BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN043P16

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006437446.1|  hypothetical protein CICLE_v10032936mg             249   1e-80   
ref|XP_011044458.1|  PREDICTED: V-type proton ATPase subunit H is...    258   6e-80   Populus euphratica
emb|CDP04145.1|  unnamed protein product                                254   7e-80   Coffea canephora [robusta coffee]
ref|XP_009608692.1|  PREDICTED: V-type proton ATPase subunit H          257   8e-80   Nicotiana tomentosiformis
ref|XP_009792608.1|  PREDICTED: V-type proton ATPase subunit H          257   9e-80   Nicotiana sylvestris
ref|XP_006437440.1|  hypothetical protein CICLE_v10031531mg             256   1e-79   
ref|XP_004509230.1|  PREDICTED: V-type proton ATPase subunit H-li...    256   2e-79   Cicer arietinum [garbanzo]
ref|XP_011044454.1|  PREDICTED: V-type proton ATPase subunit H is...    257   3e-79   Populus euphratica
ref|XP_007217990.1|  hypothetical protein PRUPE_ppa005592mg             256   3e-79   Prunus persica
gb|KHN44512.1|  V-type proton ATPase subunit H                          254   6e-79   Glycine soja [wild soybean]
ref|XP_003548002.1|  PREDICTED: V-type proton ATPase subunit H-li...    254   1e-78   Glycine max [soybeans]
ref|XP_006484607.1|  PREDICTED: V-type proton ATPase subunit H-li...    253   2e-78   Citrus sinensis [apfelsine]
gb|AIZ49542.1|  V-ATPase subunit H1                                     253   2e-78   Eriobotrya japonica [loquat]
gb|KDP39537.1|  hypothetical protein JCGZ_02557                         253   2e-78   Jatropha curcas
ref|XP_010087456.1|  V-type proton ATPase subunit H                     253   3e-78   Morus notabilis
ref|XP_007156009.1|  hypothetical protein PHAVU_003G250900g             254   3e-78   Phaseolus vulgaris [French bean]
ref|XP_008357071.1|  PREDICTED: V-type proton ATPase subunit H-like     253   3e-78   Malus domestica [apple tree]
ref|XP_009361140.1|  PREDICTED: V-type proton ATPase subunit H          253   3e-78   Pyrus x bretschneideri [bai li]
ref|XP_006343605.1|  PREDICTED: V-type proton ATPase subunit H-li...    253   5e-78   Solanum tuberosum [potatoes]
ref|XP_004307846.1|  PREDICTED: V-type proton ATPase subunit H          251   1e-77   Fragaria vesca subsp. vesca
ref|XP_003629515.1|  V-type proton ATPase subunit H                     251   1e-77   
ref|XP_002325805.1|  putative vacuolar ATPase subunit H family pr...    251   1e-77   
ref|XP_011084696.1|  PREDICTED: V-type proton ATPase subunit H-like     251   1e-77   Sesamum indicum [beniseed]
ref|XP_004242619.1|  PREDICTED: V-type proton ATPase subunit H          251   2e-77   Solanum lycopersicum
ref|XP_008343829.1|  PREDICTED: V-type proton ATPase subunit H-like     251   2e-77   
ref|XP_010662098.1|  PREDICTED: V-type proton ATPase subunit H          251   2e-77   Vitis vinifera
gb|ACJ85007.1|  unknown                                                 251   2e-77   Medicago truncatula
ref|XP_010251374.1|  PREDICTED: V-type proton ATPase subunit H          251   2e-77   Nelumbo nucifera [Indian lotus]
gb|AFK35511.1|  unknown                                                 250   2e-77   Lotus japonicus
gb|KFK33830.1|  hypothetical protein AALP_AA5G065600                    241   3e-77   Arabis alpina [alpine rockcress]
gb|AET03991.2|  vacuolar H+-ATPase subunit H, putative                  251   3e-77   Medicago truncatula
ref|XP_007029671.1|  Vacuolar ATP synthase subunit H family prote...    249   7e-77   
ref|XP_007029672.1|  Vacuolar ATP synthase subunit H family prote...    249   8e-77   
emb|CBI26482.3|  unnamed protein product                                250   8e-77   Vitis vinifera
ref|XP_006574707.1|  PREDICTED: V-type proton ATPase subunit H-like     249   8e-77   Glycine max [soybeans]
ref|XP_002520072.1|  vacuolar ATP synthase subunit h, putative          249   1e-76   
gb|KJB26714.1|  hypothetical protein B456_004G256400                    246   1e-76   Gossypium raimondii
gb|EYU39750.1|  hypothetical protein MIMGU_mgv1a006219mg                249   1e-76   Erythranthe guttata [common monkey flower]
gb|KJB18498.1|  hypothetical protein B456_003G056300                    249   2e-76   Gossypium raimondii
ref|XP_008800912.1|  PREDICTED: probable V-type proton ATPase sub...    248   2e-76   Phoenix dactylifera
ref|XP_006858816.1|  hypothetical protein AMTR_s00066p00170500          248   7e-76   
gb|EPS61013.1|  hypothetical protein M569_13786                         246   7e-76   Genlisea aurea
ref|XP_010912760.1|  PREDICTED: probable V-type proton ATPase sub...    245   9e-76   
gb|EYU39492.1|  hypothetical protein MIMGU_mgv1a006273mg                246   2e-75   Erythranthe guttata [common monkey flower]
ref|XP_010912758.1|  PREDICTED: probable V-type proton ATPase sub...    245   2e-75   
ref|XP_006855968.1|  hypothetical protein AMTR_s00037p00233030          236   3e-75   
ref|XP_010912757.1|  PREDICTED: probable V-type proton ATPase sub...    245   3e-75   Elaeis guineensis
gb|KHG22602.1|  V-type proton ATPase subunit H -like protein            246   5e-75   Gossypium arboreum [tree cotton]
gb|KJB26715.1|  hypothetical protein B456_004G256400                    245   5e-75   Gossypium raimondii
ref|XP_011077102.1|  PREDICTED: V-type proton ATPase subunit H-like     244   6e-75   Sesamum indicum [beniseed]
ref|XP_009615905.1|  PREDICTED: V-type proton ATPase subunit H-like     239   7e-75   Nicotiana tomentosiformis
ref|XP_010930282.1|  PREDICTED: probable V-type proton ATPase sub...    244   7e-75   Elaeis guineensis
emb|CDX69032.1|  BnaC01g04210D                                          244   8e-75   
ref|XP_008791825.1|  PREDICTED: probable V-type proton ATPase sub...    243   9e-75   
ref|XP_009115735.1|  PREDICTED: V-type proton ATPase subunit H-like     244   1e-74   Brassica rapa
gb|ACN34691.1|  unknown                                                 236   1e-74   Zea mays [maize]
ref|XP_008791823.1|  PREDICTED: probable V-type proton ATPase sub...    243   2e-74   Phoenix dactylifera
ref|XP_004136630.1|  PREDICTED: V-type proton ATPase subunit H-like     243   2e-74   Cucumis sativus [cucumbers]
ref|XP_010526971.1|  PREDICTED: V-type proton ATPase subunit H-like     243   2e-74   Tarenaya hassleriana [spider flower]
ref|XP_010547995.1|  PREDICTED: V-type proton ATPase subunit H          243   2e-74   Tarenaya hassleriana [spider flower]
ref|XP_008443235.1|  PREDICTED: V-type proton ATPase subunit H          242   5e-74   Cucumis melo [Oriental melon]
ref|XP_009416984.1|  PREDICTED: probable V-type proton ATPase sub...    242   6e-74   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY49280.1|  BnaA03g50930D                                          241   7e-74   Brassica napus [oilseed rape]
emb|CDX72455.1|  BnaC07g44770D                                          241   8e-74   
ref|XP_009138267.1|  PREDICTED: V-type proton ATPase subunit H          241   1e-73   Brassica rapa
ref|XP_010437658.1|  PREDICTED: V-type proton ATPase subunit H-li...    240   4e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010437659.1|  PREDICTED: V-type proton ATPase subunit H-li...    240   4e-73   
ref|XP_010432453.1|  PREDICTED: V-type proton ATPase subunit H-like     240   4e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006283723.1|  hypothetical protein CARUB_v10004791mg             239   5e-73   Capsella rubella
ref|XP_010447124.1|  PREDICTED: V-type proton ATPase subunit H          239   5e-73   Camelina sativa [gold-of-pleasure]
gb|KCW59595.1|  hypothetical protein EUGRSUZ_H02340                     239   6e-73   Eucalyptus grandis [rose gum]
ref|XP_010023341.1|  PREDICTED: V-type proton ATPase subunit H          239   9e-73   Eucalyptus grandis [rose gum]
ref|XP_010673864.1|  PREDICTED: V-type proton ATPase subunit H          238   2e-72   Beta vulgaris subsp. vulgaris [field beet]
emb|CAD27445.1|  putative vacuolar ATPase subunit H                     238   2e-72   Mesembryanthemum crystallinum
ref|XP_002869169.1|  vacuolar ATP synthase subunit H family protein     237   3e-72   
gb|AAO65974.1|  putative vacuolar ATPase subunit H protein              237   8e-72   Suaeda salsa
ref|NP_189791.1|  V-type proton ATPase subunit H                        236   9e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412262.1|  hypothetical protein EUTSA_v10025183mg             236   1e-71   
dbj|BAH20255.1|  AT3G42050                                              236   1e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006350112.1|  PREDICTED: V-type proton ATPase subunit H-like     236   1e-71   Solanum tuberosum [potatoes]
ref|XP_004957961.1|  PREDICTED: probable V-type proton ATPase sub...    236   1e-71   Setaria italica
gb|AAK59761.1|  AT3g42050/F4M19_10                                      236   1e-71   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA63056.1|  TPA: hypothetical protein ZEAMMB73_267119              233   2e-71   
gb|KHN00570.1|  Protein DA1-related 1                                   246   2e-71   Glycine soja [wild soybean]
ref|XP_004251740.1|  PREDICTED: V-type proton ATPase subunit H-like     235   2e-71   Solanum lycopersicum
emb|CDY57740.1|  BnaC03g77060D                                          235   3e-71   Brassica napus [oilseed rape]
ref|XP_006657814.1|  PREDICTED: probable V-type proton ATPase sub...    234   4e-71   Oryza brachyantha
ref|XP_009415033.1|  PREDICTED: probable V-type proton ATPase sub...    234   5e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002460834.1|  hypothetical protein SORBIDRAFT_02g035880          234   6e-71   Sorghum bicolor [broomcorn]
emb|CDX76266.1|  BnaA08g11340D                                          234   9e-71   
sp|Q84ZC0.1|VATH_ORYSJ  RecName: Full=Probable V-type proton ATPa...    233   1e-70   Oryza sativa Japonica Group [Japonica rice]
gb|ACF84665.1|  unknown                                                 233   1e-70   Zea mays [maize]
ref|NP_001146965.1|  vacuolar ATPase subunit H protein                  233   2e-70   Zea mays [maize]
ref|NP_001288363.1|  uncharacterized protein LOC103647744               233   3e-70   Zea mays [maize]
gb|EMS54494.1|  putative V-type proton ATPase subunit H                 232   3e-70   Triticum urartu
gb|EMT32310.1|  Putative V-type proton ATPase subunit H                 231   4e-70   
ref|XP_010237225.1|  PREDICTED: probable V-type proton ATPase sub...    232   5e-70   Brachypodium distachyon [annual false brome]
gb|EEC82241.1|  hypothetical protein OsI_26411                          233   5e-70   Oryza sativa Indica Group [Indian rice]
dbj|BAJ84958.1|  predicted protein                                      231   9e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002453051.1|  hypothetical protein SORBIDRAFT_04g037430          228   1e-68   
gb|ABG75917.1|  vacuolar proton ATPase subunit H                        226   7e-68   Triticum aestivum [Canadian hard winter wheat]
gb|ABR17502.1|  unknown                                                 218   1e-64   Picea sitchensis
tpg|DAA41086.1|  TPA: hypothetical protein ZEAMMB73_371057              219   1e-63   
emb|CAG27620.1|  putative vacuolar ATPase subunit H                     201   2e-62   Populus deltoides x Populus maximowiczii
gb|KDO40338.1|  hypothetical protein CISIN_1g034103mg                   198   3e-61   Citrus sinensis [apfelsine]
gb|KDO40334.1|  hypothetical protein CISIN_1g034108mg                   196   1e-60   Citrus sinensis [apfelsine]
gb|KDO40336.1|  hypothetical protein CISIN_1g034106mg                   196   3e-60   Citrus sinensis [apfelsine]
gb|AEG78652.1|  vacuolar H+-ATPase subunit H                            201   9e-60   Avena sativa [cultivated oat]
ref|XP_001756205.1|  predicted protein                                  202   1e-58   
ref|XP_002963102.1|  hypothetical protein SELMODRAFT_141399             200   6e-58   Selaginella moellendorffii
ref|XP_002980222.1|  hypothetical protein SELMODRAFT_444469             200   6e-58   
ref|XP_008234540.1|  PREDICTED: V-type proton ATPase subunit H          199   7e-58   Prunus mume [ume]
ref|XP_001761877.1|  predicted protein                                  197   1e-56   
ref|XP_006437443.1|  hypothetical protein CICLE_v10033985mg             157   4e-45   
gb|ABF50108.1|  vacuolar ATPase subunit H                               149   3e-42   Musa acuminata AAA Group [Cavendish banana]
ref|XP_002955475.1|  vacuolar ATP synthase, subunit H                   155   1e-40   Volvox carteri f. nagariensis
ref|XP_001689562.1|  vacuolar ATP synthase subunit H                    150   4e-39   Chlamydomonas reinhardtii
ref|XP_005646211.1|  vacuolar ATP synthase subunit H                    147   8e-38   Coccomyxa subellipsoidea C-169
gb|KDO49208.1|  hypothetical protein CISIN_1g0474481mg                  124   1e-32   Citrus sinensis [apfelsine]
ref|XP_011500008.1|  PREDICTED: V-type proton ATPase subunit H          128   5e-31   Ceratosolen solmsi marchali
gb|EFN88781.1|  Vacuolar proton pump subunit H                          127   1e-30   Harpegnathos saltator
ref|XP_011168339.1|  PREDICTED: V-type proton ATPase subunit H-like     125   1e-30   
ref|XP_011049528.1|  PREDICTED: V-type proton ATPase subunit H-like     125   1e-30   Acromyrmex echinatior
ref|XP_011150670.1|  PREDICTED: V-type proton ATPase subunit H is...    127   1e-30   Harpegnathos saltator
ref|XP_011150661.1|  PREDICTED: V-type proton ATPase subunit H is...    127   1e-30   Harpegnathos saltator
ref|XP_003425170.1|  PREDICTED: V-type proton ATPase subunit H is...    126   2e-30   Nasonia vitripennis
ref|XP_001605466.1|  PREDICTED: V-type proton ATPase subunit H is...    126   2e-30   Nasonia vitripennis
ref|XP_008217756.1|  PREDICTED: V-type proton ATPase subunit H is...    126   2e-30   Nasonia vitripennis
ref|XP_008217755.1|  PREDICTED: V-type proton ATPase subunit H is...    126   2e-30   Nasonia vitripennis
gb|EFZ22256.1|  hypothetical protein SINV_08430                         124   4e-30   
gb|ADR51673.1|  putative IgE binding protein                            120   6e-30   Culicoides nubeculosus
ref|XP_011329950.1|  PREDICTED: V-type proton ATPase subunit H is...    125   7e-30   
ref|XP_011329949.1|  PREDICTED: V-type proton ATPase subunit H is...    125   7e-30   
ref|XP_002680972.1|  vacuolar ATP synthase subunit H                    124   9e-30   Naegleria gruberi strain NEG-M
ref|XP_003394806.1|  PREDICTED: v-type proton ATPase subunit H-li...    124   1e-29   Bombus terrestris [large earth bumblebee]
ref|XP_003251675.1|  PREDICTED: V-type proton ATPase subunit H is...    124   1e-29   Apis mellifera [bee]
ref|XP_003394807.1|  PREDICTED: v-type proton ATPase subunit H-li...    124   1e-29   Bombus terrestris [large earth bumblebee]
ref|XP_006624436.1|  PREDICTED: V-type proton ATPase subunit H-li...    124   1e-29   Apis dorsata [rock honeybee]
ref|XP_006624437.1|  PREDICTED: V-type proton ATPase subunit H-li...    124   1e-29   Apis dorsata [rock honeybee]
ref|XP_006624435.1|  PREDICTED: V-type proton ATPase subunit H-li...    124   2e-29   Apis dorsata [rock honeybee]
ref|XP_003692426.1|  PREDICTED: V-type proton ATPase subunit H-like     124   2e-29   
ref|XP_006570954.1|  PREDICTED: V-type proton ATPase subunit H is...    124   2e-29   Apis mellifera [bee]
ref|XP_003251676.1|  PREDICTED: V-type proton ATPase subunit H is...    124   2e-29   Apis mellifera [bee]
ref|XP_003701718.1|  PREDICTED: V-type proton ATPase subunit H-li...    123   2e-29   
ref|XP_003701719.1|  PREDICTED: V-type proton ATPase subunit H-li...    123   2e-29   
ref|XP_011302355.1|  PREDICTED: V-type proton ATPase subunit H is...    122   3e-29   Fopius arisanus
ref|XP_008547205.1|  PREDICTED: V-type proton ATPase subunit H is...    122   4e-29   Microplitis demolitor
ref|XP_011302354.1|  PREDICTED: V-type proton ATPase subunit H is...    122   4e-29   Fopius arisanus
ref|XP_002500993.1|  H+-or Na+-translocating f-type, v-type and A...    122   4e-29   Micromonas commoda
ref|XP_008547204.1|  PREDICTED: V-type proton ATPase subunit H is...    122   4e-29   Microplitis demolitor
emb|CEF98096.1|  Armadillo-type fold                                    122   6e-29   Ostreococcus tauri
ref|XP_011398291.1|  putative V-type proton ATPase subunit H            122   6e-29   Auxenochlorella protothecoides
ref|XP_011266061.1|  PREDICTED: V-type proton ATPase subunit H is...    122   6e-29   
ref|XP_003079498.1|  putative vacuolar ATPase subunit H protein (...    122   7e-29   
ref|XP_011266060.1|  PREDICTED: V-type proton ATPase subunit H is...    122   8e-29   
ref|XP_004367300.1|  vacuolar ATP synthase subunit H                    122   8e-29   Cavenderia fasciculata
gb|AHF70968.1|  vacuolar ATP synthase subunit H                         120   2e-28   Mythimna separata [ear-cutting caterpillar]
emb|CDO69013.1|  hypothetical protein BN946_scf184834.g20               120   2e-28   Trametes cinnabarina
gb|AFN11665.1|  vacuolar ATPase subunit H                               120   2e-28   Locusta migratoria manilensis
dbj|BAM18133.1|  vacuolar H[+]-ATPase SFD subunit                       120   3e-28   Papilio xuthus [Chinese swallowtail]
gb|KIL69551.1|  hypothetical protein M378DRAFT_97213                    119   3e-28   Amanita muscaria Koide BX008
gb|EHJ66535.1|  hypothetical protein KGM_18477                          120   3e-28   
ref|XP_001418079.1|  F-ATPase family transporter: protons (vacuolar)    113   4e-28   Ostreococcus lucimarinus CCE9901
gb|EFA79805.1|  vacuolar ATP synthase subunit H                         114   4e-28   Heterostelium album PN500
gb|KFM65821.1|  V-type proton ATPase subunit H                          119   6e-28   Stegodyphus mimosarum
ref|XP_004929804.1|  PREDICTED: V-type proton ATPase subunit H-like     119   8e-28   
ref|XP_009308551.1|  ATP synthase                                       119   8e-28   Trypanosoma grayi
ref|NP_001040488.1|  vacuolar ATP synthase subunit H                    119   9e-28   Bombyx mori [silk moth]
ref|XP_005181998.1|  PREDICTED: V-type proton ATPase subunit H          119   9e-28   Musca domestica
ref|XP_011413699.1|  PREDICTED: V-type proton ATPase subunit H-li...    119   9e-28   Crassostrea gigas
ref|XP_011413698.1|  PREDICTED: V-type proton ATPase subunit H-li...    118   1e-27   Crassostrea gigas
ref|XP_011413697.1|  PREDICTED: V-type proton ATPase subunit H-li...    118   1e-27   Crassostrea gigas
sp|Q9U5N0.1|VATH_MANSE  RecName: Full=V-type proton ATPase subuni...    118   1e-27   Manduca sexta [Carolina sphinx]
ref|XP_011413696.1|  PREDICTED: V-type proton ATPase subunit H-li...    119   2e-27   Crassostrea gigas
ref|NP_523585.2|  vacuolar H[+]-ATPase SFD subunit, isoform A           117   2e-27   Drosophila melanogaster
ref|XP_001965291.1|  GF24362                                            118   2e-27   Drosophila ananassae
ref|NP_723993.1|  vacuolar H[+]-ATPase SFD subunit, isoform D           117   2e-27   Drosophila melanogaster
ref|XP_002079663.1|  GD21903                                            118   2e-27   Drosophila simulans
gb|KFG29320.1|  putative vacuolar ATP synthase subunit H                112   2e-27   Toxoplasma gondii p89
ref|XP_002014753.1|  GL19340                                            118   2e-27   Drosophila persimilis
ref|NP_723992.1|  vacuolar H[+]-ATPase SFD subunit, isoform B           118   2e-27   Drosophila melanogaster
ref|XP_002038845.1|  GM17165                                            118   2e-27   Drosophila sechellia
ref|XP_002064801.1|  GK15126                                            118   2e-27   Drosophila willistoni
ref|XP_001988830.1|  GH10362                                            118   2e-27   Drosophila grimshawi
ref|XP_002051650.1|  GJ11146                                            118   2e-27   Drosophila virilis
ref|XP_002003753.1|  GI21354                                            118   3e-27   Drosophila mojavensis
dbj|BAN20615.1|  vacuolar H[+] ATPase subunit                           117   3e-27   Riptortus pedestris
gb|KFB39891.1|  vacuolar ATP synthase subunit h                         117   3e-27   Anopheles sinensis
emb|CCO31419.1|  V-type H+-transporting ATPase 54 kD subunit            112   3e-27   Rhizoctonia solani AG-1 IB
ref|XP_010014842.1|  PREDICTED: V-type proton ATPase subunit H          113   3e-27   Nestor notabilis
gb|AHM92104.1|  vATPase subunit H                                       117   3e-27   Aphis gossypii [melon aphid]
gb|ETN60671.1|  ATPase SFD subunit                                      117   4e-27   Anopheles darlingi [American malaria mosquito]
ref|XP_003387765.1|  PREDICTED: V-type proton ATPase subunit H-like     116   4e-27   
gb|KDQ60593.1|  hypothetical protein JAAARDRAFT_31557                   116   4e-27   Jaapia argillacea MUCL 33604
ref|XP_005709836.1|  unnamed protein product                            116   6e-27   Chondrus crispus [carageen]
gb|EPZ30805.1|  V-type proton ATPase subunit H-like protein             116   6e-27   Rozella allomycis CSF55
ref|XP_310211.4|  AGAP009486-PA                                         116   8e-27   Anopheles gambiae str. PEST
ref|XP_001949116.3|  PREDICTED: V-type proton ATPase subunit H          116   8e-27   Acyrthosiphon pisum
gb|KDR12485.1|  V-type proton ATPase subunit H                          116   8e-27   Zootermopsis nevadensis
ref|XP_966693.3|  PREDICTED: V-type proton ATPase subunit H isofo...    116   9e-27   Tribolium castaneum [rust-red flour beetle]
ref|XP_003379257.1|  vacuolar proton pump subunit H                     116   1e-26   Trichinella spiralis
dbj|GAM29018.1|  hypothetical protein SAMD00019534_121940               115   1e-26   Acytostelium subglobosum LB1
ref|XP_004329545.1|  PREDICTED: V-type proton ATPase subunit H-like     113   1e-26   
ref|XP_002736386.1|  PREDICTED: V-type proton ATPase subunit H-like     115   1e-26   Saccoglossus kowalevskii
gb|AHF70969.1|  vacuolar ATP synthase subunit H                         115   1e-26   Agrotis ipsilon [dark sword grass moth]
ref|NP_001280516.1|  V-type proton ATPase subunit H                     116   1e-26   Tribolium castaneum [rust-red flour beetle]
gb|KIM32034.1|  hypothetical protein M408DRAFT_327392                   115   1e-26   Serendipita vermifera MAFF 305830
gb|EKF99745.1|  ATP synthase, putative                                  115   1e-26   Trypanosoma cruzi
ref|XP_008467401.1|  PREDICTED: V-type proton ATPase subunit H          115   2e-26   Diaphorina citri
emb|CCA75096.1|  related to vacuolar ATP synthase subunit H             115   2e-26   Serendipita indica DSM 11827
gb|AEE62279.1|  unknown                                                 115   2e-26   Dendroctonus ponderosae
gb|KDD71741.1|  V-ATPase subunit H                                      110   2e-26   Helicosporidium sp. ATCC 50920
gb|ENN77808.1|  hypothetical protein YQE_05692                          115   2e-26   Dendroctonus ponderosae
ref|XP_009020251.1|  hypothetical protein HELRODRAFT_81462              114   2e-26   Helobdella robusta
ref|XP_007863478.1|  ATPase, V1 complex, subunit H                      114   2e-26   Gloeophyllum trabeum ATCC 11539
dbj|GAM26531.1|  hypothetical protein SAMD00019534_097060               114   2e-26   Acytostelium subglobosum LB1
