASLSVK  310
             + F   E      LSVK
Sbjct  69   ARQFKEGE------LSVK  80



>gb|EJU01368.1| hypothetical protein DACRYDRAFT_107922 [Dacryopinax sp. DJM-731 
SS1]
Length=150

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP +W  NTA+ + G  +I       SA+ E R   P RP+PSQLW K F
Sbjct  81   VWSPAGGWWTRPKNWVTNTAVVIGGCAVISYFAFRYSAEHEHRLAAPHRPVPSQLWAKEF  140



>ref|XP_006457761.1| hypothetical protein AGABI2DRAFT_133629 [Agaricus bisporus var. 
bisporus H97]
 ref|XP_007326325.1| hypothetical protein AGABI1DRAFT_82136 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM82323.1| hypothetical protein AGABI1DRAFT_82136 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV49715.1| hypothetical protein AGABI2DRAFT_133629 [Agaricus bisporus var. 
bisporus H97]
Length=83

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (52%), Gaps = 0/64 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP +W  NTAI   G+  +   +   SA  EQR   P R IPS LW K +
Sbjct  13   VWSPAGGWWVRPSNWASNTAIVAGGMAAVLYAVWRVSANNEQRITQPSRFIPSMLWAKEY  72

Query  269  GTKE  280
              ++
Sbjct  73   EDRK  76



>emb|CDS13108.1| hypothetical protein LRAMOSA05291 [Absidia idahoensis var. thermophila]
Length=87

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (53%), Gaps = 0/68 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   +P  WK NT IA  G+ +    +   SA+ EQR   P R IPS +W
Sbjct  20   YPKEVWSPAGGWWAQPKAWKSNTLIAGFGLAVTVAAVWKVSAEKEQRYQQPTRWIPSMMW  79

Query  257  CKNFGTKE  280
             K +  ++
Sbjct  80   AKQYKDQQ  87



>ref|XP_003064826.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51160.1| predicted protein [Micromonas pusilla CCMP1545]
Length=83

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  83   AKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCK  262
            ++VW+  GG    P  WKRNTAI         + I   S ++EQRP +P R IPSQ WC 
Sbjct  15   SRVWSPAGGWFADPKAWKRNTAIGFLAAGAAAVAIFSYSRKVEQRPLSPTRRIPSQAWCD  74

Query  263  NF  268
            NF
Sbjct  75   NF  76



>gb|KFH65611.1| hypothetical protein MVEG_09087 [Mortierella verticillata NRRL 
6337]
Length=80

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMK-SAQLEQRPHNPVRPIPSQLWCKN  265
            VW+ +GG   +P +WK NTA+A+ GI    +  A K SA+ E+R   P   IPSQLW K 
Sbjct  12   VWSPSGGWWTQPTNWKANTAVAV-GISATIVAAAWKYSAENEERHTRPKGWIPSQLWSKE  70

Query  266  FGTKE  280
            F   E
Sbjct  71   FQDGE  75



>ref|XP_001840527.2| hypothetical protein CC1G_07257 [Coprinopsis cinerea okayama7#130]
 gb|EAU81327.2| hypothetical protein CC1G_07257 [Coprinopsis cinerea okayama7#130]
Length=120

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 0/64 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   +P +W  NTAIA  G++     +   SA  E+R   P R IPS LW K +
Sbjct  55   VWSPAGGWWVQPKNWASNTAIAFVGVLATTYAVWSVSADKERRLSQPDRWIPSMLWAKEY  114

Query  269  GTKE  280
              +E
Sbjct  115  NNEE  118



>gb|KII91964.1| hypothetical protein PLICRDRAFT_173745 [Plicaturopsis crispa 
FD-325 SS-3]
Length=91

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 31/60 (52%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP +W+ N+ I   GIV +   +A  S   E R   P RPIPS  W K +
Sbjct  20   VWSPAGGWWTRPSNWRSNSIIVFGGIVALSYGVATVSWAHEWRSVQPFRPIPSMKWAKQY  79



>emb|CEF99325.1| unnamed product [Ostreococcus tauri]
Length=84

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 33/63 (52%), Gaps = 0/63 (0%)
 Frame = +2