gb|EFX87781.1|  hypothetical protein DAPPUDRAFT_306505                  114   3e-26   Daphnia pulex
ref|XP_811617.1|  ATP synthase                                          114   3e-26   Trypanosoma cruzi strain CL Brener
gb|KIO27114.1|  hypothetical protein M407DRAFT_73717                    114   3e-26   Tulasnella calospora MUT 4182
gb|EKF31005.1|  ATP synthase, putative                                  114   3e-26   Trypanosoma cruzi marinkellei
gb|KHJ43624.1|  v-ATPase subunit H                                      114   4e-26   Trichuris suis
ref|XP_009063312.1|  hypothetical protein LOTGIDRAFT_207139             114   4e-26   Lottia gigantea
ref|XP_006495502.1|  PREDICTED: V-type proton ATPase subunit H is...    112   4e-26   Mus musculus [mouse]
gb|ERL95137.1|  hypothetical protein D910_12406                         114   4e-26   Dendroctonus ponderosae
gb|KIM87633.1|  hypothetical protein PILCRDRAFT_815209                  114   5e-26   Piloderma croceum F 1598
gb|KDQ13172.1|  hypothetical protein BOTBODRAFT_33784                   114   5e-26   Botryobasidium botryosum FD-172 SS1
gb|KGL78057.1|  V-type proton ATPase subunit H                          112   5e-26   Tinamus guttatus
ref|XP_010214153.1|  PREDICTED: V-type proton ATPase subunit H          112   5e-26   Tinamus guttatus
ref|XP_002319248.2|  hypothetical protein POPTR_0013s07630g             113   6e-26   
ref|XP_002114416.1|  hypothetical protein TRIADDRAFT_36227              113   6e-26   Trichoplax adhaerens
ref|XP_009860941.1|  PREDICTED: V-type proton ATPase subunit H is...    113   6e-26   
gb|ETN73338.1|  putative V-type proton ATPase subunit H                 113   6e-26   Necator americanus
ref|XP_003118009.1|  hypothetical protein CRE_00471                     112   6e-26   Caenorhabditis remanei
ref|XP_820568.1|  ATP synthase                                          113   6e-26   Trypanosoma cruzi strain CL Brener
gb|EYC09284.1|  hypothetical protein Y032_0061g3257                     113   6e-26   Ancylostoma ceylanicum
gb|ERE85970.1|  V-type proton ATPase subunit H                          113   7e-26   Cricetulus griseus [Chinese hamsters]
gb|ERL95136.1|  hypothetical protein D910_12406                         114   7e-26   Dendroctonus ponderosae
ref|XP_009499916.1|  PREDICTED: V-type proton ATPase subunit H          112   7e-26   Phalacrocorax carbo [common cormorant]
ref|XP_002123830.1|  PREDICTED: V-type proton ATPase subunit H is...    113   7e-26   
ref|XP_002428318.1|  vacuolar ATP synthase subunit H, putative          113   7e-26   Pediculus humanus corporis [human body lice]
gb|EFO25176.2|  vacuolar h ATPase 15                                    113   7e-26   Loa loa
gb|EGW09777.1|  V-type proton ATPase subunit H                          113   8e-26   Cricetulus griseus [Chinese hamsters]
ref|XP_010125506.1|  PREDICTED: V-type proton ATPase subunit H          111   8e-26   Chlamydotis macqueenii
ref|XP_001652018.1|  AAEL006516-PA                                      113   8e-26   Aedes aegypti
gb|ESL11474.1|  ATP synthase                                            113   8e-26   Trypanosoma rangeli SC58
ref|XP_011213954.1|  PREDICTED: V-type proton ATPase subunit H is...    113   8e-26   Bactrocera dorsalis [papaya fruit fly]
ref|XP_003291419.1|  hypothetical protein DICPUDRAFT_156018             113   8e-26   Dictyostelium purpureum
ref|XP_009946371.1|  PREDICTED: V-type proton ATPase subunit H          112   8e-26   Leptosomus discolor
ref|XP_009811839.1|  PREDICTED: V-type proton ATPase subunit H          112   8e-26   Gavia stellata
ref|XP_003879871.1|  putative vacuolar ATP synthase subunit h           113   9e-26   Neospora caninum Liverpool
ref|XP_011189552.1|  PREDICTED: V-type proton ATPase subunit H is...    113   9e-26   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_004536257.1|  PREDICTED: V-type proton ATPase subunit H-li...    113   9e-26   Ceratitis capitata [medfly]
ref|XP_008869403.1|  hypothetical protein H310_06210                    113   9e-26   Aphanomyces invadans
ref|XP_007428279.1|  PREDICTED: V-type proton ATPase subunit H is...    113   9e-26   Python bivittatus
ref|XP_001844037.1|  vacuolar ATP synthase subunit H                    113   1e-25   Culex quinquefasciatus
ref|XP_010199764.1|  PREDICTED: V-type proton ATPase subunit H          112   1e-25   Colius striatus
ref|XP_003138894.1|  vacuolar h ATPase 15                               112   1e-25   
ref|XP_011213953.1|  PREDICTED: V-type proton ATPase subunit H is...    114   1e-25   Bactrocera dorsalis [papaya fruit fly]
gb|EPY36528.1|  V-type H+-transporting ATPase 54 kD subunit             111   1e-25   Strigomonas culicis
ref|XP_006495500.1|  PREDICTED: V-type proton ATPase subunit H is...    111   1e-25   Mus musculus [mouse]
ref|XP_008842646.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   
ref|XP_007904109.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   Callorhinchus milii [Australian ghost shark]
ref|XP_008542739.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   Equus przewalskii [Przewalski horse]
ref|XP_008542740.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   Equus przewalskii [Przewalski horse]
ref|XP_007384849.1|  ATPase V1 complex subunit H                        112   1e-25   Punctularia strigosozonata HHB-11173 SS5
ref|XP_010586612.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   
ref|XP_004536256.1|  PREDICTED: V-type proton ATPase subunit H-li...    113   1e-25   Ceratitis capitata [medfly]
ref|XP_010707226.1|  PREDICTED: V-type proton ATPase subunit H          112   1e-25   Meleagris gallopavo [common turkey]
gb|AFM90690.1|  ATPase, H+ transporting, lysosomal, V1 subunit H        112   1e-25   Callorhinchus milii [Australian ghost shark]
ref|XP_006495499.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   Mus musculus [mouse]
ref|XP_004410076.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   Odobenus rosmarus divergens
ref|XP_006495498.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   
ref|XP_011189551.1|  PREDICTED: V-type proton ATPase subunit H is...    113   1e-25   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_007998823.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   Chlorocebus sabaeus
ref|XP_006924026.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   
ref|NP_001279139.1|  ATPase, H+ transporting, lysosomal 50/57kDa,...    112   1e-25   Callorhinchus milii [Australian ghost shark]
ref|XP_005638032.1|  PREDICTED: V-type proton ATPase subunit H is...    112   1e-25   
ref|XP_004602396.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   Sorex araneus [Eurasian shrew]
ref|XP_010152360.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   Eurypyga helias
ref|XP_005857374.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004679936.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004602395.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_002369639.1|  vacuolar ATP synthase subunit H, putative          114   2e-25   
ref|XP_003793749.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_009925501.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_003759824.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_005892054.1|  PREDICTED: V-type proton ATPase subunit H-like     112   2e-25   
ref|XP_006924025.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_006994248.1|  PREDICTED: V-type proton ATPase subunit H-li...    112   2e-25   
ref|XP_009969574.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_004011727.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004011726.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005215461.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_007064175.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_008886854.1|  vacuolar ATP synthase subunit 54kD, putative       112   2e-25   
ref|XP_010586613.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_006769145.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005857375.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
gb|KFO20474.1|  V-type proton ATPase subunit H                          115   2e-25   
tpg|DAA22751.1|  TPA: V-type proton ATPase subunit H                    112   2e-25   
ref|XP_007090622.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005322961.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004410073.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
gb|AAH09154.1|  ATPase, H+ transporting, lysosomal V1 subunit H         112   2e-25   
ref|XP_007464083.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004275066.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_003999861.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
gb|KFH15544.1|  putative vacuolar ATP synthase subunit 54kD             112   2e-25   
gb|EPR57971.1|  putative vacuolar ATP synthase subunit 54kD             112   2e-25   
ref|XP_008495780.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_006077052.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005638031.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005362304.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004479904.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004679937.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_003999862.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_009925491.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004479906.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_008141569.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_008253747.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_007090623.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
gb|ELK02307.1|  V-type proton ATPase subunit H                          112   2e-25   
ref|XP_003408364.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_006112246.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_009078245.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004410075.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_003975495.1|  PREDICTED: V-type proton ATPase subunit H-like     112   2e-25   
ref|XP_010609402.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005613222.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_544082.2|  PREDICTED: V-type proton ATPase subunit H isofo...    112   2e-25   
ref|XP_007168671.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
gb|ADI40572.1|  lysosomal H+-transporting ATPase V1 subunit H           112   2e-25   
ref|XP_007105305.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004479905.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004435757.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_003466039.2|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_004653416.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|NP_598587.2|  V-type proton ATPase subunit H                        112   2e-25   
ref|XP_007950399.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_007516039.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004697613.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
emb|CAG12279.1|  unnamed protein product                                112   2e-25   
ref|XP_006140948.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004633431.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
sp|Q9TVC1.1|VATH_PIG  RecName: Full=V-type proton ATPase subunit ...    112   2e-25   
ref|XP_003940899.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004887507.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
gb|ADI40571.1|  lysosomal H+-transporting ATPase V1 subunit H           112   2e-25   
ref|XP_004275067.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_010586611.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_007168672.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_007105306.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004375665.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_008761746.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_006077050.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_007090621.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_010185105.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005301264.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_006994249.1|  PREDICTED: V-type proton ATPase subunit H-li...    112   2e-25   
ref|XP_007950398.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_006745755.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_009901987.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_005613224.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_008048661.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_004697612.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|NP_999405.1|  V-type proton ATPase subunit H                        112   2e-25   
ref|XP_003428501.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_006237863.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_006112245.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_009706097.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_005966485.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_007464084.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|NP_001184255.1|  V-type proton ATPase subunit H                     112   2e-25   
ref|XP_006769146.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005322963.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004375664.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005152605.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_005362305.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_007516038.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
dbj|BAG64316.1|  unnamed protein product                                112   2e-25   
ref|XP_010141561.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_004435755.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_003506606.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
sp|O46563.2|VATH_BOVIN  RecName: Full=V-type proton ATPase subuni...    112   2e-25   
ref|XP_009984629.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005240812.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_006495497.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_009568732.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_006871918.1|  PREDICTED: V-type proton ATPase subunit H-li...    112   2e-25   
ref|XP_009935988.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
emb|CCC51018.1|  putative ATP synthase                                  112   2e-25   
ref|XP_005396120.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_009638644.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_009287620.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_006900599.1|  PREDICTED: V-type proton ATPase subunit H-like     112   2e-25   
ref|XP_009078254.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_006259999.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_003793747.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_008495781.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_009671845.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_008643145.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_002197593.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
gb|EGT30336.1|  hypothetical protein CAEBREN_09708                      110   2e-25   
ref|XP_006023922.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005506565.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_001564860.1|  putative ATP synthase                              112   2e-25   
gb|ETE73254.1|  V-type proton ATPase subunit H                          112   2e-25   
ref|XP_010185106.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_008253748.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004653417.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_010169924.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_009575443.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_008842643.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_002758941.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
gb|EHH28502.1|  V-type proton ATPase subunit H                          112   2e-25   
ref|XP_009638645.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_008938694.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005396122.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_003734984.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
emb|CBH14994.1|  ATP synthase, putative                                 112   2e-25   
ref|XP_009478934.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_006237866.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004887509.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_004633432.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_003793748.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_001515221.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
gb|KIJ17095.1|  hypothetical protein PAXINDRAFT_111825                  109   2e-25   
ref|NP_001016182.1|  V-type proton ATPase subunit H                     112   2e-25   
ref|XP_822331.1|  ATP synthase                                          112   2e-25   
ref|XP_005042123.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
gb|EOA97074.1|  Vacuolar proton pump subunit H                          112   2e-25   
ref|XP_007338813.1|  ATPase, V1 complex, subunit H                      111   2e-25   
gb|ELK26175.1|  V-type proton ATPase subunit H                          112   2e-25   
gb|EAW86730.1|  ATPase, H+ transporting, lysosomal 50/57kDa, V1 s...    111   2e-25   
ref|XP_008901144.1|  hypothetical protein PPTG_07998                    112   2e-25   
ref|XP_009984630.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_009935989.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005025557.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_007645254.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_005418370.1|  PREDICTED: V-type proton ATPase subunit H          112   2e-25   
ref|XP_010285565.1|  PREDICTED: V-type proton ATPase subunit H          111   2e-25   
ref|XP_005025556.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|XP_008842645.1|  PREDICTED: V-type proton ATPase subunit H is...    112   2e-25   
ref|NP_001270161.1|  uncharacterized protein LOC101926423               112   2e-25   
ref|XP_003902802.1|  PREDICTED: V-type proton ATPase subunit H is...    112   3e-25   
ref|XP_005479350.1|  PREDICTED: V-type proton ATPase subunit H          112   3e-25   
ref|XP_005025558.1|  PREDICTED: V-type proton ATPase subunit H is...    111   3e-25   
ref|XP_009925475.1|  PREDICTED: V-type proton ATPase subunit H is...    112   3e-25   
ref|XP_005085988.1|  PREDICTED: V-type proton ATPase subunit H          112   3e-25   
gb|KHJ79525.1|  v-ATPase subunit H                                      111   3e-25   
gb|EMC87078.1|  V-type proton ATPase subunit H                          112   3e-25   
ref|NP_001089309.1|  ATPase, H+ transporting, lysosomal 50/57kDa,...    112   3e-25   
ref|XP_003224355.1|  PREDICTED: V-type proton ATPase subunit H          112   3e-25   
ref|XP_006023923.1|  PREDICTED: V-type proton ATPase subunit H is...    111   3e-25   
dbj|BAG53609.1|  unnamed protein product                                112   3e-25   
ref|NP_998785.1|  V-type proton ATPase subunit H isoform 1              112   3e-25   
gb|AAD27720.1|AF132945_1  CGI-11 protein                                112   3e-25   
ref|XP_009925483.1|  PREDICTED: V-type proton ATPase subunit H is...    111   3e-25   
ref|XP_008921674.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    112   3e-25   
ref|XP_001634877.1|  predicted protein                                  111   3e-25   
ref|NP_998784.1|  V-type proton ATPase subunit H isoform 2              111   3e-25   
emb|CEL55783.1|  V-type H+-transporting ATPase 54 kD subunit            111   3e-25   
ref|XP_007487188.1|  PREDICTED: V-type proton ATPase subunit H is...    112   3e-25   
ref|XP_007487189.1|  PREDICTED: V-type proton ATPase subunit H is...    111   3e-25   
ref|NP_001126091.1|  V-type proton ATPase subunit H                     111   3e-25   
ref|XP_002090530.1|  GE13171                                            112   3e-25   
ref|XP_006634089.1|  PREDICTED: V-type proton ATPase subunit H-like     111   3e-25   
emb|CAJ20578.1|  vacuolar ATP synthase subunit h, putative              111   3e-25   
ref|XP_005845340.1|  hypothetical protein CHLNCDRAFT_32265              111   3e-25   
gb|AAC02986.1|  vacuolar proton pump subunit SFD beta isoform           111   3e-25   
ref|XP_009453663.1|  PREDICTED: V-type proton ATPase subunit H          111   3e-25   
ref|XP_001976245.1|  GG20115                                            112   3e-25   
gb|AAC02987.1|  vacuolar proton pump subunit SFD alpha isoform          111   3e-25   
gb|EMD38663.1|  hypothetical protein CERSUDRAFT_113838                  111   4e-25   
ref|XP_004333409.1|  vacuolar atp synthase subunit h, putative          108   4e-25   
emb|CCC93300.1|  putative ATP synthase                                  112   4e-25   
gb|EUC56956.1|  V-type proton ATPase subunit H                          111   4e-25   
ref|XP_002590036.1|  hypothetical protein BRAFLDRAFT_281437             111   4e-25   
gb|KEP50199.1|  V-type proton ATPase subunit H                          110   5e-25   
ref|XP_010698941.1|  ATP synthase, putative                             111   5e-25   
gb|EXX71257.1|  Vma13p                                                  110   5e-25   
emb|CDJ90774.1|  ATPase and Pseudouridine synthase I domain conta...    113   5e-25   
gb|KIK40766.1|  hypothetical protein CY34DRAFT_86648                    110   5e-25   
gb|EPT05401.1|  ATPase V1 complex subunit H                             110   6e-25   
ref|XP_009529196.1|  hypothetical protein PHYSODRAFT_505321             110   6e-25   
ref|XP_010987846.1|  PREDICTED: V-type proton ATPase subunit H          110   6e-25   
ref|XP_007321482.1|  hypothetical protein SERLADRAFT_474431             110   6e-25   
ref|XP_001833472.1|  MSTP042                                            110   6e-25   
ref|XP_006191105.1|  PREDICTED: V-type proton ATPase subunit H is...    110   6e-25   
gb|EPY38074.1|  V-type H+-transporting ATPase 54 kD subunit             109   6e-25   
ref|XP_006191106.1|  PREDICTED: V-type proton ATPase subunit H is...    110   7e-25   
emb|CDQ03625.1|  Protein BM-VHA-15, isoform a                           110   7e-25   
gb|KIM53725.1|  hypothetical protein SCLCIDRAFT_1222591                 110   7e-25   
ref|XP_009542498.1|  V-ATPase, subunit H                                110   8e-25   
ref|XP_003118376.1|  CRE-VHA-15 protein                                 110   8e-25   
ref|XP_010968999.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    110   8e-25   
gb|ELW71992.1|  V-type proton ATPase subunit H                          112   8e-25   
gb|ESA21230.1|  hypothetical protein GLOINDRAFT_343254                  110   8e-25   
ref|XP_005993507.1|  PREDICTED: V-type proton ATPase subunit H is...    110   9e-25   
ref|XP_002909335.1|  V-type proton ATPase subunit H, putative           110   9e-25   



>ref|XP_006437446.1| hypothetical protein CICLE_v10032936mg [Citrus clementina]
 gb|ESR50686.1| hypothetical protein CICLE_v10032936mg [Citrus clementina]
Length=163

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN K+LSS DKY QEVLLGHLDWSPMHKDP FWRDNITNFEENDFQILRVL+TILDT
Sbjct  33   GLKDNTKRLSSLDKYMQEVLLGHLDWSPMHKDPLFWRDNITNFEENDFQILRVLLTILDT  92

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLF
Sbjct  93   SSDPRALAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLF  152

Query  362  LGAKYASFLQV  394
            LGAKYASFLQ 
Sbjct  153  LGAKYASFLQA  163



>ref|XP_011044458.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Populus 
euphratica]
Length=452

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWR+NITNFEENDFQILRVLITILDT
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRENITNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR LAVACFDLSQFIQ HPAGRVIV DLK KER MKL+NHEN EVTKNALLCIQRLF
Sbjct  382  SNDPRALAVACFDLSQFIQHHPAGRVIVADLKTKERVMKLMNHENAEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  442  LGAKYASFLQV  452



>emb|CDP04145.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NIT FEENDFQILRVLITILDT
Sbjct  240  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENITTFEENDFQILRVLITILDT  299

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            ++DPRTLAVACFDLSQFIQ HPAGRVIVTDLKAK+R MKL+NHEN EVTKNALLCIQRLF
Sbjct  300  ANDPRTLAVACFDLSQFIQHHPAGRVIVTDLKAKDRVMKLMNHENGEVTKNALLCIQRLF  359

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  360  LGAKYASFLQV  370



>ref|XP_009608692.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana tomentosiformis]
 ref|XP_009608693.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana tomentosiformis]
Length=454

 Score =   257 bits (657),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NI +FEENDFQILRVLITILDT
Sbjct  324  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENINSFEENDFQILRVLITILDT  383

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPRTLAVAC+DLSQFIQCH AGR+IV DLKAKER MKLLNHEN EVTKNALLCIQRLF
Sbjct  384  SSDPRTLAVACYDLSQFIQCHSAGRIIVNDLKAKERVMKLLNHENAEVTKNALLCIQRLF  443

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  444  LGAKYASFLQV  454



>ref|XP_009792608.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana sylvestris]
Length=454

 Score =   257 bits (656),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NI +FEENDFQILRVLITILDT
Sbjct  324  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENINSFEENDFQILRVLITILDT  383

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPRTLAVAC+DLSQFIQCH AGR+IV DLKAKER MKLLNHEN EVTKNALLCIQRLF
Sbjct  384  SSDPRTLAVACYDLSQFIQCHSAGRIIVNDLKAKERVMKLLNHENAEVTKNALLCIQRLF  443

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  444  LGAKYASFLQV  454



>ref|XP_006437440.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 ref|XP_006437441.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 gb|ESR50680.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 gb|ESR50681.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
Length=447

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIK+LSSFDKYKQEVLLGHLDWSPMHKDP FWRDNITNFEENDFQILRVL+TILDT
Sbjct  317  GLKDNIKRLSSFDKYKQEVLLGHLDWSPMHKDPLFWRDNITNFEENDFQILRVLLTILDT  376

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLF
Sbjct  377  SSDPRALAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLF  436

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  437  LGAKYASFLQ  446



>ref|XP_004509230.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Cicer 
arietinum]
 ref|XP_004509231.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Cicer 
arietinum]
Length=452

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLG+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILDT
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPRTLAVACFD+SQFIQCHPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLF
Sbjct  382  SNDPRTLAVACFDISQFIQCHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  442  LGAKYASFLQV  452



>ref|XP_011044454.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044455.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044456.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044457.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
Length=483

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWR+NITNFEENDFQILRVLITILDT
Sbjct  353  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRENITNFEENDFQILRVLITILDT  412

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR LAVACFDLSQFIQ HPAGRVIV DLK KER MKL+NHEN EVTKNALLCIQRLF
Sbjct  413  SNDPRALAVACFDLSQFIQHHPAGRVIVADLKTKERVMKLMNHENAEVTKNALLCIQRLF  472

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  473  LGAKYASFLQV  483



>ref|XP_007217990.1| hypothetical protein PRUPE_ppa005592mg [Prunus persica]
 gb|EMJ19189.1| hypothetical protein PRUPE_ppa005592mg [Prunus persica]
Length=452

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+N+TNFEENDFQILRVLITILDT
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENVTNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFD+SQF+Q HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  382  SSDPRALAVACFDISQFVQQHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>gb|KHN44512.1| V-type proton ATPase subunit H [Glycine soja]
Length=428

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIK+LSSFD YKQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDT
Sbjct  298  GLKDNIKRLSSFDMYKQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDT  357

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPRTLAVAC+DLSQFIQCH AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  358  SNDPRTLAVACYDLSQFIQCHSAGRIIVSDLKAKERVMKLMNHENAEVTKNALLCIQRLF  417

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  418  LGAKYASFLQV  428



>ref|XP_003548002.1| PREDICTED: V-type proton ATPase subunit H-like isoform 2 [Glycine 
max]
Length=452

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIK+LSSFD YKQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDT
Sbjct  322  GLKDNIKRLSSFDMYKQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPRTLAVAC+DLSQFIQCH AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  382  SNDPRTLAVACYDLSQFIQCHSAGRIIVSDLKAKERVMKLMNHENAEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  442  LGAKYASFLQV  452



>ref|XP_006484607.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484608.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Citrus 
sinensis]
Length=452

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIK+LSSFDKYKQEVLLGHLDWSPMHKDP FWRDNITNFEENDFQILRVL+TIL T
Sbjct  322  GLKDNIKRLSSFDKYKQEVLLGHLDWSPMHKDPLFWRDNITNFEENDFQILRVLLTILHT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLF
Sbjct  382  SSDPRALAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLF  441

Query  362  LGAKYASFLQV  394
            LGAKYASFLQ 
Sbjct  442  LGAKYASFLQA  452



>gb|AIZ49542.1| V-ATPase subunit H1 [Eriobotrya japonica]
Length=452

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDT
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENITNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFD+SQF+Q HPAGRVIVTDLKAKER MKL++HE+ EVTKNALLCIQRLF
Sbjct  382  SSDPRALAVACFDISQFVQQHPAGRVIVTDLKAKERVMKLMDHESAEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>gb|KDP39537.1| hypothetical protein JCGZ_02557 [Jatropha curcas]
Length=439

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GL+DNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDT
Sbjct  309  GLRDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDT  368

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR LAV CFDLSQFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  369  SNDPRALAVGCFDLSQFIQYHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLF  428

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  429  LGAKYASFLQ  438



>ref|XP_010087456.1| V-type proton ATPase subunit H [Morus notabilis]
 gb|EXB29137.1| V-type proton ATPase subunit H [Morus notabilis]
Length=453

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKL SFDKYKQEVLL HLDWSPMHKDPAFWR+N TNFEENDFQILRVL+TILDT
Sbjct  323  GLKDNIKKLRSFDKYKQEVLLAHLDWSPMHKDPAFWRENATNFEENDFQILRVLLTILDT  382

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  383  SSDPRALAVACFDLSQFIQHHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLF  442

Query  362  LGAKYASFLQV  394
            LGAKYASFLQ 
Sbjct  443  LGAKYASFLQA  453



>ref|XP_007156009.1| hypothetical protein PHAVU_003G250900g [Phaseolus vulgaris]
 gb|ESW28003.1| hypothetical protein PHAVU_003G250900g [Phaseolus vulgaris]
Length=491

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFD YKQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQI RVLITILDT
Sbjct  361  GLKDNIKKLSSFDMYKQEVLLGHLDWSPMHKDPIFWRENITNFEENDFQIPRVLITILDT  420

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPRTLAVAC+D+SQFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  421  SSDPRTLAVACYDISQFIQHHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLF  480

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  481  LGAKYASFLQV  491



>ref|XP_008357071.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
 ref|XP_008357072.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
Length=452

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDT
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENITNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFD+SQF+Q HPAGRV+VTDLKAKER MKL++HE+ EVTKNALLCIQRLF
Sbjct  382  SSDPRALAVACFDISQFVQQHPAGRVVVTDLKAKERVMKLMDHESAEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_009361140.1| PREDICTED: V-type proton ATPase subunit H [Pyrus x bretschneideri]
Length=452

 Score =   253 bits (646),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            G+KDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDT
Sbjct  322  GMKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENITNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFD+SQF+Q HPAGRVIVTDLKAKER MKL++HE+ EVTKNALLCIQRLF
Sbjct  382  SSDPRALAVACFDISQFVQQHPAGRVIVTDLKAKERVMKLMDHESAEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_006343605.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343606.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343607.1| PREDICTED: V-type proton ATPase subunit H-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006343608.1| PREDICTED: V-type proton ATPase subunit H-like isoform X4 [Solanum 
tuberosum]
Length=454

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+NIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDT
Sbjct  324  GLKENIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDT  383

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD RTLAVAC+DLSQFIQCH AGR+IV DLKAKER M+LLNHEN EVTKNALLCIQRLF
Sbjct  384  SSDARTLAVACYDLSQFIQCHSAGRIIVNDLKAKERVMRLLNHENAEVTKNALLCIQRLF  443

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  444  LGAKYASFLQ  453



>ref|XP_004307846.1| PREDICTED: V-type proton ATPase subunit H [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKD  FWR+NITNFEENDFQILRVLITILDT
Sbjct  321  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDAIFWRENITNFEENDFQILRVLITILDT  380

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFD+SQF+Q HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLF
Sbjct  381  SSDPRALAVACFDISQFVQHHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLF  440

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  441  LGAKYASFLQ  450



>ref|XP_003629515.1| V-type proton ATPase subunit H [Medicago truncatula]
Length=448

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLG+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILD+
Sbjct  318  GLKDNIKKLSSFDKYKQEVLLGNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDS  377

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPRTLAVACFD+SQFIQ HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLF
Sbjct  378  SNDPRTLAVACFDISQFIQSHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLF  437

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  438  LGAKYASFLQV  448



>ref|XP_002325805.1| putative vacuolar ATPase subunit H family protein [Populus trichocarpa]
 gb|EEF00187.1| putative vacuolar ATPase subunit H family protein [Populus trichocarpa]
Length=447

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            G+KDNIKKLSSFDKYKQEVLLGHLDWSPMHK+PAFW +N TNFEENDFQILRVL+TILDT
Sbjct  317  GVKDNIKKLSSFDKYKQEVLLGHLDWSPMHKNPAFWCENFTNFEENDFQILRVLVTILDT  376

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR LAVACFDLSQFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  377  SNDPRALAVACFDLSQFIQYHPAGRIIVTDLKAKERMMKLMNHENAEVTKNALLCIQRLF  436

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  437  LGAKYASFLQV  447



>ref|XP_011084696.1| PREDICTED: V-type proton ATPase subunit H-like [Sesamum indicum]
Length=453

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK NIKKLSSF+KYKQEVLLGHLDWSPMHKDP FWR+NITNFEE+DFQILRVLITILDT
Sbjct  323  GLKVNIKKLSSFEKYKQEVLLGHLDWSPMHKDPVFWRENITNFEEHDFQILRVLITILDT  382

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            +SDPRTLAVAC+D+SQFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  383  ASDPRTLAVACYDISQFIQYHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLF  442

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  443  LGAKYASFLQ  452



>ref|XP_004242619.1| PREDICTED: V-type proton ATPase subunit H [Solanum lycopersicum]
Length=454

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+NIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDT
Sbjct  324  GLKENIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDT  383

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD RTLAVAC+DLSQFIQCH AGR+IV DLKAKER M+LLNH+N EVTKNALLCIQRLF
Sbjct  384  SSDARTLAVACYDLSQFIQCHSAGRIIVNDLKAKERVMRLLNHDNAEVTKNALLCIQRLF  443

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  444  LGAKYASFLQ  453



>ref|XP_008343829.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
 ref|XP_008343831.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
Length=452

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NITNFE+NDFQILRVLITILDT
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENITNFEDNDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFD+SQF+Q HPAGR IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLF
Sbjct  382  SSDPRALAVACFDISQFVQQHPAGRSIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_010662098.1| PREDICTED: V-type proton ATPase subunit H [Vitis vinifera]
Length=452

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK NIKKLSSFDKYKQEVLLGHLDW+P+HKDP FWRDNI+NFEENDFQILRVLITILDT
Sbjct  322  GLKANIKKLSSFDKYKQEVLLGHLDWTPVHKDPMFWRDNISNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFDLSQFIQ HPAGRVIV DLKAKER MKL+NHEN EVTKN+LLCIQRLF
Sbjct  382  SSDPRALAVACFDLSQFIQYHPAGRVIVNDLKAKERVMKLMNHENAEVTKNSLLCIQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>gb|ACJ85007.1| unknown [Medicago truncatula]
 gb|AFK33862.1| unknown [Medicago truncatula]
Length=452

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLG+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILD+
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDS  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPRTLAVACFD+SQFIQ HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLF
Sbjct  382  SNDPRTLAVACFDISQFIQSHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  442  LGAKYASFLQV  452



>ref|XP_010251374.1| PREDICTED: V-type proton ATPase subunit H [Nelumbo nucifera]
 ref|XP_010251375.1| PREDICTED: V-type proton ATPase subunit H [Nelumbo nucifera]
Length=452

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+N+TNFEENDFQILRVLITILDT
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPWFWRENMTNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR LAVAC+DLSQFIQ H AGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  382  SNDPRALAVACYDLSQFIQYHSAGRIIVTDLKAKERVMKLMNHENSEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>gb|AFK35511.1| unknown [Lotus japonicus]
Length=429

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSS+DKYKQ VLLGHLDWSPMHKD  FWR+NITNFEENDFQILRVLITILDT
Sbjct  299  GLKDNIKKLSSYDKYKQGVLLGHLDWSPMHKDSIFWRENITNFEENDFQILRVLITILDT  358

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPRTLAVACFDLSQF+Q HPAGR IVTDLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  359  SSDPRTLAVACFDLSQFVQHHPAGRFIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLF  418

Query  362  LGAKYASFLQ  391
            LG+KYASFLQ
Sbjct  419  LGSKYASFLQ  428



>gb|KFK33830.1| hypothetical protein AALP_AA5G065600, partial [Arabis alpina]
Length=182

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDT
Sbjct  52   GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDT  111

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFDLSQFIQ H AGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  112  SSDPRSLAVACFDLSQFIQYHAAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLL  171

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  172  LGAKYASFLQ  181



>gb|AET03991.2| vacuolar H+-ATPase subunit H, putative [Medicago truncatula]
Length=486

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 127/131 (97%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLG+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILD+
Sbjct  356  GLKDNIKKLSSFDKYKQEVLLGNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDS  415

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPRTLAVACFD+SQFIQ HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLF
Sbjct  416  SNDPRTLAVACFDISQFIQSHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLF  475

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  476  LGAKYASFLQV  486



>ref|XP_007029671.1| Vacuolar ATP synthase subunit H family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10173.1| Vacuolar ATP synthase subunit H family protein isoform 1 [Theobroma 
cacao]
Length=459

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWRDNIT FEENDFQILRVLITI+D+
Sbjct  329  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPLFWRDNITCFEENDFQILRVLITIMDS  388

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D R LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHE+ EVTKNALLCIQRLF
Sbjct  389  SNDSRALAVACFDLSQFIQHHPAGRVIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLF  448

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  449  LGAKYASFLQV  459



>ref|XP_007029672.1| Vacuolar ATP synthase subunit H family protein isoform 2 [Theobroma 
cacao]
 gb|EOY10174.1| Vacuolar ATP synthase subunit H family protein isoform 2 [Theobroma 
cacao]
Length=453

 Score =   249 bits (637),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWRDNIT FEENDFQILRVLITI+D+
Sbjct  323  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPLFWRDNITCFEENDFQILRVLITIMDS  382

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D R LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHE+ EVTKNALLCIQRLF
Sbjct  383  SNDSRALAVACFDLSQFIQHHPAGRVIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLF  442

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  443  LGAKYASFLQV  453



>emb|CBI26482.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   250 bits (639),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK NIKKLSSFDKYKQEVLLGHLDW+P+HKDP FWRDNI+NFEENDFQILRVLITILDT
Sbjct  353  GLKANIKKLSSFDKYKQEVLLGHLDWTPVHKDPMFWRDNISNFEENDFQILRVLITILDT  412

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFDLSQFIQ HPAGRVIV DLKAKER MKL+NHEN EVTKN+LLCIQRLF
Sbjct  413  SSDPRALAVACFDLSQFIQYHPAGRVIVNDLKAKERVMKLMNHENAEVTKNSLLCIQRLF  472

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  473  LGAKYASFLQ  482



>ref|XP_006574707.1| PREDICTED: V-type proton ATPase subunit H-like [Glycine max]
Length=452

 Score =   249 bits (636),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIK+LSSFD YKQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVL+TILDT
Sbjct  322  GLKDNIKRLSSFDMYKQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLLTILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPRTLAVAC+DLSQFIQ H AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  382  SSDPRTLAVACYDLSQFIQHHSAGRIIVSDLKAKERVMKLMNHENVEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  442  LGAKYASFLQV  452



>ref|XP_002520072.1| vacuolar ATP synthase subunit h, putative [Ricinus communis]
 gb|EEF42396.1| vacuolar ATP synthase subunit h, putative [Ricinus communis]
Length=446

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GL+DNIKKLSSFDKYKQEVLLGHLDW+PMHKDP FWR+N+ NFEENDFQILRVLITILDT
Sbjct  316  GLRDNIKKLSSFDKYKQEVLLGHLDWTPMHKDPIFWRENLNNFEENDFQILRVLITILDT  375

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D R LAVACFDLSQFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  376  SNDSRALAVACFDLSQFIQNHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLF  435

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  436  LGAKYASFLQ  445



>gb|KJB26714.1| hypothetical protein B456_004G256400 [Gossypium raimondii]
Length=351

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWRDN++ FEENDFQ+LR+LITI++T
Sbjct  221  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPLFWRDNVSCFEENDFQVLRILITIMET  280

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFDLSQFIQ HPAGRVIV DLKAKER MKL+NH++ EVTKNALLCIQRLF
Sbjct  281  SSDPRALAVACFDLSQFIQHHPAGRVIVNDLKAKERVMKLMNHDSAEVTKNALLCIQRLF  340

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  341  LGAKYASFLQ  350



>gb|EYU39750.1| hypothetical protein MIMGU_mgv1a006219mg [Erythranthe guttata]
Length=452

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            G+KDNIKKLSSFDKYKQEVLLGHLDWSPMHKD  FWR+NIT+FEE+DFQILRVLITILDT
Sbjct  322  GMKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDLIFWRENITSFEEHDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPRTLAVAC+DLSQFIQ HPAGR+IVTDLKAK+R MKL+NHEN EVTKNALLCIQRLF
Sbjct  382  SSDPRTLAVACYDLSQFIQNHPAGRIIVTDLKAKDRVMKLMNHENAEVTKNALLCIQRLF  441

Query  362  LGAKYASFLQV  394
            LGAKYASF+QV
Sbjct  442  LGAKYASFVQV  452



>gb|KJB18498.1| hypothetical protein B456_003G056300 [Gossypium raimondii]
Length=463

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/131 (90%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWRDNIT FEENDFQILRVLITI+D+
Sbjct  333  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPLFWRDNITCFEENDFQILRVLITIMDS  392

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR LAVACFD+SQFIQ HPAGRVIV DLKAKER MKL+NHE+ EVTKNALLCIQRLF
Sbjct  393  SNDPRPLAVACFDISQFIQHHPAGRVIVNDLKAKERVMKLMNHESAEVTKNALLCIQRLF  452

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  453  LGAKYASFLQV  463



>ref|XP_008800912.1| PREDICTED: probable V-type proton ATPase subunit H [Phoenix dactylifera]
Length=452

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIK+LSSFDKYKQEVLLGHLDWSPMHKDP FWRDNITNFEENDFQILRVL+TILD 
Sbjct  322  GLKDNIKRLSSFDKYKQEVLLGHLDWSPMHKDPNFWRDNITNFEENDFQILRVLVTILDM  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DP  LAVAC+DLSQFIQ HP GR++V+DLKAKERAMKL+NHEN EVTKNALLC+QRLF
Sbjct  382  SNDPTALAVACYDLSQFIQYHPGGRIVVSDLKAKERAMKLMNHENAEVTKNALLCVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_006858816.1| hypothetical protein AMTR_s00066p00170500 [Amborella trichopoda]
 gb|ERN20283.1| hypothetical protein AMTR_s00066p00170500 [Amborella trichopoda]
Length=475

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKK+SSFDKYKQEVLLGHLDWSPMH+DP FWR+NI NFEENDFQI+RVL+TILDT
Sbjct  345  GLKDNIKKMSSFDKYKQEVLLGHLDWSPMHRDPVFWRENIKNFEENDFQIVRVLLTILDT  404

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR LAVAC+DLSQFIQ HPAGR I++DLKAK+R MKL+NHENPEVTKNALLCIQRLF
Sbjct  405  STDPRALAVACYDLSQFIQYHPAGRGILSDLKAKDRVMKLMNHENPEVTKNALLCIQRLF  464

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  465  LGAKYASFLQ  474



>gb|EPS61013.1| hypothetical protein M569_13786, partial [Genlisea aurea]
Length=442

 Score =   246 bits (629),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIK+LSSFD YKQEVLLGHLDWS MHKDPAFWR+N  NFEENDFQILRVL+TILDT
Sbjct  311  GLKDNIKRLSSFDNYKQEVLLGHLDWSIMHKDPAFWRENSANFEENDFQILRVLVTILDT  370

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPRTLAVAC+DLSQFIQ HPAGR++VTDLKAKER MKLLNHEN EVTKNALLCIQRLF
Sbjct  371  STDPRTLAVACYDLSQFIQHHPAGRIVVTDLKAKERVMKLLNHENAEVTKNALLCIQRLF  430

Query  362  LGAKYASFL  388
            LGAKYASFL
Sbjct  431  LGAKYASFL  439



>ref|XP_010912760.1| PREDICTED: probable V-type proton ATPase subunit H isoform X3 
[Elaeis guineensis]
Length=391

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN+K+LSSFDKYKQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDT
Sbjct  261  GLKDNMKRLSSFDKYKQEVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLITILDT  320

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DP  LAVAC+DLSQFIQ HP GR++++D+KAKER MKL+NHEN EVTKNALLC+QRLF
Sbjct  321  SNDPTALAVACYDLSQFIQYHPGGRIVISDMKAKERVMKLMNHENAEVTKNALLCVQRLF  380

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  381  LGAKYASFLQ  390



>gb|EYU39492.1| hypothetical protein MIMGU_mgv1a006273mg [Erythranthe guttata]
Length=450