Query  80   RAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWC  259
            RA VW+  GG    P  W+RNTA+   G+ ++       S + E+RP  P   +PSQ+W 
Sbjct  14   RAHVWSPYGGWFADPKGWRRNTALGFVGLGVLAFATWDFSRKREKRPIYPAHRVPSQMWS  73

Query  260  KNF  268
              F
Sbjct  74   NAF  76



>gb|KII85719.1| hypothetical protein PLICRDRAFT_178751 [Plicaturopsis crispa 
FD-325 SS-3]
Length=98

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 31/60 (52%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP +WK N+ I   GIV +   +A  S   E R   P RPIPS  W K +
Sbjct  25   VWSPAGGWWTRPSNWKSNSIIIFGGIVALSYGVATVSWAHEWRSVQPFRPIPSMKWAKQY  84



>gb|KIJ28564.1| hypothetical protein M422DRAFT_235617 [Sphaerobolus stellatus 
SS14]
Length=85

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+ +GG   RP  WK NT IA  GI ++   +   SA  E R   P +PIPS +W
Sbjct  9    YPKEVWSPSGGWWTRPKAWKANTFIAFLGIGVVAYQVFKLSASKEWRYIQPDKPIPSMMW  68

Query  257  CKNF  268
             + +
Sbjct  69   ARQY  72



>emb|CDI53939.1| conserved hypothetical protein, partial [Melanopsichium pennsylvanicum 
4]
Length=82

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 38/78 (49%), Gaps = 6/78 (8%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   RP +W  NTA+   GI L    +   SA  E R + P +PIPS  W
Sbjct  9    YPKEVWSPAGGWWTRPNNWVSNTAVCAVGIALATYGVWTYSADREWRHNAPTKPIPSMKW  68

Query  257  CKNFGTKEY*FCASLSVK  310
             + F   E      LSVK
Sbjct  69   ARQFKEGE------LSVK  80



>gb|EST05386.1| hypothetical protein PSEUBRA_SCAF6g00927, partial [Pseudozyma 
brasiliensis GHG001]
Length=81

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 38/78 (49%), Gaps = 6/78 (8%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   RP +W  NTA+   GI L    +   SA  E R + P +PIPS  W
Sbjct  8    YPKEVWSPAGGWWTRPNNWVSNTAVCAVGIALATYGVWTYSADREWRHNAPTKPIPSMNW  67

Query  257  CKNFGTKEY*FCASLSVK  310
             + F   E      LSVK
Sbjct  68   ARQFKEGE------LSVK  79



>ref|XP_007379548.1| hypothetical protein PUNSTDRAFT_81119 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN14631.1| hypothetical protein PUNSTDRAFT_81119 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=81

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 30/60 (50%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP +WK NTAI   GI  I +     S   E R   P +PIPS  W K +
Sbjct  13   VWSPAGGWWARPSNWKTNTAITAGGIAAIVLATWNISKDKEWRDVEPSKPIPSMNWTKQY  72



>dbj|GAC75901.1| hypothetical protein PANT_19d00008 [Pseudozyma antarctica T-34]
Length=133

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 38/78 (49%), Gaps = 6/78 (8%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VWT  GG   RP +W  NTA+   GI L    +   SA  E R + P +PIPS  W
Sbjct  60   YPKEVWTPAGGWWTRPNNWVSNTAVCAVGIALATYGVWTYSADREWRHNAPTKPIPSMNW  119

Query  257  CKNFGTKEY*FCASLSVK  310
             + F   E      LSVK
Sbjct  120  ARQFKEGE------LSVK  131



>emb|CBQ73509.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
Length=82

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 38/78 (49%), Gaps = 6/78 (8%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   RP +W  NTA+   GI L    +   SA  E R + P +PIPS  W
Sbjct  9    YPKEVWSPAGGWWTRPNNWVSNTAVCAVGIALATYGVWTYSADREWRHNAPTKPIPSMNW  68