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSF+KYKQE LLGHLDWSPMHKDP FWRDNIT+FEE+DFQILRVLITILDT
Sbjct  320  GLKDNIKKLSSFEKYKQEALLGHLDWSPMHKDPIFWRDNITHFEEHDFQILRVLITILDT  379

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD RTLAVAC+DLSQFIQ HPAGR+IV DLKAKER MKL+NHEN EVTK+ALLCIQRLF
Sbjct  380  SSDSRTLAVACYDLSQFIQYHPAGRIIVNDLKAKERVMKLMNHENAEVTKSALLCIQRLF  439

Query  362  LGAKYASFLQV  394
            LGAKYASFLQ 
Sbjct  440  LGAKYASFLQT  450



>ref|XP_010912758.1| PREDICTED: probable V-type proton ATPase subunit H isoform X2 
[Elaeis guineensis]
Length=431

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN+K+LSSFDKYKQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDT
Sbjct  301  GLKDNMKRLSSFDKYKQEVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLITILDT  360

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DP  LAVAC+DLSQFIQ HP GR++++D+KAKER MKL+NHEN EVTKNALLC+QRLF
Sbjct  361  SNDPTALAVACYDLSQFIQYHPGGRIVISDMKAKERVMKLMNHENAEVTKNALLCVQRLF  420

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  421  LGAKYASFLQ  430



>ref|XP_006855968.1| hypothetical protein AMTR_s00037p00233030 [Amborella trichopoda]
 gb|ERN17435.1| hypothetical protein AMTR_s00037p00233030 [Amborella trichopoda]
Length=157

 Score =   236 bits (601),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKL SFDKY+QEVLLGHLDWSPMH+DP FWR+NITNFEENDFQI+RVL+TILDT
Sbjct  27   GLKDNIKKLCSFDKYEQEVLLGHLDWSPMHRDPVFWRENITNFEENDFQIVRVLLTILDT  86

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR LAVAC+DLSQFIQ HPAGR I++DLKAK+  MKL+NHENPEV KNALL IQRLF
Sbjct  87   STDPRALAVACYDLSQFIQYHPAGRGILSDLKAKDWVMKLMNHENPEVIKNALLGIQRLF  146

Query  362  LGAKYASFLQV  394
            LGAKYASFLQ 
Sbjct  147  LGAKYASFLQA  157



>ref|XP_010912757.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Elaeis guineensis]
Length=452

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN+K+LSSFDKYKQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDT
Sbjct  322  GLKDNMKRLSSFDKYKQEVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DP  LAVAC+DLSQFIQ HP GR++++D+KAKER MKL+NHEN EVTKNALLC+QRLF
Sbjct  382  SNDPTALAVACYDLSQFIQYHPGGRIVISDMKAKERVMKLMNHENAEVTKNALLCVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>gb|KHG22602.1| V-type proton ATPase subunit H -like protein [Gossypium arboreum]
Length=494

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWRDN++ FEENDFQ+LRVLITI++T
Sbjct  364  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPLFWRDNVSCFEENDFQVLRVLITIMET  423

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFDLSQFIQ HPAGRVIV DLKAKER MKL+NH++ EVTKNALLCIQRLF
Sbjct  424  SSDPRALAVACFDLSQFIQHHPAGRVIVNDLKAKERVMKLMNHDSAEVTKNALLCIQRLF  483

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  484  LGAKYASFLQ  493



>gb|KJB26715.1| hypothetical protein B456_004G256400 [Gossypium raimondii]
Length=481

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWRDN++ FEENDFQ+LR+LITI++T
Sbjct  351  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPLFWRDNVSCFEENDFQVLRILITIMET  410

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFDLSQFIQ HPAGRVIV DLKAKER MKL+NH++ EVTKNALLCIQRLF
Sbjct  411  SSDPRALAVACFDLSQFIQHHPAGRVIVNDLKAKERVMKLMNHDSAEVTKNALLCIQRLF  470

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  471  LGAKYASFLQ  480



>ref|XP_011077102.1| PREDICTED: V-type proton ATPase subunit H-like [Sesamum indicum]
Length=453

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+NITNFEE+DFQILRVLITILDT
Sbjct  323  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPTFWRENITNFEEHDFQILRVLITILDT  382

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D RTLAVAC+DLSQFIQ H AGR+IV DLKAK+R MKL++HEN EVTKNALLCIQRLF
Sbjct  383  STDARTLAVACYDLSQFIQYHSAGRIIVNDLKAKDRVMKLMDHENAEVTKNALLCIQRLF  442

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  443  LGAKYASFLQ  452



>ref|XP_009615905.1| PREDICTED: V-type proton ATPase subunit H-like [Nicotiana tomentosiformis]
Length=297

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIK LSS+DKYKQEVLLG+LDWSPMHKD  FW++NI NFEEN FQILRVL+TILDT
Sbjct  167  GLKDNIKILSSYDKYKQEVLLGNLDWSPMHKDLLFWKENINNFEENGFQILRVLMTILDT  226

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD RTLAVAC+DLSQFIQCHPAGR+IV DLKAKER MKLLNHE  EVTKNALLCIQRLF
Sbjct  227  SSDARTLAVACYDLSQFIQCHPAGRIIVADLKAKERVMKLLNHETAEVTKNALLCIQRLF  286

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  287  LGAKYASFLQ  296



>ref|XP_010930282.1| PREDICTED: probable V-type proton ATPase subunit H [Elaeis guineensis]
Length=452

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIK+LSSFDKYKQEVLLGHLDWS MHKDP FWR+NITNFEENDFQILRVL+TILDT
Sbjct  322  GLKDNIKRLSSFDKYKQEVLLGHLDWSLMHKDPNFWRENITNFEENDFQILRVLVTILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DP  LAVAC+DLSQFIQ HP GR++V+DLKAKER MKL+NHEN EVTKNALLC+QRLF
Sbjct  382  SNDPTALAVACYDLSQFIQYHPGGRIVVSDLKAKERVMKLMNHENAEVTKNALLCVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>emb|CDX69032.1| BnaC01g04210D [Brassica napus]
Length=452

 Score =   244 bits (623),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDT
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVAC+DLSQFIQ H AGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  382  SSDPRSLAVACYDLSQFIQYHAAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLL  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_008791825.1| PREDICTED: probable V-type proton ATPase subunit H isoform X2 
[Phoenix dactylifera]
Length=431

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN+K+LSSFDKYKQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDT
Sbjct  301  GLKDNMKRLSSFDKYKQEVLLGHLDWSPMHKDPNFWRENIANFEENDFQILRVLITILDT  360

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DP  LAVAC+DLSQFIQ HP GR++V+D+KAKER MKL+NHEN EVTKNALLC+QRLF
Sbjct  361  SNDPTALAVACYDLSQFIQHHPGGRIVVSDMKAKERVMKLMNHENAEVTKNALLCVQRLF  420

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  421  LGAKYASFLQ  430



>ref|XP_009115735.1| PREDICTED: V-type proton ATPase subunit H-like [Brassica rapa]
 gb|AID60130.1| AT3g42050-like protein [Brassica napus]
 emb|CDX75407.1| BnaA01g02950D [Brassica napus]
Length=452

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDT
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVAC+DLSQFIQ H AGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  382  SSDPRSLAVACYDLSQFIQYHAAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLL  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>gb|ACN34691.1| unknown [Zea mays]
Length=199

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+KKLSSFDKYKQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  69   GLKENLKKLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDT  128

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLF
Sbjct  129  SSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLF  188

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  189  LGAKYASFLQ  198



>ref|XP_008791823.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Phoenix dactylifera]
 ref|XP_008791824.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Phoenix dactylifera]
Length=452

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN+K+LSSFDKYKQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDT
Sbjct  322  GLKDNMKRLSSFDKYKQEVLLGHLDWSPMHKDPNFWRENIANFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DP  LAVAC+DLSQFIQ HP GR++V+D+KAKER MKL+NHEN EVTKNALLC+QRLF
Sbjct  382  SNDPTALAVACYDLSQFIQHHPGGRIVVSDMKAKERVMKLMNHENAEVTKNALLCVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_004136630.1| PREDICTED: V-type proton ATPase subunit H-like [Cucumis sativus]
 ref|XP_004162622.1| PREDICTED: V-type proton ATPase subunit H-like [Cucumis sativus]
 gb|KGN59423.1| hypothetical protein Csa_3G819800 [Cucumis sativus]
Length=454

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKD  FWR+NIT+FEEND +ILRVLITILD+
Sbjct  324  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDVNFWRENITSFEENDLKILRVLITILDS  383

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK ALLCIQRLF
Sbjct  384  STDPRALAVACFDLSQFIQHHPAGRVIVTDLKAKERVMKLMNHENAEVTKYALLCIQRLF  443

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  444  LGAKYASFLQ  453



>ref|XP_010526971.1| PREDICTED: V-type proton ATPase subunit H-like [Tarenaya hassleriana]
Length=452

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNI+K SSFDKYKQEVLLGHLDW+PMHKDPAFWR+NI NFE NDFQILRVLITIL+T
Sbjct  322  GLKDNIRKSSSFDKYKQEVLLGHLDWTPMHKDPAFWRENIVNFEGNDFQILRVLITILET  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPRTLAVACFD+SQFIQ HPAGRVIV DLKAKER MKL++HEN EVTKNALL IQRL 
Sbjct  382  SSDPRTLAVACFDISQFIQFHPAGRVIVNDLKAKERVMKLMSHENVEVTKNALLSIQRLL  441

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  442  LGAKYASFLQV  452



>ref|XP_010547995.1| PREDICTED: V-type proton ATPase subunit H [Tarenaya hassleriana]
 ref|XP_010547996.1| PREDICTED: V-type proton ATPase subunit H [Tarenaya hassleriana]
Length=452

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD I+KLSSFDKYKQEVLLGHLDW+PMHKD AFWR+NI  FEENDFQILRVLITILD+
Sbjct  322  GLKDKIRKLSSFDKYKQEVLLGHLDWTPMHKDLAFWRENIMGFEENDFQILRVLITILDS  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVAC+DLSQFIQ HPAGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  382  SSDPRSLAVACYDLSQFIQYHPAGRVIVNDLKAKERVMKLMNHENSEVTKNALLCIQRLL  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_008443235.1| PREDICTED: V-type proton ATPase subunit H [Cucumis melo]
 ref|XP_008443236.1| PREDICTED: V-type proton ATPase subunit H [Cucumis melo]
Length=454

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKD  FWR+NI +FEEND +ILRVLITILD+
Sbjct  324  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDVNFWRENIMSFEENDLKILRVLITILDS  383

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK ALLCIQRLF
Sbjct  384  SSDPRALAVACFDLSQFIQHHPAGRVIVTDLKAKERVMKLMNHENAEVTKYALLCIQRLF  443

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  444  LGAKYASFLQ  453



>ref|XP_009416984.1| PREDICTED: probable V-type proton ATPase subunit H [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK++IK LSSFDKYKQEVLLGHLDW PMHKDP FWR+NITNFEENDFQILRVLITILDT
Sbjct  322  GLKEHIKTLSSFDKYKQEVLLGHLDWYPMHKDPGFWRENITNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S DP  LAVAC+DLSQFIQ HPAGR+IV+DLKAK+R MKL+NHEN +VTKNALLCIQRLF
Sbjct  382  SGDPTALAVACYDLSQFIQYHPAGRIIVSDLKAKDRVMKLMNHENADVTKNALLCIQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>emb|CDY49280.1| BnaA03g50930D [Brassica napus]
Length=450

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDT
Sbjct  320  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDT  379

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR+LAVACFD+SQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  380  STDPRSLAVACFDISQFIQYHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLL  439

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  440  LGAKYASFLQ  449



>emb|CDX72455.1| BnaC07g44770D [Brassica napus]
Length=450

 Score =   241 bits (616),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDT
Sbjct  320  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDT  379

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR+LAVACFD+SQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  380  STDPRSLAVACFDISQFIQYHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLL  439

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  440  LGAKYASFLQ  449



>ref|XP_009138267.1| PREDICTED: V-type proton ATPase subunit H [Brassica rapa]
Length=451

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDT
Sbjct  321  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDT  380

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR+LAVACFD+SQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  381  STDPRSLAVACFDISQFIQYHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLL  440

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  441  LGAKYASFLQ  450



>ref|XP_010437658.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Camelina 
sativa]
Length=452

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDT
Sbjct  322  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  382  SSDPRSLAVACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLL  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_010437659.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Camelina 
sativa]
Length=452

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDT
Sbjct  322  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  382  SSDPRSLAVACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLL  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_010432453.1| PREDICTED: V-type proton ATPase subunit H-like [Camelina sativa]
Length=452

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDT
Sbjct  322  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  382  SSDPRSLAVACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLL  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_006283723.1| hypothetical protein CARUB_v10004791mg [Capsella rubella]
 gb|EOA16621.1| hypothetical protein CARUB_v10004791mg [Capsella rubella]
Length=452

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDT
Sbjct  322  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  382  SSDPRSLAVACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLL  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_010447124.1| PREDICTED: V-type proton ATPase subunit H [Camelina sativa]
Length=437

 Score =   239 bits (610),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDT
Sbjct  307  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDT  366

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  367  SSDPRSLAVACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLL  426

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  427  LGAKYASFLQ  436



>gb|KCW59595.1| hypothetical protein EUGRSUZ_H02340 [Eucalyptus grandis]
Length=438

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLG LDWSPMHKDP FWR+NIT+FE++DFQILRVL+TILDT
Sbjct  308  GLKDNIKKLSSFDKYKQEVLLGQLDWSPMHKDPIFWRENITSFEDSDFQILRVLVTILDT  367

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD R LAVAC+DLSQFIQ HPAGR+I++DLKAK+R MKLLNH+N EVTKNALLC QRLF
Sbjct  368  SSDARALAVACYDLSQFIQYHPAGRIILSDLKAKDRVMKLLNHDNAEVTKNALLCSQRLF  427

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  428  LGAKYASFLQV  438



>ref|XP_010023341.1| PREDICTED: V-type proton ATPase subunit H [Eucalyptus grandis]
Length=443

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLG LDWSPMHKDP FWR+NIT+FE++DFQILRVL+TILDT
Sbjct  313  GLKDNIKKLSSFDKYKQEVLLGQLDWSPMHKDPIFWRENITSFEDSDFQILRVLVTILDT  372

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD R LAVAC+DLSQFIQ HPAGR+I++DLKAK+R MKLLNH+N EVTKNALLC QRLF
Sbjct  373  SSDARALAVACYDLSQFIQYHPAGRIILSDLKAKDRVMKLLNHDNAEVTKNALLCSQRLF  432

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  433  LGAKYASFLQV  443



>ref|XP_010673864.1| PREDICTED: V-type proton ATPase subunit H [Beta vulgaris subsp. 
vulgaris]
Length=465

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN+KK+SSFDKYKQEVLLGHLDWSP+HKD  FWR+NI+NFEE DF+ILRVL+TILDT
Sbjct  335  GLKDNVKKMSSFDKYKQEVLLGHLDWSPVHKDTFFWRENISNFEEKDFEILRVLLTILDT  394

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR+L+VACFDLSQFIQ HP+GR+IV DLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  395  SNDPRSLSVACFDLSQFIQHHPSGRIIVKDLKAKERVMKLMNHENAEVTKNALLCIQRLF  454

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  455  LGAKYASFLQ  464



>emb|CAD27445.1| putative vacuolar ATPase subunit H [Mesembryanthemum crystallinum]
Length=470

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/132 (89%), Positives = 123/132 (93%), Gaps = 2/132 (2%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            G+K+NIKKLSSFDKYKQEVLLGHLDWSP+HKD  FWRDNITNFEENDFQILRVLITILDT
Sbjct  338  GMKENIKKLSSFDKYKQEVLLGHLDWSPVHKDTFFWRDNITNFEENDFQILRVLITILDT  397

Query  182  SSDPRTLAVA-C-FDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQR  355
            SSDPR+LAV  C FDLSQFIQ HPAGR+IV DLKAKER MKL+NHEN EVTKNALLCIQR
Sbjct  398  SSDPRSLAVCKCEFDLSQFIQNHPAGRMIVNDLKAKERVMKLMNHENAEVTKNALLCIQR  457

Query  356  LFLGAKYASFLQ  391
            LFLGAKYASFLQ
Sbjct  458  LFLGAKYASFLQ  469



>ref|XP_002869169.1| vacuolar ATP synthase subunit H family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45428.1| vacuolar ATP synthase subunit H family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=418

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDT
Sbjct  288  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDT  347

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  348  SSDPRSLAVACFDISQFIQYHAAGRVIVADLKAKERVMKLMNHENTEVTKNALLCIQRLL  407

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  408  LGAKYASFLQ  417



>gb|AAO65974.1| putative vacuolar ATPase subunit H protein [Suaeda salsa]
 gb|AEP40377.1| vacuolar proton pump ATPase subunit H [Suaeda corniculata]
Length=465

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK N+K+LSSF+KYKQEVLLGHLDWSP+HKD  FWR+NI NFEENDFQILRVLITILDT
Sbjct  335  GLKYNVKQLSSFEKYKQEVLLGHLDWSPVHKDAFFWRENIKNFEENDFQILRVLITILDT  394

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+DPR+LAVACFDLSQF+Q HP+GR+IV DL+AKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  395  SNDPRSLAVACFDLSQFVQQHPSGRIIVNDLQAKERVMKLMNHENAEVTKNALLCIQRLF  454

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  455  LGAKYASFLQ  464



>ref|NP_189791.1| V-type proton ATPase subunit H [Arabidopsis thaliana]
 sp|Q9LX65.1|VATH_ARATH RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar H(+)-ATPase subunit H; AltName: 
Full=Vacuolar proton pump subunit H [Arabidopsis thaliana]
 emb|CAB91576.1| vacuolar H(+)-ATPase subunit-like protein [Arabidopsis thaliana]
 gb|AAM10284.1| AT3g42050/F4M19_10 [Arabidopsis thaliana]
 gb|AEE77718.1| V-type proton ATPase subunit H [Arabidopsis thaliana]
Length=441

 Score =   236 bits (602),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDT
Sbjct  311  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKETNFWRENVTCFEENDFQILRVLLTILDT  370

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNA+LCIQRL 
Sbjct  371  SSDPRSLAVACFDISQFIQYHAAGRVIVADLKAKERVMKLINHENAEVTKNAILCIQRLL  430

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  431  LGAKYASFLQ  440



>ref|XP_006412262.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 ref|XP_006412263.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 ref|XP_006412264.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53715.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53716.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53717.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
Length=452

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD I+KLSSFDKYKQEVLLG LDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDT
Sbjct  322  GLKDKIRKLSSFDKYKQEVLLGQLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFDLSQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL 
Sbjct  382  SSDPRSLAVACFDLSQFIQYHAAGRVIVNDLKAKERVMKLMNHENAEVTKNALLCIQRLL  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>dbj|BAH20255.1| AT3G42050 [Arabidopsis thaliana]
Length=436

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDT
Sbjct  306  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKETNFWRENVTCFEENDFQILRVLLTILDT  365

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNA+LCIQRL 
Sbjct  366  SSDPRSLAVACFDISQFIQYHAAGRVIVADLKAKERVMKLINHENAEVTKNAILCIQRLL  425

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  426  LGAKYASFLQ  435



>ref|XP_006350112.1| PREDICTED: V-type proton ATPase subunit H-like [Solanum tuberosum]
Length=454

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK NIKKLSS+DKYKQEVLLG LDWSPMHKDP FW++NIT FEEN FQILRVL+TILD+
Sbjct  324  GLKANIKKLSSYDKYKQEVLLGSLDWSPMHKDPLFWKENITCFEENGFQILRVLMTILDS  383

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D RTL+VAC+DLSQFIQCHPAGRVIV DLKAKER MKLLNH   EVTKNALLCIQRLF
Sbjct  384  SNDARTLSVACYDLSQFIQCHPAGRVIVADLKAKERVMKLLNHGTAEVTKNALLCIQRLF  443

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  444  LGAKYASFLQ  453



>ref|XP_004957961.1| PREDICTED: probable V-type proton ATPase subunit H-like [Setaria 
italica]
Length=452

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN+KKLSSFDKYKQ+VLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  322  GLKDNLKKLSSFDKYKQQVLLGHLDWSPMHKDPGFWRENINNFEENDFQILRVLMTIIDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLCIQRLF
Sbjct  382  SSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALLCIQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>gb|AAK59761.1| AT3g42050/F4M19_10 [Arabidopsis thaliana]
Length=441

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD IKKLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDT
Sbjct  311  GLKDKIKKLSSFDKYKQEVLLGHLDWNPMHKETNFWRENVTCFEENDFQILRVLLTILDT  370

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVACFD+SQFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNA+LCIQRL 
Sbjct  371  SSDPRSLAVACFDISQFIQYHAAGRVIVADLKAKERVMKLINHENAEVTKNAILCIQRLL  430

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  431  LGAKYASFLQ  440



>tpg|DAA63056.1| TPA: hypothetical protein ZEAMMB73_267119 [Zea mays]
Length=379

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+KKLSSFDKYKQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  249  GLKENLKKLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDT  308

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLF
Sbjct  309  SSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLF  368

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  369  LGAKYASFLQ  378



>gb|KHN00570.1| Protein DA1-related 1 [Glycine soja]
Length=1212

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  2     GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
             GLKDNIK+LSSFD YKQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVL+TILDT
Sbjct  1082  GLKDNIKRLSSFDMYKQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLLTILDT  1141

Query  182   SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
             SSDPRTLAVAC+DLSQFIQ H AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLF
Sbjct  1142  SSDPRTLAVACYDLSQFIQHHSAGRIIVSDLKAKERVMKLMNHENVEVTKNALLCIQRLF  1201

Query  362   LGAKYASFLQV  394
             LGAKYASFLQV
Sbjct  1202  LGAKYASFLQV  1212



>ref|XP_004251740.1| PREDICTED: V-type proton ATPase subunit H-like [Solanum lycopersicum]
Length=454

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK NIKK+SS+DKYKQEVLLG LDWSPMHKDP FW++NIT FEEN FQILRVL+TILDT
Sbjct  324  GLKANIKKMSSYDKYKQEVLLGSLDWSPMHKDPLFWKENITCFEENGFQILRVLMTILDT  383

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D RTLAVAC+DLSQFIQCHPAGRVIV DLKAKER MKLLNH   EVTKNALLCIQRLF
Sbjct  384  SNDSRTLAVACYDLSQFIQCHPAGRVIVADLKAKERVMKLLNHGTAEVTKNALLCIQRLF  443

Query  362  LGAKYASFL  388
            LGAKYASFL
Sbjct  444  LGAKYASFL  452



>emb|CDY57740.1| BnaC03g77060D [Brassica napus]
Length=459

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            LKD I+KLSSFDKYKQEVLLGHLDW+PMHK+  FWR+N+T+FEEND QILRVL+TILDTS
Sbjct  330  LKDKIRKLSSFDKYKQEVLLGHLDWNPMHKEANFWRENVTSFEENDLQILRVLLTILDTS  389

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            SDPR+LAVAC+DLSQFIQ H AGRVIVTDLKAKER MKL+ HEN EVTKNALLCIQRL L
Sbjct  390  SDPRSLAVACYDLSQFIQYHAAGRVIVTDLKAKERVMKLMAHENAEVTKNALLCIQRLLL  449

Query  365  GAKYASFLQV  394
            GAKYASFLQV
Sbjct  450  GAKYASFLQV  459



>ref|XP_006657814.1| PREDICTED: probable V-type proton ATPase subunit H-like [Oryza 
brachyantha]
Length=452

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN+KKLSSF+KYKQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  322  GLKDNLKKLSSFEKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLF
Sbjct  382  SSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENGEVRKNALLCVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|XP_009415033.1| PREDICTED: probable V-type proton ATPase subunit H [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK++IK LSSFDKYKQEVL GHLDW PMHKDP FWR+NITNFEENDFQILRVLITILDT
Sbjct  322  GLKEHIKTLSSFDKYKQEVLQGHLDWYPMHKDPGFWRENITNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDP  L+VAC+DLSQFIQ HPAGR++V DLKAK+R MKL+NHEN EVT++ALLCIQRLF
Sbjct  382  SSDPTALSVACYDLSQFIQYHPAGRIMVADLKAKDRVMKLMNHENAEVTRHALLCIQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYAS LQ
Sbjct  442  LGAKYASLLQ  451



>ref|XP_002460834.1| hypothetical protein SORBIDRAFT_02g035880 [Sorghum bicolor]
 gb|EER97355.1| hypothetical protein SORBIDRAFT_02g035880 [Sorghum bicolor]
Length=452

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+KKLSSFDKYKQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  322  GLKENLKKLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLF
Sbjct  382  SSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALLCVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>emb|CDX76266.1| BnaA08g11340D [Brassica napus]
Length=468

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD I KLSSFDKYKQEVLLGHL+W+PMHK+  FWR+N+++FEENDFQILRVL+TILDT
Sbjct  338  GLKDKIWKLSSFDKYKQEVLLGHLEWNPMHKEANFWRENVSSFEENDFQILRVLLTILDT  397

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSDPR+LAVAC+DLSQFIQ H AGRVIVTDLKAKER M+L+ HEN EVTKNALLCIQRL 
Sbjct  398  SSDPRSLAVACYDLSQFIQYHAAGRVIVTDLKAKERVMRLMGHENAEVTKNALLCIQRLL  457

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  458  LGAKYASFLQV  468



>sp|Q84ZC0.1|VATH_ORYSJ RecName: Full=Probable V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar proton pump subunit 
H [Oryza sativa Japonica Group]
 dbj|BAC57732.1| putative vacuolar ATP synthase subunit H [Oryza sativa Japonica 
Group]
 dbj|BAG90555.1| unnamed protein product [Oryza sativa Japonica Group]
Length=452

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN+KKLSSF+KYKQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  322  GLKDNLKKLSSFEKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLF
Sbjct  382  SADTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENAEVRKNALLCVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>gb|ACF84665.1| unknown [Zea mays]
 gb|ACL54657.1| unknown [Zea mays]
Length=452

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+KKLSSFDKYKQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  322  GLKENLKKLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLF
Sbjct  382  SSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>ref|NP_001146965.1| vacuolar ATPase subunit H protein [Zea mays]
 gb|ACG24799.1| vacuolar ATPase subunit H protein [Zea mays]
Length=468

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+KKLSSFDKYKQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  338  GLKENLKKLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDT  397

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLF
Sbjct  398  SSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLF  457

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  458  LGAKYASFLQ  467



>ref|NP_001288363.1| uncharacterized protein LOC103647744 [Zea mays]
 gb|ACN33576.1| unknown [Zea mays]
 tpg|DAA41089.1| TPA: vacuolar ATPase subunit H protein [Zea mays]
Length=452

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 121/130 (93%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+KKLSSFDKYKQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  322  GLKENLKKLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLF
Sbjct  382  SSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVQKNALLCVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFL+
Sbjct  442  LGAKYASFLR  451



>gb|EMS54494.1| putative V-type proton ATPase subunit H [Triticum urartu]
Length=450

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+K+LSSFDKYKQ+VLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DT
Sbjct  320  GLKENLKRLSSFDKYKQQVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDT  379

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLF
Sbjct  380  STDTTALAVACYDLSQFLQYHPSGRLVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLF  439

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  440  LGAKYASFLQV  450



>gb|EMT32310.1| Putative V-type proton ATPase subunit H [Aegilops tauschii]
Length=436

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+K+LSSFDKYKQ+VLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DT
Sbjct  306  GLKENLKRLSSFDKYKQQVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDT  365

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLF
Sbjct  366  STDTTALAVACYDLSQFLQYHPSGRLVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLF  425

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  426  LGAKYASFLQV  436



>ref|XP_010237225.1| PREDICTED: probable V-type proton ATPase subunit H [Brachypodium 
distachyon]
 ref|XP_010237228.1| PREDICTED: probable V-type proton ATPase subunit H [Brachypodium 
distachyon]
Length=452

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+K+LSSFDKYKQ+VLLGHLDWSPMHKDP+FWR+NITNFEENDFQILRVL+T++DT
Sbjct  322  GLKENLKRLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENITNFEENDFQILRVLMTVIDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLF
Sbjct  382  STDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>gb|EEC82241.1| hypothetical protein OsI_26411 [Oryza sativa Indica Group]
 gb|EEE67371.1| hypothetical protein OsJ_24664 [Oryza sativa Japonica Group]
Length=495

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDN+KKLSSF+KYKQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  365  GLKDNLKKLSSFEKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDT  424

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLF
Sbjct  425  SADTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENAEVRKNALLCVQRLF  484

Query  362  LGAKYASFLQV  394
            LGAKYASFLQ 
Sbjct  485  LGAKYASFLQT  495



>dbj|BAJ84958.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90688.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+K+LSSFDKYKQ+VLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DT
Sbjct  322  GLKENLKRLSSFDKYKQQVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLF
Sbjct  382  STDTTALAVACYDLSQFLQYHPSGRLVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLF  441

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  442  LGAKYASFLQV  452



>ref|XP_002453051.1| hypothetical protein SORBIDRAFT_04g037430 [Sorghum bicolor]
 gb|EES06027.1| hypothetical protein SORBIDRAFT_04g037430 [Sorghum bicolor]
Length=452

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+KKLSSFDKYKQ+VLLGHLDWSPMHKDP+FWR+NI +FEENDFQILRVL+TI+DT
Sbjct  322  GLKENLKKLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENINSFEENDFQILRVLMTIIDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD   LAVAC+DLSQF+Q HP+GR++V DLKAK++ MKL+NH N EV KNALLC+QRLF
Sbjct  382  SSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDQVMKLMNHGNTEVRKNALLCVQRLF  441

Query  362  LGAKYASFLQ  391
            LGAKYASFLQ
Sbjct  442  LGAKYASFLQ  451



>gb|ABG75917.1| vacuolar proton ATPase subunit H [Triticum aestivum]
Length=452

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+K+LSSFDKYKQ+VLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DT
Sbjct  322  GLKENLKRLSSFDKYKQQVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D   LAVAC+DLSQF+Q H +GR++V DLKAK+R MKL++H+N EV KN+LLC+QRLF
Sbjct  382  STDTTALAVACYDLSQFLQYHTSGRLVVADLKAKDRVMKLMSHDNAEVRKNSLLCVQRLF  441

Query  362  LGAKYASFLQV  394
            LGAKYASFLQV
Sbjct  442  LGAKYASFLQV  452



>gb|ABR17502.1| unknown [Picea sitchensis]
Length=458

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKD+IK+LSSFDKYKQEVLLG+LDWSPMHKDP FWR+NI  FE+NDFQ+LR+LITILDT
Sbjct  328  GLKDSIKRLSSFDKYKQEVLLGNLDWSPMHKDPVFWRENINKFEDNDFQVLRILITILDT  387

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S + R LAVAC+D+SQFIQ HPAGR IVTDLK KER +KL++HE+ EV KNALLC+Q+L 
Sbjct  388  SGESRALAVACYDISQFIQYHPAGRGIVTDLKVKERVIKLMDHESSEVRKNALLCVQKLL  447

Query  362  LGAKYASFLQ  391
            L AKY S+LQ
Sbjct  448  LSAKYVSYLQ  457



>tpg|DAA41086.1| TPA: hypothetical protein ZEAMMB73_371057, partial [Zea mays]
Length=607

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+KKLSSFDKYKQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DT
Sbjct  476  GLKENLKKLSSFDKYKQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDT  535

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SSD   LAVAC+DLSQF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLF
Sbjct  536  SSDTTALAVACYDLSQFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVQKNALLCVQRLF  595

Query  362  LG  367
            LG
Sbjct  596  LG  597



>emb|CAG27620.1| putative vacuolar ATPase subunit H [Populus deltoides x Populus 
maximowiczii]
Length=105

 Score =   201 bits (511),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +2

Query  47   KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  226
            KQEVLLGHLDWSPMHKDPAFWR+NITNFEENDFQILRVLITILDTSSDPR LAVACFDLS
Sbjct  1    KQEVLLGHLDWSPMHKDPAFWRENITNFEENDFQILRVLITILDTSSDPRALAVACFDLS  60

Query  227  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            QFIQ HPAGRVIVTDLK KER MKL+NHEN EVTKNALLCIQ  F
Sbjct  61   QFIQHHPAGRVIVTDLKTKERVMKLMNHENAEVTKNALLCIQGSF  105



>gb|KDO40338.1| hypothetical protein CISIN_1g034103mg [Citrus sinensis]
Length=103

 Score =   198 bits (503),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/102 (92%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +2

Query  86   MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  265
            MHKDP FWRDNITNFEENDFQILRVL+TILDTSSDPR LAVACFDLSQFIQ HPAGRVIV
Sbjct  1    MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIV  60

Query  266  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  391
            TDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFLQ
Sbjct  61   TDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQ  102



>gb|KDO40334.1| hypothetical protein CISIN_1g034108mg [Citrus sinensis]
Length=103

 Score =   196 bits (499),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  86   MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  265
            MHKDP FWRDNITNFEENDFQILRVL+TILDTSSDPR LAVACFDLSQFIQ HPAGRVIV
Sbjct  1    MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIV  60

Query  266  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  391
            TDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKY SFLQ
Sbjct  61   TDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYTSFLQ  102



>gb|KDO40336.1| hypothetical protein CISIN_1g034106mg [Citrus sinensis]
Length=103

 Score =   196 bits (497),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +2

Query  86   MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  265
            MHKDP FW DNITNFEENDFQILRVL+TILDTSSDPR LAVACFDLSQFIQ HPAGRVIV
Sbjct  1    MHKDPLFWHDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIV  60

Query  266  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  391
            TDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFLQ
Sbjct  61   TDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQ  102



>gb|AEG78652.1| vacuolar H+-ATPase subunit H, partial [Avena sativa]
Length=298

 Score =   201 bits (510),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK+N+K+ SSFDKYKQ+VLLGHLDWSPMHKDP FW +NIT FE N+FQI RVL+T++DT
Sbjct  168  GLKENLKRXSSFDKYKQQVLLGHLDWSPMHKDPNFWXENITXFEGNEFQIXRVLMTVIDT  227

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S+D   LAVAC+DLSQ +Q HP GR+   DLKA  R M L NH+N EV KN+LLC+QRLF
Sbjct  228  STDTHALAVACYDLSQXLQYHPXGRLXXADLKAXXRVMXLXNHDNAEVRKNSLLCVQRLF  287

Query  362  LGAKYASFLQ  391
            LGAKY SFLQ
Sbjct  288  LGAKYXSFLQ  297



>ref|XP_001756205.1| predicted protein [Physcomitrella patens]
 gb|EDQ79071.1| predicted protein [Physcomitrella patens]
Length=448

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
             LKD I+KLSSFD+YK EV  G+LDWSPMHKDP FWR+NI+ FEE+DFQ+LR+LIT+LD 
Sbjct  319  ALKDIIRKLSSFDRYKGEVFSGNLDWSPMHKDPVFWRENISKFEESDFQVLRILITLLDN  378

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S DP+TLAVAC D++QFIQ HPAGR I+ DLKAKER MK ++H NPEV   ALLC+Q++ 
Sbjct  379  SRDPKTLAVACHDIAQFIQNHPAGRGIILDLKAKERVMKHMSHPNPEVATQALLCVQKVL  438

Query  362  LGAKYASFLQ  391
            L AKYAS++Q
Sbjct  439  LSAKYASYMQ  448



>ref|XP_002963102.1| hypothetical protein SELMODRAFT_141399 [Selaginella moellendorffii]
 gb|EFJ36565.1| hypothetical protein SELMODRAFT_141399 [Selaginella moellendorffii]
Length=451

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            LK N+K LSSF+KYKQEVL G+LDW+PMHKDP FW++NI  FEENDFQ+LR+L+TILD S
Sbjct  321  LKKNLKLLSSFEKYKQEVLSGNLDWTPMHKDPLFWKENIKKFEENDFQVLRILVTILDNS  380

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DPRT AVAC D++QFIQ HPAGR IV D++AK+R M+L+NH+N EV K AL+C+Q+L L
Sbjct  381  RDPRTQAVACQDIAQFIQFHPAGRGIVLDMRAKDRVMRLMNHDNSEVRKEALICVQKLLL  440

Query  365  GAKYASFLQ  391
             AKYASF+Q
Sbjct  441  NAKYASFMQ  449



>ref|XP_002980222.1| hypothetical protein SELMODRAFT_444469 [Selaginella moellendorffii]
 gb|EFJ18482.1| hypothetical protein SELMODRAFT_444469 [Selaginella moellendorffii]
Length=451

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            LK N+K LSSF+KYKQEVL G+LDW+PMHKDP FW++NI  FEENDFQ+LR+L+TILD S
Sbjct  321  LKKNLKLLSSFEKYKQEVLSGNLDWTPMHKDPLFWKENIKKFEENDFQVLRILVTILDNS  380

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DPRT AVAC D++QFIQ HPAGR IV D++AK+R M+L+NH+N EV K AL+C+Q+L L
Sbjct  381  RDPRTQAVACQDIAQFIQFHPAGRGIVLDMRAKDRVMRLMNHDNSEVRKEALICVQKLLL  440

Query  365  GAKYASFLQ  391
             AKYASF+Q
Sbjct  441  NAKYASFMQ  449



>ref|XP_008234540.1| PREDICTED: V-type proton ATPase subunit H, partial [Prunus mume]
Length=423

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/102 (89%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP FWR+N+TNFEENDFQILRVLITILDT
Sbjct  322  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPIFWRENVTNFEENDFQILRVLITILDT  381

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLN  307
            S+DPR LAVACFD+SQF+Q HPAGR+IVTDLKAKER MKL+N
Sbjct  382  STDPRALAVACFDISQFVQQHPAGRIIVTDLKAKERVMKLMN  423



>ref|XP_001761877.1| predicted protein [Physcomitrella patens]
 gb|EDQ73318.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
             LKD+I+KLSSFDK+K +V  G+LDW+ MHKDP FWR+NIT FEENDFQ+LR+LIT+LD 
Sbjct  321  ALKDSIRKLSSFDKFKGQVFSGNLDWTSMHKDPVFWRENITKFEENDFQVLRILITLLDI  380

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S D +TLAVAC D+SQFIQ HPAGR IV DLKAKER MK ++H +PE+ K ALLC+Q++ 
Sbjct  381  SRDSKTLAVACHDISQFIQFHPAGRGIVVDLKAKERVMKHMSHPDPELAKQALLCVQKIL  440

Query  362  LGAKYASFLQ  391
            L AKY S++Q
Sbjct  441  LSAKYVSYMQ  450



>ref|XP_006437443.1| hypothetical protein CICLE_v10033985mg [Citrus clementina]
 gb|ESR50683.1| hypothetical protein CICLE_v10033985mg [Citrus clementina]
Length=114

 Score =   157 bits (397),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 84/101 (83%), Gaps = 6/101 (6%)
 Frame = +2

Query  89   HKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIVT  268
            +K      DN+ +      QILRVL+TILDTSSDPR LAVACFDLSQFIQ HPAGRVIVT
Sbjct  19   YKVSVILMDNLLS------QILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIVT  72

Query  269  DLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  391
            DLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFLQ
Sbjct  73   DLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQ  113



>gb|ABF50108.1| vacuolar ATPase subunit H [Musa acuminata AAA Group]
Length=105

 Score =   149 bits (377),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GLK++IK LSSFDKYKQEVLLGHLDW PMHKDP FWR+NITNFEENDFQILRVLITILDT
Sbjct  27   GLKEHIKTLSSFDKYKQEVLLGHLDWYPMHKDPGFWRENITNFEENDFQILRVLITILDT  86

Query  182  SSDPRTLAVACFDLSQFIQ  238
            S DP  LAVAC+DLSQFIQ
Sbjct  87   SGDPTALAVACYDLSQFIQ  105



>ref|XP_002955475.1| vacuolar ATP synthase, subunit H [Volvox carteri f. nagariensis]
 gb|EFJ43546.1| vacuolar ATP synthase, subunit H [Volvox carteri f. nagariensis]
Length=477

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            LK  I  LS+F+KYK+EV+ G LDWSPMH    FWR+N+  FEE DFQ+LRVL+ I++T+
Sbjct  348  LKQGIIILSNFEKYKKEVMSGQLDWSPMHSSDLFWRENVEKFEERDFQVLRVLLKIIETN  407

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D +TLAV C DL QFI  HP GR IV DL+ KE  M+LL+H + EV K ALLC+Q+L L
Sbjct  408  RDVKTLAVGCHDLGQFIVNHPQGRYIVNDLRGKELVMRLLSHSDAEVQKQALLCVQKLML  467

Query  365  GAKYASFLQ  391
                  FL+
Sbjct  468  SKDKLDFLK  476



>ref|XP_001689562.1| vacuolar ATP synthase subunit H [Chlamydomonas reinhardtii]
 gb|EDP09300.1| vacuolar ATP synthase subunit H [Chlamydomonas reinhardtii]
Length=463

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            LK+ I  LS+FDKYK+EVL   LDWSPMH    FWR N   FEE DFQ+LRVL+ I++T+
Sbjct  334  LKEGIVFLSNFDKYKKEVLSNTLDWSPMHTSDLFWRQNAEKFEERDFQVLRVLLKIIETN  393

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D +TLAV C DL QFI  HP GR IV DL+ KE  M+LL H + EV K ALLC+Q+L L
Sbjct  394  RDVKTLAVGCHDLGQFIVYHPQGRYIVNDLRGKELVMRLLGHSDVEVQKQALLCVQKLML  453

Query  365  GAKYASFLQ  391
                  F++
Sbjct  454  SKDKLDFIK  462



>ref|XP_005646211.1| vacuolar ATP synthase subunit H [Coccomyxa subellipsoidea C-169]
 gb|EIE21667.1| vacuolar ATP synthase subunit H [Coccomyxa subellipsoidea C-169]
Length=465

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
             L  NIK LSS+DKYK+EVL G LDWSPMH    FW +N   FEE DFQ+LRVL+ +L+ 
Sbjct  335  ALAANIKLLSSWDKYKKEVLSGSLDWSPMHTSDLFWLENAPKFEERDFQVLRVLLKLLEQ  394

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S + RTLAVA  DL  FI  HP GR IVTDL+ KE AM+L+ H + EV K ALL +Q++ 
Sbjct  395  SRENRTLAVAASDLGHFISAHPHGRNIVTDLRGKELAMRLMMHPDAEVQKQALLAVQKIL  454

Query  362  LGAKYASFL  388
            L     ++L
Sbjct  455  LAKDKVAYL  463



>gb|KDO49208.1| hypothetical protein CISIN_1g0474481mg, partial [Citrus sinensis]
Length=65

 Score =   124 bits (310),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  200  LAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYA  379
            LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYA
Sbjct  1    LAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYA  60

Query  380  SFLQ  391
            SFLQ
Sbjct  61   SFLQ  64



>ref|XP_011500008.1| PREDICTED: V-type proton ATPase subunit H [Ceratosolen solmsi 
marchali]
Length=484

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  332  LQASVQDLSSFDEYATEVKSGRLEWSPVHKSGKFWRENSSRLNEKNYELLRILVHLLETS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VACFD+ ++++ +P G+ I+  L  K+R M+LL+HE+P V   ALL +Q+L +
Sbjct  392  KDPLVLSVACFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLSHEDPNVRYEALLAVQKLMV  451



>gb|EFN88781.1| Vacuolar proton pump subunit H [Harpegnathos saltator]
Length=529

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+LI +LDTS
Sbjct  377  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILIHLLDTS  436

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  437  KDPLVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  496



>ref|XP_011168339.1| PREDICTED: V-type proton ATPase subunit H-like [Solenopsis invicta]
Length=325

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  173  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILVHLLETS  232

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  233  KDPLVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  292



>ref|XP_011049528.1| PREDICTED: V-type proton ATPase subunit H-like, partial [Acromyrmex 
echinatior]
 gb|EGI68544.1| V-type proton ATPase subunit H [Acromyrmex echinatior]
Length=336

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  184  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILVHLLETS  243

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  244  KDPLVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  303



>ref|XP_011150670.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Harpegnathos 
saltator]
Length=484