Query  257  CKNFGTKEY*FCASLSVK  310
             + F   E      LSVK
Sbjct  69   ARQFKQGE------LSVK  80



>ref|XP_002297069.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED86797.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=72

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 6/66 (9%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAM---KSAQLEQRPHNPVRPIPS  247
            F+ +VW+  GG    PV WKRNT   +A    IC+  AM    SA+ E+RP  P + IPS
Sbjct  1    FKKQVWSPAGGWWPTPVAWKRNT---VACAFCICVASAMIFKVSAEKERRPIPPFKHIPS  57

Query  248  QLWCKN  265
            Q WCK+
Sbjct  58   QRWCKH  63



>ref|XP_007303281.1| hypothetical protein STEHIDRAFT_78104 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM87237.1| hypothetical protein STEHIDRAFT_78104 [Stereum hirsutum FP-91666 
SS1]
Length=87

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 34/64 (53%), Gaps = 0/64 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   +P  WK NTA+  AGI+ +       SA+ E+R   P R IPS +W K F
Sbjct  13   VWSPAGGWWGQPRAWKTNTAVLFAGILAVAYGTWTISAEHERRDVLPNRWIPSMMWAKQF  72

Query  269  GTKE  280
               E
Sbjct  73   KDAE  76



>dbj|GAK68423.1| conserved hypothetical protein [Pseudozyma antarctica]
Length=146

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 37/75 (49%), Gaps = 6/75 (8%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VWT  GG   RP +W  NTA+   GI L    +   SA  E R + P +PIPS  W + 
Sbjct  76   EVWTPAGGWWTRPNNWVSNTAVCAVGIALATYGVWTYSADREWRHNAPTKPIPSMNWARQ  135

Query  266  FGTKEY*FCASLSVK  310
            F   E      LSVK
Sbjct  136  FKEGE------LSVK  144



>gb|EIE90594.1| hypothetical protein RO3G_15305 [Rhizopus delemar RA 99-880]
Length=76

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VW+  GG   RP +WK NTA+A  G+ +    +   SA+ E R   P R IPS +W K 
Sbjct  12   EVWSPAGGWWSRPSNWKSNTAVAAIGMAVTLGFVWNVSAKKEVRYQQPKRWIPSMMWAKQ  71

Query  266  FGTKE  280
            +  ++
Sbjct  72   YKDQQ  76



>ref|XP_011389522.1| hypothetical protein UMAG_10628 [Ustilago maydis 521]
 gb|KIS69131.1| hypothetical protein UMAG_10628 [Ustilago maydis 521]
Length=82

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 39/78 (50%), Gaps = 6/78 (8%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   RP +W  NTA+   GI L    +   SA  E R + P +PIPS  W
Sbjct  9    YPKEVWSPAGGWWTRPNNWVSNTAVCAVGIALATYGVWTYSADREWRHNAPTKPIPSMKW  68

Query  257  CKNFGTKEY*FCASLSVK  310
             + F  KE      LSVK
Sbjct  69   ARQF--KE----GQLSVK  80



>ref|XP_007394963.1| hypothetical protein PHACADRAFT_194711 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM57140.1| hypothetical protein PHACADRAFT_194711 [Phanerochaete carnosa 
HHB-10118-sp]
Length=118

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 30/60 (50%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP +WK NT I    I  I   +   SA  E R   P RPIPS +W K +
Sbjct  48   VWSPAGGWWTRPSNWKSNTTIVFGMIFAITYGVWRVSADKEWRHVEPSRPIPSMMWAKQY  107



>gb|EMT09414.1| hypothetical protein F775_00254 [Aegilops tauschii]
Length=195

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -1

Query  211  LELGGFHGDGNANENDSCHGDGGIAFPVHGPAIRSAGHGPDLGPEVAG  68
            LELGGFHGDG+A+E D+ HGDGG+A PV GPAI  A H P L PEVA 
Sbjct  102  LELGGFHGDGDADEEDADHGDGGVAAPVDGPAIGPARHAPHLLPEVAA  149



>gb|KIK56364.1| hypothetical protein GYMLUDRAFT_47140 [Gymnopus luxurians FD-317 
M1]
Length=79