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+LI +LDTS
Sbjct  332  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILIHLLDTS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  392  KDPLVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  451



>ref|XP_011150661.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Harpegnathos 
saltator]
Length=519

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+LI +LDTS
Sbjct  367  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILIHLLDTS  426

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  427  KDPLVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  486



>ref|XP_003425170.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Nasonia 
vitripennis]
Length=518

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  366  LQASVQDLSSFDEYATEVKSGRLEWSPVHKSGKFWRENSSRLNEKNYELLRILVHLLETS  425

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VACFD+ ++++ +P G+ I+  L  K+R M+LL+H++P V   ALL +Q+L +
Sbjct  426  KDPLVLSVACFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLSHDDPNVRYEALLAVQKLMV  485



>ref|XP_001605466.1| PREDICTED: V-type proton ATPase subunit H isoform X4 [Nasonia 
vitripennis]
Length=484

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  332  LQASVQDLSSFDEYATEVKSGRLEWSPVHKSGKFWRENSSRLNEKNYELLRILVHLLETS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VACFD+ ++++ +P G+ I+  L  K+R M+LL+H++P V   ALL +Q+L +
Sbjct  392  KDPLVLSVACFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLSHDDPNVRYEALLAVQKLMV  451



>ref|XP_008217756.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Nasonia 
vitripennis]
Length=527

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  378  LQASVQDLSSFDEYATEVKSGRLEWSPVHKSGKFWRENSSRLNEKNYELLRILVHLLETS  437

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VACFD+ ++++ +P G+ I+  L  K+R M+LL+H++P V   ALL +Q+L +
Sbjct  438  KDPLVLSVACFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLSHDDPNVRYEALLAVQKLMV  497



>ref|XP_008217755.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Nasonia 
vitripennis]
Length=530

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  378  LQASVQDLSSFDEYATEVKSGRLEWSPVHKSGKFWRENSSRLNEKNYELLRILVHLLETS  437

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VACFD+ ++++ +P G+ I+  L  K+R M+LL+H++P V   ALL +Q+L +
Sbjct  438  KDPLVLSVACFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLSHDDPNVRYEALLAVQKLMV  497



>gb|EFZ22256.1| hypothetical protein SINV_08430 [Solenopsis invicta]
Length=372

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  220  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILVHLLETS  279

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  280  KDPLVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  339



>gb|ADR51673.1| putative IgE binding protein [Culicoides nubeculosus]
Length=181

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y   V    L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  34   LQNSVQDLSSFDEYSTGVKSARLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  93

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            +DP  LAVA FD+ ++++ +P G+ ++  L  K+  M+LL+HE+P V   ALL +Q+L +
Sbjct  94   TDPLVLAVASFDIGEYVRHYPRGKNVIEQLGGKQLVMQLLSHEDPNVRYEALLAVQKLMV  153



>ref|XP_011329950.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Cerapachys 
biroi]
 gb|EZA59801.1| V-type proton ATPase subunit H [Cerapachys biroi]
Length=484

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  332  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILVHLLETS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  392  KDPLVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  451



>ref|XP_011329949.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Cerapachys 
biroi]
Length=519

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  367  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILVHLLETS  426

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  427  KDPLVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  486



>ref|XP_002680972.1| vacuolar ATP synthase subunit H [Naegleria gruberi]
 gb|EFC48228.1| vacuolar ATP synthase subunit H [Naegleria gruberi]
Length=478

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
             L  +I ++SSFD Y+QEVL GHL+W+P+H    FW++N+   E+N+F ILR LI +LD 
Sbjct  351  NLDAHIDEISSFDDYRQEVLSGHLEWTPVHSSEKFWKENMDKMEQNNFYILRELIKLLDD  410

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
             S+   LA+ C D+ +F++ H  G+ +VTDL AK R ++L+ H N EV K AL C Q++ 
Sbjct  411  ESNTDNLAIGCHDIGEFVRYHNRGKRVVTDLGAKARILQLMEHPNDEVKKYALECCQKIM  470

Query  362  L  364
            +
Sbjct  471  I  471



>ref|XP_003394806.1| PREDICTED: v-type proton ATPase subunit H-like isoform 1 [Bombus 
terrestris]
 ref|XP_003485660.1| PREDICTED: V-type proton ATPase subunit H-like isoform 1 [Bombus 
impatiens]
Length=483

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  332  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  392  KDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  451



>ref|XP_003251675.1| PREDICTED: V-type proton ATPase subunit H isoformX1 [Apis mellifera]
Length=484

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  332  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  392  KDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  451



>ref|XP_003394807.1| PREDICTED: v-type proton ATPase subunit H-like isoform 2 [Bombus 
terrestris]
 ref|XP_003485661.1| PREDICTED: V-type proton ATPase subunit H-like isoform 2 [Bombus 
impatiens]
Length=515

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  364  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  423

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  424  KDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  483



>ref|XP_006624436.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Apis 
dorsata]
Length=484

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  332  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  392  KDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  451



>ref|XP_006624437.1| PREDICTED: V-type proton ATPase subunit H-like isoform X3 [Apis 
dorsata]
Length=482

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  330  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  389

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  390  KDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  449



>ref|XP_006624435.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Apis 
dorsata]
Length=516

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  364  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  423

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  424  KDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  483



>ref|XP_003692426.1| PREDICTED: V-type proton ATPase subunit H-like [Apis florea]
Length=515

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  363  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  422

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  423  KDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  482



>ref|XP_006570954.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Apis mellifera]
Length=482

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  330  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  389

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  390  KDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  449



>ref|XP_003251676.1| PREDICTED: V-type proton ATPase subunit H isoformX2 [Apis mellifera]
Length=516

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  364  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  423

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  424  KDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  483



>ref|XP_003701718.1| PREDICTED: V-type proton ATPase subunit H-like isoform 1 [Megachile 
rotundata]
Length=484

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  332  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  392  KDPLVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLAHEDPNVRYEALLAVQKLMV  451



>ref|XP_003701719.1| PREDICTED: V-type proton ATPase subunit H-like isoform 2 [Megachile 
rotundata]
Length=516

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  364  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLLETS  423

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  424  KDPLVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLAHEDPNVRYEALLAVQKLMV  483



>ref|XP_011302355.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Fopius 
arisanus]
Length=483

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  +V  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  332  LQASVQDLSSFDEYSTQVKSGRLEWSPVHKSSKFWRENASRLNEKNYELLRILVHLLETS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ ++  L  K+R M+LL+HE+P V   AL+ +Q+L +
Sbjct  392  KDPLVLSVASFDIGEYVRHYPRGKHVIEQLGGKQRVMQLLSHEDPNVRYEALIAVQKLMV  451



>ref|XP_008547205.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Microplitis 
demolitor]
Length=484

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  +V  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  332  LQASVQDLSSFDEYSTQVKSGRLEWSPVHKSSKFWRENASRLNEKNYELLRILVHLLETS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ ++  L  K+R M+LL+HE+P V   AL+ +Q+L +
Sbjct  392  KDPLVLSVASFDIGEYVRHYPRGKHVIEQLGGKQRVMQLLSHEDPNVRYEALIAVQKLMV  451



>ref|XP_011302354.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Fopius 
arisanus]
Length=518

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  +V  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  367  LQASVQDLSSFDEYSTQVKSGRLEWSPVHKSSKFWRENASRLNEKNYELLRILVHLLETS  426

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ ++  L  K+R M+LL+HE+P V   AL+ +Q+L +
Sbjct  427  KDPLVLSVASFDIGEYVRHYPRGKHVIEQLGGKQRVMQLLSHEDPNVRYEALIAVQKLMV  486



>ref|XP_002500993.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO62251.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=504

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 85/134 (63%), Gaps = 7/134 (5%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITIL-D  178
            G+    K+ SS+D+Y+ EV  G LDW+  H D  FWR+N +   +N+ Q+LR+L+    D
Sbjct  370  GVLARRKEASSWDRYRAEVTSGALDWTAAHIDEGFWRENASKLTDNNCQLLRMLVAAASD  429

Query  179  TSSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  358
              ++PRTLAV C DL +F   +PAGR +V DLK K+ AM+LL H + EV K ALLC Q+L
Sbjct  430  PGAEPRTLAVVCHDLGEFATHYPAGRFLVQDLKGKDCAMRLLAHADDEVRKQALLCTQKL  489

Query  359  ------FLGAKYAS  382
                  FLG + +S
Sbjct  490  LVQKWQFLGGEVSS  503



>ref|XP_008547204.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Microplitis 
demolitor]
Length=518

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  +V  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  366  LQASVQDLSSFDEYSTQVKSGRLEWSPVHKSSKFWRENASRLNEKNYELLRILVHLLETS  425

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ ++  L  K+R M+LL+HE+P V   AL+ +Q+L +
Sbjct  426  KDPLVLSVASFDIGEYVRHYPRGKHVIEQLGGKQRVMQLLSHEDPNVRYEALIAVQKLMV  485



>emb|CEF98096.1| Armadillo-type fold [Ostreococcus tauri]
Length=512

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +2

Query  20   KKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSS--DP  193
            K+ SS+++Y+ EV+ G L+WS  H+D  FWR+  T   +N+ QILRVLI ++D +   D 
Sbjct  383  KEASSWERYRDEVMSGSLEWSAAHRDEGFWRECATKLTDNNCQILRVLIKLIDGNEPMDS  442

Query  194  RTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            +TLAVAC D+ +F   +PAGR +  DL  KE  M+L+NHE+ EV K AL C+Q+L +
Sbjct  443  KTLAVACNDIGEFAVHYPAGRFLANDLGGKEHTMRLMNHEDDEVRKYALQCVQKLLV  499



>ref|XP_011398291.1| putative V-type proton ATPase subunit H [Auxenochlorella protothecoides]
 gb|KFM25396.1| putative V-type proton ATPase subunit H [Auxenochlorella protothecoides]
Length=471

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 84/128 (66%), Gaps = 0/128 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+  + +LSSF++Y++E+LLG L W P+H    FW  N     E + Q+LRVL+ ++++S
Sbjct  338  LERGVCELSSFERYRRELLLGQLAWGPLHTADDFWAQNAERLAEGNGQLLRVLLKLVESS  397

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D  TLAV C D+++F+  +P GR IVT+L+ KE  M+L+ H +  V + AL C+QR+ L
Sbjct  398  RDATTLAVGCNDVARFVAAYPHGRGIVTELRGKELVMRLMVHPDQAVQRQALACVQRILL  457

Query  365  GAKYASFL  388
               +AS L
Sbjct  458  SKDHASAL  465



>ref|XP_011266061.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Camponotus 
floridanus]
Length=484

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  332  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILVHLLETS  391

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  392  KDALVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  451



>ref|XP_003079498.1| putative vacuolar ATPase subunit H protein (ISS) [Ostreococcus 
tauri]
Length=525

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = +2

Query  20   KKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSS--DP  193
            K+ SS+++Y+ EV+ G L+WS  H+D  FWR+  T   +N+ QILRVLI ++D +   D 
Sbjct  396  KEASSWERYRDEVMSGSLEWSAAHRDEGFWRECATKLTDNNCQILRVLIKLIDGNEPMDS  455

Query  194  RTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            +TLAVAC D+ +F   +PAGR +  DL  KE  M+L+NHE+ EV K AL C+Q+L +
Sbjct  456  KTLAVACNDIGEFAVHYPAGRFLANDLGGKEHTMRLMNHEDDEVRKYALQCVQKLLV  512



>ref|XP_011266060.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Camponotus 
floridanus]
 gb|EFN61620.1| Vacuolar proton pump subunit H [Camponotus floridanus]
Length=519

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  367  LQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILVHLLETS  426

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  427  KDALVLSVASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  486



>ref|XP_004367300.1| vacuolar ATP synthase subunit H [Dictyostelium fasciculatum]
 gb|EGG20317.1| vacuolar ATP synthase subunit H [Dictyostelium fasciculatum]
Length=493

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GL ++I  +SSFDKYK EVL   L+W+P+HK   FW+DN + FEEN+F +L+ L  IL  
Sbjct  364  GLSEDIAIMSSFDKYKAEVLSNELEWTPVHKSEQFWKDNASKFEENNFNVLKFLHLILQK  423

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            SS+P  L+VAC DL +F+  HP G+ IV  L+ K   M L+ + N EV K+AL  +Q++ 
Sbjct  424  SSNPLHLSVACHDLGEFVIHHPRGKHIVEQLQIKPDIMSLMANTNEEVKKHALFALQKMM  483

Query  362  L  364
            +
Sbjct  484  I  484



>gb|AHF70968.1| vacuolar ATP synthase subunit H [Mythimna separata]
Length=474

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E   ++LR L+ +L+ S
Sbjct  328  LQTSVQDLSSFDQYATEVKSGRLEWSPVHKSAKFWRENAIRLNERGQELLRTLVHLLEKS  387

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  LAVAC+D+ ++++ +P G+ I+  L  K+R M LL+HE+P V   ALL +Q+L +
Sbjct  388  KDPVVLAVACYDVGEYVRHYPRGKHIIEQLGGKQRVMHLLSHEDPNVRYEALLAVQKLMV  447



>emb|CDO69013.1| hypothetical protein BN946_scf184834.g20 [Trametes cinnabarina]
Length=398

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L    + L+++D+Y+ E+L GHL W+P+H+   FW++N T   +ND+++L++LI +L+ S
Sbjct  256  LSARFESLTTYDEYRSELLSGHLSWTPVHESDLFWKENATRLNDNDYELLKILIRLLNES  315

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  358
            +DP  LAVA  D+ Q+++ +  G+ I+TDL  K R M+L++H NP+V   AL+ +QRL
Sbjct  316  NDPTVLAVASHDIGQYVKHYERGKKILTDLGGKTRVMELMSHPNPDVRYQALISVQRL  373



>gb|AFN11665.1| vacuolar ATPase subunit H [Locusta migratoria manilensis]
Length=515

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++LR+LI +L+TS
Sbjct  365  LQASVQDLSSFDEYATEIKSGRLEWSPVHKSAKFWRENAGRLNEKNYELLRILIHLLETS  424

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ ++  L  K+  M+LL HE+P V   ALL +Q+L +
Sbjct  425  KDPLVLSVASFDIGEYVRHYPRGKHVIEQLGGKQLVMQLLGHEDPNVRYEALLAVQKLMV  484



>dbj|BAM18133.1| vacuolar H[+]-ATPase SFD subunit [Papilio xuthus]
Length=475

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E   ++LR L+ +L+ S
Sbjct  328  LQASVQDLSSFDQYATEVKSGRLEWSPVHKSAKFWRENAARLNERGQELLRTLVHLLEKS  387

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  LAVAC+D+ ++++ +P G+ I+  L  K+R M LL+HE+P V   ALL +Q+L +
Sbjct  388  RDPVVLAVACYDVGEYVRHYPRGKHIIEQLGGKQRVMYLLSHEDPNVRYEALLAVQKLMV  447



>gb|KIL69551.1| hypothetical protein M378DRAFT_97213 [Amanita muscaria Koide 
BX008]
Length=437

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 83/118 (70%), Gaps = 0/118 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L    + L++FD+YK E+L GH  W+P+H+   FW++N     + D+Q+LR+L+ +++ S
Sbjct  312  LNARFQSLTTFDEYKSELLSGHPSWTPVHESEDFWKENAVKLNDADYQLLRILLRLVNES  371

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  358
            +DP  LAVA  DL Q+++ +  G+ +++DL +K R M+L++HENP+V   ALLC+Q+L
Sbjct  372  NDPTILAVAVHDLGQYVKHYERGKKVISDLGSKARIMQLMSHENPDVAYRALLCVQQL  429



>gb|EHJ66535.1| hypothetical protein KGM_18477 [Danaus plexippus]
Length=565

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E   ++LR L+ +L+ S
Sbjct  418  LQASVQDLSSFDQYATEVKSGRLEWSPVHKSAKFWRENAARLNERGQELLRTLVHLLEKS  477

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  LAVAC+D+ ++++ +P G+ I+  L  K+R M LL+HE+P V   ALL +Q+L +
Sbjct  478  RDPVVLAVACYDVGEYVRHYPRGKHIIEQLGGKQRVMYLLSHEDPNVRYEALLAVQKLMV  537



>ref|XP_001418079.1| F-ATPase family transporter: protons (vacuolar), partial [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO96372.1| F-ATPase family transporter: protons (vacuolar), partial [Ostreococcus 
lucimarinus CCE9901]
Length=104

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (2%)
 Frame = +2

Query  47   KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSS--DPRTLAVACFD  220
            + EV+ G L+WS  HKD  FWR+  T   +N+ QILRVLI ++D S   DP+TLAVAC D
Sbjct  1    RDEVMSGSLEWSAAHKDEGFWRECATKLTDNNCQILRVLIKLIDGSEAMDPKTLAVACND  60

Query  221  LSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQ  352
            + +F   +PAGR +  DL  KE +M+L++HE+ EV K+AL C+Q
Sbjct  61   IGEFAVHYPAGRFLANDLGGKEHSMRLMSHEDDEVRKSALQCVQ  104



>gb|EFA79805.1| vacuolar ATP synthase subunit H [Polysphondylium pallidum PN500]
Length=162

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 77/121 (64%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
             L  +I K+SSFDKY+ EV    L+WSP+HK   FW++N   FEEN   +L++L  IL  
Sbjct  33   ALSQDIAKMSSFDKYRTEVQTNELEWSPVHKSENFWKENALRFEENSHSVLKLLHLILQK  92

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S +P  L++AC DL +F + HP G++I+  L  K+  M+L+ + N EV K AL  +Q++ 
Sbjct  93   SENPVHLSIACHDLGEFARFHPRGKIIIEALGIKQDIMRLMTNPNEEVKKQALFALQKMM  152

Query  362  L  364
            +
Sbjct  153  I  153



>gb|KFM65821.1| V-type proton ATPase subunit H, partial [Stegodyphus mimosarum]
Length=475

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +I+ LSSFD+Y  E+  G L+WSP+H    FWR+N     E ++++L++LI IL TS
Sbjct  334  LQTSIQDLSSFDEYSTEIKSGRLEWSPVHNSEKFWRENTHRLNEKNYELLKILIYILQTS  393

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA  D+ ++++ +P G+ ++  L  K++ M LL+HE+P V   ALLC+Q+L +
Sbjct  394  KDPLALSVAAHDIGEYVRHYPRGKHVIEGLGGKQQVMHLLSHEDPNVRYQALLCVQKLMV  453



>ref|XP_004929804.1| PREDICTED: V-type proton ATPase subunit H-like [Bombyx mori]
Length=453

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E   ++LR L+ +L+ S
Sbjct  307  LQASVQDLSSFDQYATEVKSGRLEWSPVHKSAKFWRENAARLNERGQELLRTLVHLLEKS  366

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  LAVAC+D+ ++++ +P G+ I+  L  K+R M LL+H++P V   ALL +Q+L +
Sbjct  367  RDPVVLAVACYDIGEYVRHYPRGKHIIEQLGGKQRVMYLLSHDDPNVRYEALLAVQKLMV  426



>ref|XP_009308551.1| ATP synthase [Trypanosoma grayi]
 gb|KEG13226.1| ATP synthase [Trypanosoma grayi]
Length=472

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 85/123 (69%), Gaps = 3/123 (2%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++KL+SF +Y+ EVL G L+W+P+H    FW++N+  FE N++++L  L  I+ T+
Sbjct  340  LEQSMEKLTSFSEYRGEVLSGALEWTPVHTSAKFWKENVMQFESNNYEVLAALGNIIMTT  399

Query  185  SDPRTLAVACFDLSQFIQCHPAGR--VIVTDLKA-KERAMKLLNHENPEVTKNALLCIQR  355
                TLAVAC+DL + ++ HP GR  +++  L+  K R M L++H NPEV KNALL +Q+
Sbjct  400  RQDLTLAVACYDLGEVVRHHPTGRALLLLPQLEGVKTRVMALMSHANPEVAKNALLAVQK  459

Query  356  LFL  364
            + +
Sbjct  460  IMV  462



>ref|NP_001040488.1| vacuolar ATP synthase subunit H [Bombyx mori]
 gb|ABF51492.1| vacuolar ATP synthase subunit H [Bombyx mori]
Length=475

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E   ++LR L+ +L+ S
Sbjct  329  LQASVQDLSSFDQYATEVKSGRLEWSPVHKSAKFWRENAARLNERGQELLRTLVHLLEKS  388

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  LAVAC+D+ ++++ +P G+ I+  L  K+R M LL+H++P V   ALL +Q+L +
Sbjct  389  RDPVVLAVACYDIGEYVRHYPRGKHIIEQLGGKQRVMYLLSHDDPNVRYEALLAVQKLMV  448



>ref|XP_005181998.1| PREDICTED: V-type proton ATPase subunit H [Musca domestica]
Length=471

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  E+    L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  324  LQNSVQDLSSFDEYATELRSARLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  383

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VAC+D+ ++++ +P G+ ++  L  K+  M+LL HE+P V   ALL +Q+L +
Sbjct  384  KDPIILSVACYDIGEYVRHYPRGKHVLEQLGGKQIVMQLLGHEDPNVRYEALLAVQKLMV  443



>ref|XP_011413699.1| PREDICTED: V-type proton ATPase subunit H-like isoform X4 [Crassostrea 
gigas]
Length=468

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK+  FWR+N     EN++ +L++L+ +L++S
Sbjct  323  LQESVQDLSSFDEYTSEVKSGRLEWSPVHKNEKFWRENAIRLNENNYSLLKMLVRLLESS  382

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA  DL ++++ +P G+V++  L  K+  M+ L+HE+P V   AL+ +Q+L +
Sbjct  383  KDPLILSVAAHDLGEYVRHYPRGKVVIEQLGGKQMVMQYLSHEDPNVRFEALIAVQKLMV  442



>ref|XP_011413698.1| PREDICTED: V-type proton ATPase subunit H-like isoform X3 [Crassostrea 
gigas]
 gb|EKC28169.1| V-type proton ATPase subunit H [Crassostrea gigas]
Length=478

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK+  FWR+N     EN++ +L++L+ +L++S
Sbjct  333  LQESVQDLSSFDEYTSEVKSGRLEWSPVHKNEKFWRENAIRLNENNYSLLKMLVRLLESS  392

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA  DL ++++ +P G+V++  L  K+  M+ L+HE+P V   AL+ +Q+L +
Sbjct  393  KDPLILSVAAHDLGEYVRHYPRGKVVIEQLGGKQMVMQYLSHEDPNVRFEALIAVQKLMV  452



>ref|XP_011413697.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Crassostrea 
gigas]
Length=484

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK+  FWR+N     EN++ +L++L+ +L++S
Sbjct  339  LQESVQDLSSFDEYTSEVKSGRLEWSPVHKNEKFWRENAIRLNENNYSLLKMLVRLLESS  398

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA  DL ++++ +P G+V++  L  K+  M+ L+HE+P V   AL+ +Q+L +
Sbjct  399  KDPLILSVAAHDLGEYVRHYPRGKVVIEQLGGKQMVMQYLSHEDPNVRFEALIAVQKLMV  458



>sp|Q9U5N0.1|VATH_MANSE RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar proton pump subunit H [Manduca 
sexta]
 emb|CAB55499.1| vacuolar ATPase subunit H [Manduca sexta]
Length=475

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E   ++LR L+ +L+ S
Sbjct  329  LQASVQDLSSFDQYATEVKSGRLEWSPVHKSAKFWRENAARLNERGQELLRTLVHLLEKS  388

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  LAVAC+D+ ++++ +P G+ I+  L  K+R M LL+H++P V   ALL +Q+L +
Sbjct  389  HDPVVLAVACYDVGEYVRHYPRGKHIIEQLGGKQRVMYLLSHDDPNVRYEALLAVQKLMV  448



>ref|XP_011413696.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Crassostrea 
gigas]
Length=582

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK+  FWR+N     EN++ +L++L+ +L++S
Sbjct  437  LQESVQDLSSFDEYTSEVKSGRLEWSPVHKNEKFWRENAIRLNENNYSLLKMLVRLLESS  496

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA  DL ++++ +P G+V++  L  K+  M+ L+HE+P V   AL+ +Q+L +
Sbjct  497  KDPLILSVAAHDLGEYVRHYPRGKVVIEQLGGKQMVMQYLSHEDPNVRFEALIAVQKLMV  556



>ref|NP_523585.2| vacuolar H[+]-ATPase SFD subunit, isoform A [Drosophila melanogaster]
 ref|NP_001260510.1| vacuolar H[+]-ATPase SFD subunit, isoform E [Drosophila melanogaster]
 sp|Q9V3J1.2|VATH_DROME RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar proton pump subunit H; AltName: 
Full=Vacuolar proton pump subunit SFD [Drosophila melanogaster]
 gb|AAF53555.2| vacuolar H[+]-ATPase SFD subunit, isoform A [Drosophila melanogaster]
 gb|AAK93546.1| SD07421p [Drosophila melanogaster]
 gb|ACL85811.1| VhaSFD-PA, partial [synthetic construct]
 gb|ACL90646.1| VhaSFD-PA [synthetic construct]
 gb|AGB93045.1| vacuolar H[+]-ATPase SFD subunit, isoform E [Drosophila melanogaster]
Length=468

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  321  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  380

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  381  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  440



>ref|XP_001965291.1| GF24362 [Drosophila ananassae]
 gb|EDV33425.1| GF24362 [Drosophila ananassae]
Length=545

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  398  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  457

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  458  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  517



>ref|NP_723993.1| vacuolar H[+]-ATPase SFD subunit, isoform D [Drosophila melanogaster]
 gb|AAN10957.1| vacuolar H[+]-ATPase SFD subunit, isoform D [Drosophila melanogaster]
Length=441

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  321  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  380

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  381  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  440



>ref|XP_002079663.1| GD21903 [Drosophila simulans]
 gb|EDX05248.1| GD21903 [Drosophila simulans]
Length=545

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  398  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  457

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  458  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  517



>gb|KFG29320.1| putative vacuolar ATP synthase subunit H [Toxoplasma gondii p89]
Length=141

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+  I++ ++FD+Y  E+  G L +S +H +  FWR+N+  FE ++F+ ++ L+ +LDTS
Sbjct  12   LEQKIRQFNNFDRYCHELDKGQLTFSVLHSEK-FWRENVMAFENDEFRAIKKLVKLLDTS  70

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            +D  TLAVAC+DL +F + HPAG+ +   LK K+R M +++ ++ EV   ALLCIQ+L L
Sbjct  71   TDKTTLAVACYDLGEFARLHPAGKKVCQQLKVKDRVMLMISDKDREVAGEALLCIQKLML  130



>ref|XP_002014753.1| GL19340 [Drosophila persimilis]
 ref|XP_001356546.2| GA14464 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW28749.1| GL19340 [Drosophila persimilis]
 gb|EAL33610.2| GA14464 [Drosophila pseudoobscura pseudoobscura]
Length=548

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  401  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  460

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  461  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  520



>ref|NP_723992.1| vacuolar H[+]-ATPase SFD subunit, isoform B [Drosophila melanogaster]
 gb|AAF53556.3| vacuolar H[+]-ATPase SFD subunit, isoform B [Drosophila melanogaster]
Length=542

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  395  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  454

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  455  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  514



>ref|XP_002038845.1| GM17165 [Drosophila sechellia]
 gb|EDW55491.1| GM17165 [Drosophila sechellia]
Length=545

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  398  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  457

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  458  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  517



>ref|XP_002064801.1| GK15126 [Drosophila willistoni]
 gb|EDW75787.1| GK15126 [Drosophila willistoni]
Length=541

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  394  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  453

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  454  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  513



>ref|XP_001988830.1| GH10362 [Drosophila grimshawi]
 gb|EDW03697.1| GH10362 [Drosophila grimshawi]
Length=546

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  399  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  458

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  459  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  518



>ref|XP_002051650.1| GJ11146 [Drosophila virilis]
 gb|EDW63805.1| GJ11146 [Drosophila virilis]
Length=541

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  394  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  453

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  454  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  513



>ref|XP_002003753.1| GI21354 [Drosophila mojavensis]
 gb|EDW13195.1| GI21354 [Drosophila mojavensis]
Length=545

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  398  LQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  457

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+ L HE+P V   ALL +Q+L +
Sbjct  458  KDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHLGHEDPNVRYEALLAVQKLMV  517



>dbj|BAN20615.1| vacuolar H[+] ATPase subunit [Riptortus pedestris]
Length=479

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+H+   FWR+N     E  +++LR+L+ +L+TS
Sbjct  331  LQASVQDLSSFDEYATEVKSGRLEWSPVHRSAQFWRENAARLNEKKYELLRILVHLLETS  390

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VA +D+ ++++ +P G+ ++  L  K+  M+LL+HE+P V   ALL +Q+L +
Sbjct  391  RDALVLSVASYDIGEYVRHYPRGKTVIEQLGGKQLVMQLLSHEDPNVRYEALLAVQKLMV  450



>gb|KFB39891.1| vacuolar ATP synthase subunit h [Anopheles sinensis]
Length=470

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV    L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  324  LQNSVQDLSSFDEYATEVKSARLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  383

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA +D+ ++++ +P G+ ++  L  K+  M+LL HE+P V   ALL +Q+L +
Sbjct  384  KDPLVLSVASYDIGEYVRHYPRGKHVIEQLGGKQLVMQLLAHEDPNVRYEALLAVQKLMV  443



>emb|CCO31419.1| V-type H+-transporting ATPase 54 kD subunit [Rhizoctonia solani 
AG-1 IB]
Length=159

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ + + L+++D+Y  E+  GHL WSP+H+  AFW++N    +E DF  L+ L+ +L TS
Sbjct  34   LQQSFESLTTYDEYTSELASGHLSWSPVHESEAFWKENAARLDEKDFAQLKRLVELLKTS  93

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  358
             +   LAVA  DL Q+++ H  G+  VT+L  KER M+L++H + +V   ALL +QRL
Sbjct  94   ENNTVLAVAAHDLGQYVKHHDRGKKFVTELGGKERVMELMSHSDADVRYRALLSVQRL  151



>ref|XP_010014842.1| PREDICTED: V-type proton ATPase subunit H, partial [Nestor notabilis]
Length=193

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  52   LGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  111

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  112  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  171



>gb|AHM92104.1| vATPase subunit H, partial [Aphis gossypii]
Length=471

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+H+   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  324  LQASVQDLSSFDEYATEVRSGRLEWSPVHRSAQFWRENASRLNEKNYELLRILVHLLETS  383

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+  M+LL+HE+  V   ALL +Q+L +
Sbjct  384  RDPLFLSVASFDVGEYVRHYPRGKHIIEQLGGKQLVMQLLSHEDANVRYEALLAVQKLMV  443



>gb|ETN60671.1| ATPase SFD subunit [Anopheles darlingi]
Length=552

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV    L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  405  LQNSVQDLSSFDEYATEVKSARLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  464

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA +D+ ++++ +P G+ ++  L  K+  M+LL HE+P V   ALL +Q+L +
Sbjct  465  KDPLVLSVASYDIGEYVRHYPRGKHVIEQLGGKQLVMQLLAHEDPNVRYEALLAVQKLMV  524



>ref|XP_003387765.1| PREDICTED: V-type proton ATPase subunit H-like [Amphimedon queenslandica]
Length=399

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 84/132 (64%), Gaps = 6/132 (5%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            LK +++ LSSFD+Y  EV    L+WSP+HK   FWR+N+    +N++ +LR LI IL  S
Sbjct  266  LKISLQDLSSFDEYSTEVESRRLEWSPVHKSDKFWRENVMKLNDNNYHLLRCLIGILKES  325

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL--  358
            S+P  +AVA  DL ++++ +P G+ ++  L AKE  M L+NH N EV   ALL IQ++  
Sbjct  326  SNPTAMAVASHDLGEYVRYYPRGKNVIDKLGAKELVMGLVNHGNTEVRMQALLSIQKMMV  385

Query  359  ----FLGAKYAS  382
                +LG + A+
Sbjct  386  QNWEYLGKQLAA  397



>gb|KDQ60593.1| hypothetical protein JAAARDRAFT_31557 [Jaapia argillacea MUCL 
33604]
Length=437

 Score =   116 bits (291),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+     L+++D+Y  E+  GHL W+P+H+   FW++N     +  +Q L+ L++++  S
Sbjct  312  LRARFDSLTTYDEYTSELSSGHLSWTPVHESETFWKENAVKLNDKGYQQLKTLVSLMQES  371

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  358
            +DP  LAVA  DL Q+++ +  G+ I+TDL  KERAM+L++HENP+V   AL+ +QRL
Sbjct  372  ADPIVLAVAVHDLGQYVKHYDRGKKIITDLGGKERAMQLMSHENPDVRYQALISVQRL  429



>ref|XP_005709836.1| unnamed protein product [Chondrus crispus]
 emb|CDF39542.1| unnamed protein product [Chondrus crispus]
Length=471

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 75/121 (62%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
             L+  +  +S+FD Y+ EVL G L+W+P H+D  FWR+N+   + N  ++LR L+ +L  
Sbjct  344  ALESELASMSNFDVYRAEVLSGALEWTPAHRDEMFWRENVEKLDRNQQEVLRCLVRVLHE  403

Query  182  SSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            S D   LAVAC DL+QFI+ HP GRVI   L  K R M+L+     EV + AL C+Q L 
Sbjct  404  SGDETVLAVACNDLAQFIKFHPRGRVIAQSLGVKARLMELMVSGEGEVRRYALNCVQVLM  463

Query  362  L  364
            +
Sbjct  464  I  464



>gb|EPZ30805.1| V-type proton ATPase subunit H-like protein [Rozella allomycis 
CSF55]
Length=440

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (65%), Gaps = 4/122 (3%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQIL----RVLITI  172
            L++    LSSFD+Y  E+  G L+WSP H+   FW+ N+  F E DF++L    R+LI I
Sbjct  311  LRNVFNTLSSFDEYVSELRSGKLEWSPPHQSELFWKQNVIKFNEKDFEVLNNWSRILIRI  370

Query  173  LDTSSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQ  352
            L TS DP  L+VAC D+  + + +P GR  + +L AK++ MKL++HEN EV  +AL+ +Q
Sbjct  371  LATSEDPTVLSVACNDIGNYAKFYPNGRRYLQELGAKQKVMKLMSHENSEVKYHALMSVQ  430

Query  353  RL  358
             L
Sbjct  431  NL  432



>ref|XP_310211.4| AGAP009486-PA [Anopheles gambiae str. PEST]
 gb|EAA05847.4| AGAP009486-PA [Anopheles gambiae str. PEST]
Length=537

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV    L+WSP+HK   FWR+N     E  +++LR+L+ +L+TS
Sbjct  390  LQNSVQDLSSFDEYATEVKSARLEWSPVHKSAKFWRENAQRLNEKQYELLRILVHLLETS  449

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA +D+ ++++ +P G+ ++  L  K+  M+LL HE+P V   ALL +Q+L +
Sbjct  450  KDPLVLSVASYDIGEYVRHYPRGKHVIEQLGGKQLVMQLLAHEDPNVRYEALLAVQKLMV  509



>ref|XP_001949116.3| PREDICTED: V-type proton ATPase subunit H [Acyrthosiphon pisum]
Length=477

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+H+   FWR+N +   E ++++LR+L+ +L+TS
Sbjct  330  LQASVQDLSSFDEYATEVKSGRLEWSPVHRSAQFWRENASRLNERNYELLRILVHLLETS  389

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ I+  L  K+  M+LL+H++  V   ALL +Q+L +
Sbjct  390  RDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQLVMQLLSHDDANVRYEALLAVQKLMV  449



>gb|KDR12485.1| V-type proton ATPase subunit H [Zootermopsis nevadensis]
Length=518

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+LI +L+T+
Sbjct  368  LQASVQDLSSFDEYATEVKSGRLEWSPVHKSAKFWRENAPRLNEKNYELLRILIHLLETN  427

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +  G+ I+  L  K+  M+LL HE+P V   ALL +Q+L +
Sbjct  428  RDPLVLSVASFDIGEYVRHYSRGKHIIEQLGGKQLVMQLLGHEDPNVRYEALLAVQKLMV  487



>ref|XP_966693.3| PREDICTED: V-type proton ATPase subunit H isoform X1 [Tribolium 
castaneum]
 gb|AHY84718.1| V-type proton ATPase subunit H variant-1 [Tribolium castaneum]
Length=487

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+LI +L+TS
Sbjct  339  LQNSVQDLSSFDEYATEVKSGRLEWSPVHKSK-FWRENAQRLNEKNYELLRILIHLLETS  397

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA +D+ ++++ +P G+ ++  L  K+  M+LL HE+P V   ALL +Q+L +
Sbjct  398  KDPLVLSVASYDIGEYVRHYPRGKHVIEQLGGKQLVMQLLAHEDPNVRYEALLAVQKLMV  457



>ref|XP_003379257.1| vacuolar proton pump subunit H [Trichinella spiralis]
 gb|EFV61149.1| vacuolar proton pump subunit H [Trichinella spiralis]
Length=504

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L WSP+HK   FW++N   F E +F++L++LI +L+  
Sbjct  345  LQSSVQDLSSFDEYLTEVKSGRLQWSPVHKSEKFWKENTQRFNEKNFEVLKILIKVLEVG  404

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            +DP  L VA  DL ++++ +P G+ ++  L  K   M+LL HE+P V  +ALL +Q++ +
Sbjct  405  NDPLILCVAAHDLGEYVRHYPRGKTVIEQLNGKTMVMRLLTHEDPNVRYHALLSVQKIMV  464



>dbj|GAM29018.1| hypothetical protein SAMD00019534_121940 [Acytostelium subglobosum 
LB1]
Length=450

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  +I ++SSFDKY+ EVL   L+WSP+HK   FW++N   FEEN   +L+ L  IL  S
Sbjct  322  LSQDIARMSSFDKYRAEVLSKELEWSPVHKSEKFWKENAVRFEENSHNVLKFLHLILQKS  381

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             +P  +++AC DL +F++ HP G++I+  L  K   MKL+ + N EV K AL  +Q++ +
Sbjct  382  DNPLHISIACHDLGEFVRFHPRGKIIIETLGIKTDIMKLMTNPNEEVKKQALFALQKMMI  441



>ref|XP_004329545.1| PREDICTED: V-type proton ATPase subunit H-like [Tursiops truncatus]
Length=240

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  99   LGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  158

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  159  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  218



>ref|XP_002736386.1| PREDICTED: V-type proton ATPase subunit H-like [Saccoglossus 
kowalevskii]
Length=470

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L D++  LSSFD+Y  EV  G L+WSP+HK   FWR+N++   E ++++L++LI +L++S
Sbjct  337  LHDSVDGLSSFDEYSSEVKSGRLEWSPVHKSEKFWRENVSRLNERNYELLKILIRLLESS  396

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  LAVA  D+ ++++ +P G+  +  L  KE  M  + H++P V   ALL +Q+L +
Sbjct  397  KDPLVLAVAAHDIGEYVRHYPRGKHNIEQLGGKELVMTYMTHDDPNVRYEALLAVQKLMV  456



>gb|AHF70969.1| vacuolar ATP synthase subunit H [Agrotis ipsilon]
Length=468

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFDKY  EV  G L+WSP+HK   FWR+N     E   ++LR L+ +L  +
Sbjct  322  LQTSVQDLSSFDKYATEVKSGRLEWSPVHKSAKFWRENAARLNERGQELLRTLVHLLQFN  381

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            +DP  LAVAC+D+ ++++ +P G+ I+  L  K+  M LL+H +P V   ALL +Q+L +
Sbjct  382  TDPVVLAVACYDIGEYVRHYPRGKHIIEQLGGKQHVMHLLSHADPNVRYEALLAVQKLMV  441



>ref|NP_001280516.1| V-type proton ATPase subunit H [Tribolium castaneum]
 gb|EFA08618.1| hypothetical protein TcasGA2_TC006281 [Tribolium castaneum]
 gb|AHY84719.1| V-type proton ATPase subunit H variant-2 [Tribolium castaneum]
Length=528

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+LI +L+TS
Sbjct  380  LQNSVQDLSSFDEYATEVKSGRLEWSPVHKSK-FWRENAQRLNEKNYELLRILIHLLETS  438

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA +D+ ++++ +P G+ ++  L  K+  M+LL HE+P V   ALL +Q+L +
Sbjct  439  KDPLVLSVASYDIGEYVRHYPRGKHVIEQLGGKQLVMQLLAHEDPNVRYEALLAVQKLMV  498



>gb|KIM32034.1| hypothetical protein M408DRAFT_327392 [Serendipita vermifera 
MAFF 305830]
Length=438

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 74/119 (62%), Gaps = 0/119 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  N + L+++D+Y  E+  GHL WSP+H    FW++N     E D+Q LRVLI +L +S
Sbjct  313  LSANFQSLTTYDEYTSELASGHLSWSPVHTSEGFWKENAVKLNEKDYQQLRVLIDLLKSS  372

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            +DP  LAV   D+ Q+++ +  G+  V DL  K R M+L+ HEN +V   ALL +QRL 
Sbjct  373  TDPVVLAVGAHDVGQYVKFYDRGKQKVADLGGKTRIMELMTHENNDVQYQALLTVQRLI  431



>gb|EKF99745.1| ATP synthase, putative [Trypanosoma cruzi]
Length=474

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 82/123 (67%), Gaps = 3/123 (2%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++KL+SF +Y+ EVL G ++W+P+H    FWR+N+  FE ND+++L  L   + T+
Sbjct  341  LEHSMEKLTSFSEYRGEVLSGEMEWTPVHTSNKFWRENVMQFENNDYEVLVALGNTIMTT  400

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLK---AKERAMKLLNHENPEVTKNALLCIQR  355
                TLAVAC+DL + ++ HP G+ ++   +    K R M L++H NPEV KNALL +Q+
Sbjct  401  HQDLTLAVACYDLGEVVRHHPTGKSLLLLPRMEGVKNRVMALMSHPNPEVAKNALLAVQK  460

Query  356  LFL  364
            + +
Sbjct  461  IMV  463



>ref|XP_008467401.1| PREDICTED: V-type proton ATPase subunit H [Diaphorina citri]
Length=486

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+YK EV  G L+WSP+H+   FWR+N     E ++++L+ LI +L+TS
Sbjct  336  LQASVQDLSSFDEYKTEVKSGRLEWSPVHRSAQFWRENAPRLHEKNYELLKSLIHLLETS  395

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA +D+ ++++  P G+ ++  L  K+  M+LL+HE+P V   ALL +Q+L +
Sbjct  396  RDPLVLSVASYDIGEYVRHCPRGKHVIEQLGGKQLVMQLLSHEDPNVRYEALLAVQKLMV  455



>emb|CCA75096.1| related to vacuolar ATP synthase subunit H [Piriformospora indica 
DSM 11827]
Length=438

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  N + L+++D+Y  E+  GHL W+P+H    FW++N     E D+Q LRVLI +L +S
Sbjct  313  LTANFQSLTTYDEYTSELASGHLSWTPVHTSDDFWKENAVRLNERDYQQLRVLIGLLQSS  372

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  358
            +DP  LAV   D+ Q+++ +  G+ IV DL  K R M+L+ HEN +V   AL+ +QRL
Sbjct  373  TDPLVLAVGSHDIGQYVKFYDRGKKIVADLGGKTRIMELMGHENGDVRYEALIAVQRL  430



>gb|AEE62279.1| unknown [Dendroctonus ponderosae]
Length=486

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+LI +L+TS
Sbjct  337  LHSSVQDLSSFDEYATEVKSGRLEWSPVHKSK-FWRENAQRLNEKNYELLRILIHLLETS  395

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ ++  L  K   M+LL HE+P V   ALL +Q+L +
Sbjct  396  KDPLVLSVASFDIGEYVRHYPRGKHVIEQLGGKTLVMQLLGHEDPNVRYEALLAVQKLMV  455



>gb|KDD71741.1| V-ATPase subunit H, partial [Helicosporidium sp. ATCC 50920]
Length=178

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 82/129 (64%), Gaps = 0/129 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L++ +++LSS + +++EVL G L W P+H+  AFW ++     + +  +L+ L+ +++T+
Sbjct  46   LEEGVQRLSSLECFRREVLAGVLSWGPLHRQGAFWYEHADKLLDQNALLLKALLRVVETA  105