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 34/65 (52%), Gaps = 0/65 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VW+  GG   RP +WK NT +  AGI  +   +   S+  E R   P + IPS  W K 
Sbjct  12   QVWSPAGGWWVRPSNWKSNTFVVSAGIAGMAYLLFQLSSSKEHRYIAPAKDIPSMKWAKQ  71

Query  266  FGTKE  280
            F T++
Sbjct  72   FQTEQ  76



>emb|CEG65756.1| hypothetical protein RMATCC62417_02471 [Rhizopus microsporus]
 emb|CEJ01690.1| hypothetical protein RMCBS344292_15712 [Rhizopus microsporus]
Length=76

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 34/65 (52%), Gaps = 0/65 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VW+  GG   RP +WK NT +A  G+      +   SA+ E R   P R IPS +W K 
Sbjct  12   EVWSPAGGWWSRPHNWKSNTIVAAIGMTAALAVVWKVSAEKEVRYQEPKRWIPSMMWAKQ  71

Query  266  FGTKE  280
            +  +E
Sbjct  72   YKDRE  76



>emb|CEG79291.1| hypothetical protein RMATCC62417_13776 [Rhizopus microsporus]
 emb|CEI93760.1| hypothetical protein RMCBS344292_07987 [Rhizopus microsporus]
Length=76

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 34/65 (52%), Gaps = 0/65 (0%)
 Frame = +2

Query  86   KVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKN  265
            +VW+  GG   RP +WK NT +A  G+      +   SA+ E R   P R IPS +W K 
Sbjct  12   EVWSPAGGWWSRPHNWKSNTIVAAIGMTAALAVVWKVSAEKEVRYQEPKRWIPSMMWAKQ  71

Query  266  FGTKE  280
            +  +E
Sbjct  72   YRDRE  76



>ref|XP_007878647.1| hypothetical protein PFL1_02944 [Pseudozyma flocculosa PF-1]
 gb|EPQ29724.1| hypothetical protein PFL1_02944 [Pseudozyma flocculosa PF-1]
Length=82

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 32/64 (50%), Gaps = 0/64 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   RP +W  NT +   GI +    +   SA  E R + P +PIPS  W
Sbjct  9    YPKEVWSPAGGWWTRPKNWVSNTTVCAVGIAVATYGVWTYSADREWRHNPPTKPIPSMAW  68

Query  257  CKNF  268
             K F
Sbjct  69   AKQF  72



>emb|CEP16694.1| hypothetical protein [Parasitella parasitica]
Length=76

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 32/64 (50%), Gaps = 0/64 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VW+  GG   RP  WK NT +A  G+ +    +   SA  E R   P R IPS +W K F
Sbjct  13   VWSPAGGWWSRPKTWKANTIVAALGMAVTLGAVWRVSADKEVRYQQPKRWIPSMMWSKQF  72

Query  269  GTKE  280
              ++
Sbjct  73   KDQQ  76



>ref|XP_006957094.1| hypothetical protein WALSEDRAFT_59753 [Wallemia sebi CBS 633.66]
 gb|EIM23060.1| hypothetical protein WALSEDRAFT_59753 [Wallemia sebi CBS 633.66]
Length=90

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   VWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLWCKNF  268
            VWT  GG    P +WK NTA+    I  +   +   SA  E R   P R IPS +W + F
Sbjct  13   VWTPAGGWWTNPRNWKANTAVVFTAIGFLTYGVWNYSASKENRTREPSRWIPSMIWAREF  72



>emb|CCG84559.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=82

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (52%), Gaps = 0/62 (0%)
 Frame = +2

Query  77   FRAKVWTMTGGPNCRPVHWKRNTAIAMAGIVLICIPIAMKSAQLEQRPHNPVRPIPSQLW  256
            +  +VW+  GG   RP +W  NT +   GI  I   +   SA++E R   P R IPS +W
Sbjct  9    YPKQVWSPAGGWWSRPKNWASNTVVTAIGIASITAWVWSVSARIETRDKQPTRWIPSMMW  68

Query  257  CK  262
             K
Sbjct  69   SK  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400