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             +P TLAVAC DL +F+   PAGR +V DL  K+  M+L+ H + +V + ALLCIQ + L
Sbjct  106  QEPTTLAVACNDLHRFVSHCPAGRGLVVDLGGKQLVMRLVAHPDADVRREALLCIQNILL  165

Query  365  GAKYASFLQ  391
                   LQ
Sbjct  166  SKDKVDVLQ  174



>gb|ENN77808.1| hypothetical protein YQE_05692, partial [Dendroctonus ponderosae]
Length=523

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+LI +L+TS
Sbjct  374  LHSSVQDLSSFDEYATEVKSGRLEWSPVHKSK-FWRENAQRLNEKNYELLRILIHLLETS  432

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ ++  L  K   M+LL HE+P V   ALL +Q+L +
Sbjct  433  KDPLVLSVASFDIGEYVRHYPRGKHVIEQLGGKTLVMQLLGHEDPNVRYEALLAVQKLMV  492



>ref|XP_009020251.1| hypothetical protein HELRODRAFT_81462 [Helobdella robusta]
 gb|ESO01597.1| hypothetical protein HELRODRAFT_81462 [Helobdella robusta]
Length=450

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+  ++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E +F++L++L  +L+TS
Sbjct  310  LQVQVQDLSSFDEYTSELKSGQLEWSPVHKSEKFWRENAGRLNEKNFELLKILAKLLETS  369

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA  DL ++++ +P G+ ++  L  K   M LL+HE+P V   ALL +Q+L +
Sbjct  370  KDPLILSVAAHDLGEYVRHYPHGKTVIEQLGGKTYVMALLSHEDPNVRYEALLAVQKLMV  429



>ref|XP_007863478.1| ATPase, V1 complex, subunit H [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58239.1| ATPase, V1 complex, subunit H [Gloeophyllum trabeum ATCC 11539]
Length=437

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            LK     L+++D+Y  E+  GHL W+P+H+   FW++N T   E D++ L+ L+ +L  S
Sbjct  312  LKSRFDSLTNYDEYTSELASGHLSWTPVHESEVFWKENATKLNEKDYEQLKTLVRLLKES  371

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  358
            SD   LAVA  DL Q+++ +  G+ +VTDL AK R M+L+ H NP+V   AL+ +QRL
Sbjct  372  SDALVLAVAAHDLGQYVKHYERGKKVVTDLGAKTRVMELMTHPNPDVRYQALISVQRL  429



>dbj|GAM26531.1| hypothetical protein SAMD00019534_097060 [Acytostelium subglobosum 
LB1]
Length=449

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +2

Query  14   NIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDP  193
            ++ ++SSFDKYK EVL   L+WSP+HK   FW++N   FEE    +L+ L  IL  S +P
Sbjct  324  DVARMSSFDKYKAEVLARELEWSPVHKSEKFWKENALRFEEQSHSVLKFLHLILQKSDNP  383

Query  194  RTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
              L+VACFDL +F++ HP G+ IV  L  K+  M L+ + N +V KNAL  +Q++ +
Sbjct  384  LHLSVACFDLGEFVRFHPRGKQIVEALGIKKDIMALMTNPNEDVKKNALFALQKMMI  440



>gb|EFX87781.1| hypothetical protein DAPPUDRAFT_306505 [Daphnia pulex]
Length=479

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +I+ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++L++L+ +L+TS
Sbjct  333  LQASIQDLSSFDEYSTEVKAGRLEWSPVHKSERFWRENAPRLTEKNYELLKMLVHLLETS  392

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   LAVA +D+ +F++ +P G+ I+  L  K+  M+LL HE+  V   ALL +Q+L +
Sbjct  393  RDTLVLAVASYDIGEFVRHYPRGKSIIEQLGGKQMVMQLLAHEDSNVRYEALLAVQKLMV  452



>ref|XP_811617.1| ATP synthase [Trypanosoma cruzi strain CL Brener]
 gb|EAN89766.1| ATP synthase, putative [Trypanosoma cruzi]
Length=474

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 82/123 (67%), Gaps = 3/123 (2%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++KL+SF +Y+ EVL G ++W+P+H    FW++N+  FE ND+++L  L   + T+
Sbjct  341  LEHSMEKLTSFSEYRGEVLSGEMEWTPVHTSNKFWKENVMQFENNDYEVLVALGNTIMTT  400

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLK---AKERAMKLLNHENPEVTKNALLCIQR  355
                TLAVAC+DL + ++ HP G+ ++   +    K R M L++H NPEV KNALL +Q+
Sbjct  401  HQDLTLAVACYDLGEVVRHHPTGKSLLLLPRMEGVKSRVMALMSHPNPEVAKNALLAVQK  460

Query  356  LFL  364
            + +
Sbjct  461  IMV  463



>gb|KIO27114.1| hypothetical protein M407DRAFT_73717 [Tulasnella calospora MUT 
4182]
Length=437

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  N + L+++D+Y  E+  GHL W+P+H   AFW++N T   + D++ L+VL+ +L  S
Sbjct  313  LTKNFESLTTYDEYTSELASGHLSWTPVHDSEAFWKENATKLNDKDYEQLKVLVKLLKES  372

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            +DP  LAVA  D+ Q+ + +  G+  ++DL AK R M+L++H+NP+V   ALL  QRL  
Sbjct  373  TDPVVLAVAAHDVGQYTKHYERGKKTLSDLGAKTRVMELMSHDNPDVRYQALLTTQRLVS  432

Query  365  GA  370
             A
Sbjct  433  QA  434



>gb|EKF31005.1| ATP synthase, putative [Trypanosoma cruzi marinkellei]
Length=474

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 82/123 (67%), Gaps = 3/123 (2%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++KL+SF +Y+ EVL G ++W+P+H    FW++N+  FE ND+++L  L   + T+
Sbjct  341  LEHSMEKLTSFSEYRGEVLSGEMEWTPVHTSNKFWKENVMQFENNDYEVLVALGNTIMTT  400

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLK---AKERAMKLLNHENPEVTKNALLCIQR  355
                TLAVAC+DL + ++ HP G+ ++   +    K R M L++H NPEV KNALL +Q+
Sbjct  401  HQDLTLAVACYDLGEVVRHHPTGKSLLLLPRMEGVKNRVMALMSHPNPEVAKNALLAVQK  460

Query  356  LFL  364
            + +
Sbjct  461  IMV  463



>gb|KHJ43624.1| v-ATPase subunit H [Trichuris suis]
Length=501

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSS D+Y  E+  G L WSP+HK   FW++N   F E +F+I+++LI ILD S
Sbjct  345  LQISVQDLSSLDEYVTELKSGRLQWSPVHKMEKFWKENAQRFNEKNFEIVKILIKILDVS  404

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            SDP  L VA  DL ++++ +P G+ ++  L  K   M+LL+HE+P V  +ALL +Q++ +
Sbjct  405  SDPLVLCVAAHDLGEYVRHYPRGKTVIEHLDGKTMVMRLLSHEDPNVRYHALLAVQKIMV  464



>ref|XP_009063312.1| hypothetical protein LOTGIDRAFT_207139 [Lottia gigantea]
 gb|ESO86067.1| hypothetical protein LOTGIDRAFT_207139 [Lottia gigantea]
Length=489

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  +++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L+ +LDTS
Sbjct  343  LLSSVQDLSSFDEYTTEIKSGRLEWSPVHKSDRFWRENAIRLNEKNYELLKILVRLLDTS  402

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA  D+ ++++ +P G+  V  L AK++ M  L HE+P V   AL+ +Q+L +
Sbjct  403  KDPLILSVAAHDIGEYVRYYPRGKNAVEQLGAKQKVMWYLGHEDPNVRYEALIAVQKLMV  462



>ref|XP_006495502.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
 ref|XP_011236637.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
 ref|XP_011236638.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
 ref|XP_011236639.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
Length=276

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  135  LGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  194

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  195  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  254



>gb|ERL95137.1| hypothetical protein D910_12406 [Dendroctonus ponderosae]
Length=517

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+LI +L+TS
Sbjct  368  LHSSVQDLSSFDEYATEVKSGRLEWSPVHKSK-FWRENAQRLNEKNYELLRILIHLLETS  426

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ ++  L  K   M+LL HE+P V   ALL +Q+L +
Sbjct  427  KDPLVLSVASFDIGEYVRHYPRGKHVIEQLGGKTLVMQLLGHEDPNVRYEALLAVQKLMV  486



>gb|KIM87633.1| hypothetical protein PILCRDRAFT_815209 [Piloderma croceum F 1598]
Length=437

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 79/115 (69%), Gaps = 0/115 (0%)
 Frame = +2

Query  14   NIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDP  193
            N + L+++D+Y  E+  GHL W+P+H+   FW++N T   + D++ L+ LI +L+ +SDP
Sbjct  315  NFQSLTTYDEYSSELTSGHLSWTPVHESVDFWKENATKLNDKDYEQLKTLIKLLNEASDP  374

Query  194  RTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  358
              LAVA  D+ Q+++ +  G+ ++TDL AK RAM+L+ H +P+V   ALL +Q+L
Sbjct  375  LVLAVAVHDVGQYVKHYERGKKVITDLGAKTRAMELMTHHDPDVRYRALLSVQQL  429



>gb|KDQ13172.1| hypothetical protein BOTBODRAFT_33784 [Botryobasidium botryosum 
FD-172 SS1]
Length=445

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  N + L+++D+Y  E+  GHL W+P+H+   FW++N     + +F+ L++L+ +L+ S
Sbjct  321  LAKNFESLTTYDEYTSELSSGHLSWTPVHESEMFWKENALRLNDREFEQLKILVELLNDS  380

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  361
            +DP  LAVA  DL Q+++    G+ +VTDL AK R M+L+ H+NP+V  +AL+ +QRL 
Sbjct  381  TDPLVLAVAAHDLGQYVKYCDRGKQVVTDLGAKARVMELMTHDNPDVRYHALISVQRLI  439



>gb|KGL78057.1| V-type proton ATPase subunit H, partial [Tinamus guttatus]
Length=271

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  149  LGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  208

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  209  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  268



>ref|XP_010214153.1| PREDICTED: V-type proton ATPase subunit H, partial [Tinamus guttatus]
Length=290

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  149  LGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  208

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  209  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  268



>ref|XP_002319248.2| hypothetical protein POPTR_0013s07630g [Populus trichocarpa]
 gb|EEE95171.2| hypothetical protein POPTR_0013s07630g [Populus trichocarpa]
Length=397

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILD  178
            GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWR+NITNFEENDFQ+L  + + L+
Sbjct  339  GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRENITNFEENDFQVLVFIFSYLN  397



>ref|XP_002114416.1| hypothetical protein TRIADDRAFT_36227 [Trichoplax adhaerens]
 gb|EDV23506.1| hypothetical protein TRIADDRAFT_36227 [Trichoplax adhaerens]
Length=448

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  N+  LS+FD+Y  EV  GHL+WSP+H+   FWR+N +   EN+++IL++L+ +L  S
Sbjct  306  LSMNLNFLSTFDEYAGEVKSGHLEWSPVHRSERFWRENASMLNENNYEILKILLQLLSDS  365

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  LA+A  D+ ++++ + AG+ ++     KER M+L+ H + +V   ALL +Q+L +
Sbjct  366  RDPLVLAIAAHDIGEYVRHYGAGKRVIEKFGGKERVMQLMTHSDQQVRYEALLAVQKLMV  425



>ref|XP_009860941.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Ciona intestinalis]
Length=466

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 79/122 (65%), Gaps = 6/122 (5%)
 Frame = +2

Query  26   LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  205
            LSSFD+Y  EV    L+WSP+HK   FWR+N T   E ++++LR+L  +L+T  DP  LA
Sbjct  341  LSSFDEYSSEVKSQRLEWSPVHKSEKFWRENSTRLNEKNYELLRILTNLLETCQDPEILA  400

Query  206  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL------FLG  367
            VA  D+ ++++ +P G+ ++  L  K+  M+LL+HEN +V  NAL+ +Q+L      FLG
Sbjct  401  VATHDIGEYVRHYPRGKKVIEQLGIKQLVMQLLSHENTQVKYNALIAVQKLMVHNWEFLG  460

Query  368  AK  373
             +
Sbjct  461  KQ  462



>gb|ETN73338.1| putative V-type proton ATPase subunit H [Necator americanus]
Length=468

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L WSP+HK   FWR+N   F E +F+++++LI +L+TS
Sbjct  328  LQLSVQDLSSFDEYCSEVRSGRLQWSPVHKSDKFWRENAPRFNEKNFELIKILIRLLETS  387

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L VA  D+ ++++ +P G+ ++   + K+  M+LL  E+P V  +ALL +Q+L +
Sbjct  388  QDPLILCVAAHDIGEYVRHYPRGKTVIEQYQGKQAVMRLLTAEDPNVRYHALLAVQKLMV  447



>ref|XP_003118009.1| hypothetical protein CRE_00471 [Caenorhabditis remanei]
 gb|EFO82607.1| hypothetical protein CRE_00471 [Caenorhabditis remanei]
Length=320

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +2

Query  14   NIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDP  193
            ++  LSS+D+Y  EV  G L WSP+HK   FWR+N +   E  F+++++LI +L+TS DP
Sbjct  182  SVHDLSSYDEYYSEVRTGRLTWSPVHKSEKFWRENASKLNEKQFEVVKILIKLLETSKDP  241

Query  194  RTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
              L VA  D+ ++++ +P G+ ++   + K   MKLL+ E+P V  +ALL +Q+L +
Sbjct  242  TILCVAAHDIGEYVRHYPRGKTVIEQYQGKAAVMKLLSAEDPNVRYHALLAVQKLMV  298



>ref|XP_820568.1| ATP synthase [Trypanosoma cruzi strain CL Brener]
 gb|EAN98717.1| ATP synthase, putative [Trypanosoma cruzi]
Length=474

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 81/123 (66%), Gaps = 3/123 (2%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++KL+SF +Y+ EVL G ++W+P+H    FWR+N+  FE ND+++L  L   + T+
Sbjct  341  LEHSMEKLTSFSEYRGEVLSGEMEWTPVHTSNKFWRENVMQFENNDYEVLVALGNTIMTT  400

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLK---AKERAMKLLNHENPEVTKNALLCIQR  355
                TLAVAC DL + ++ HP G+ ++   +    K R M L++H NPEV KNALL +Q+
Sbjct  401  HQDLTLAVACHDLGEVVRHHPTGKSLLLLPRMEGVKNRVMALMSHPNPEVAKNALLAVQK  460

Query  356  LFL  364
            + +
Sbjct  461  IMV  463



>gb|EYC09284.1| hypothetical protein Y032_0061g3257 [Ancylostoma ceylanicum]
Length=468

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L WSP+HK   FWR+N   F E +F+++++LI +L+TS
Sbjct  328  LQLSVQDLSSFDEYCSEVRSGRLQWSPVHKSDKFWRENAPRFNEKNFELIKILIRLLETS  387

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L VA  D+ ++++ +P G+ ++   + K+  M+LL  E+P V  +ALL +Q+L +
Sbjct  388  QDPLILCVAAHDIGEYVRHYPRGKTVIEQYQGKQAVMRLLTAEDPNVRYHALLAVQKLMV  447



>gb|ERE85970.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=476

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 82/125 (66%), Gaps = 0/125 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  342  LGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  401

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  402  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461

Query  365  GAKYA  379
               YA
Sbjct  462  HNWYA  466



>gb|ERL95136.1| hypothetical protein D910_12406 [Dendroctonus ponderosae]
Length=599

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 80/120 (67%), Gaps = 1/120 (1%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++LR+LI +L+TS
Sbjct  450  LHSSVQDLSSFDEYATEVKSGRLEWSPVHKSK-FWRENAQRLNEKNYELLRILIHLLETS  508

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ ++  L  K   M+LL HE+P V   ALL +Q+L +
Sbjct  509  KDPLVLSVASFDIGEYVRHYPRGKHVIEQLGGKTLVMQLLGHEDPNVRYEALLAVQKLMV  568



>ref|XP_009499916.1| PREDICTED: V-type proton ATPase subunit H, partial [Phalacrocorax 
carbo]
Length=308

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  167  LGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  226

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  227  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  286



>ref|XP_002123830.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Ciona intestinalis]
Length=481

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 79/122 (65%), Gaps = 6/122 (5%)
 Frame = +2

Query  26   LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  205
            LSSFD+Y  EV    L+WSP+HK   FWR+N T   E ++++LR+L  +L+T  DP  LA
Sbjct  356  LSSFDEYSSEVKSQRLEWSPVHKSEKFWRENSTRLNEKNYELLRILTNLLETCQDPEILA  415

Query  206  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL------FLG  367
            VA  D+ ++++ +P G+ ++  L  K+  M+LL+HEN +V  NAL+ +Q+L      FLG
Sbjct  416  VATHDIGEYVRHYPRGKKVIEQLGIKQLVMQLLSHENTQVKYNALIAVQKLMVHNWEFLG  475

Query  368  AK  373
             +
Sbjct  476  KQ  477



>ref|XP_002428318.1| vacuolar ATP synthase subunit H, putative [Pediculus humanus 
corporis]
 gb|EEB15580.1| vacuolar ATP synthase subunit H, putative [Pediculus humanus 
corporis]
Length=455

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++ LSSFD+Y  EV  G L+WSP+HK   FWR+N     E ++++L +LI +L  S
Sbjct  333  LQASVQDLSSFDEYASEVKSGRLEWSPVHKSAKFWRENAGRLNEKNYELLAILIDLLQQS  392

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA FD+ ++++ +P G+ ++  L  K+  M+LL H++P V   AL+ +Q+L +
Sbjct  393  KDPLVLSVASFDIGEYVRHYPRGKNVIEQLGGKQLVMQLLGHDDPNVRYEALIAVQKLMV  452



>gb|EFO25176.2| vacuolar h ATPase 15 [Loa loa]
Length=422

 Score =   113 bits (282),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L  +I+  SSFD+Y  EV  G L WSP+HK   FWR+N   F E DF++LR+LI IL+  
Sbjct  284  LHSSIQDFSSFDEYVSEVRSGRLQWSPVHKSEKFWRENAQKFNEKDFELLRILINILELQ  343

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            SD  TL VA  D+ ++++ +P G+  +  L+ K+  MKLL+ ++P V  ++LL IQ+L +
Sbjct  344  SDTLTLCVAVHDIGEYVRHYPRGKNKIEQLQGKQAVMKLLSADDPNVRYHSLLAIQKLMV  403



>gb|EGW09777.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=473

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 82/125 (66%), Gaps = 0/125 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  339  LGESVEDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  398

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  399  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  458

Query  365  GAKYA  379
               YA
Sbjct  459  HNWYA  463



>ref|XP_010125506.1| PREDICTED: V-type proton ATPase subunit H, partial [Chlamydotis 
macqueenii]
Length=290

 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  149  LGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  208

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  209  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  268



>ref|XP_001652018.1| AAEL006516-PA [Aedes aegypti]
 gb|EAT41889.1| AAEL006516-PA [Aedes aegypti]
Length=475

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L++++  LSSFD+Y  E+    L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  328  LQNSVHDLSSFDEYATEIKSARLEWSPVHKSAKFWRENAQRLNEKNYELLRILVHLLETS  387

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP  L+VA +D+ ++++ +P G+ ++  L  K+  M LL H++P V   ALL +Q+L +
Sbjct  388  KDPLVLSVASYDIGEYVRHYPRGKHVIEQLGGKQLVMLLLGHDDPNVRYEALLAVQKLMV  447



>gb|ESL11474.1| ATP synthase [Trypanosoma rangeli SC58]
Length=478

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 81/123 (66%), Gaps = 3/123 (2%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+ +++KL+SF +Y+ EVL G L+W+P+H    FW++N   F+ ND+++L  L  I+ T+
Sbjct  341  LEHSMEKLTSFSEYRGEVLSGELEWTPVHTSVKFWKENAGQFDNNDYEVLVALGRIIMTT  400

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIV---TDLKAKERAMKLLNHENPEVTKNALLCIQR  355
                TLAVAC+DL + I+ HP G+ ++        K R M L++H NPEV KNALL +Q+
Sbjct  401  HHDLTLAVACYDLGEVIRHHPTGKALLLLPCMEGVKGRVMSLMSHANPEVAKNALLAVQK  460

Query  356  LFL  364
            + +
Sbjct  461  IMV  463



>ref|XP_011213954.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Bactrocera 
dorsalis]
Length=473

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+++++ LSSFD+Y  E+    L+WSP+HK   FWR+N     E ++++LR+L+ +L+TS
Sbjct  324  LQNSVQDLSSFDEYATELRSARLEWSPVHKSAKFWRENAHRLNEKNYELLRILVHLLETS  383

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             D   L+VACFD+ ++++ +P G+ ++  L  K+  M+LL H++P V   ALL +Q+L +
Sbjct  384  KDHIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQLLAHDDPNVRYEALLAVQKLMV  443



>ref|XP_003291419.1| hypothetical protein DICPUDRAFT_156018 [Dictyostelium purpureum]
 gb|EGC32065.1| hypothetical protein DICPUDRAFT_156018 [Dictyostelium purpureum]
Length=446

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 79/122 (65%), Gaps = 1/122 (1%)
 Frame = +2

Query  2    GLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDT  181
            GL  +I  +SSF+KYK E++ G L+W+P+HK   FW++NIT FEE ++ +++ L  IL  
Sbjct  314  GLAKDIDNMSSFNKYKAEIVSGELEWTPVHKSERFWKENITKFEEQNYYVIKSLHQILSN  373

Query  182  S-SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  358
              S P  L++AC DL +F++ HP G+ I+  L+ K   M L+ + N EV K AL  +Q++
Sbjct  374  GQSTPIQLSIACHDLGEFVRHHPRGKAIIDFLQIKPAIMALMANPNEEVKKQALFALQKM  433

Query  359  FL  364
             L
Sbjct  434  ML  435



>ref|XP_009946371.1| PREDICTED: V-type proton ATPase subunit H, partial [Leptosomus 
discolor]
Length=343

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  202  LGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  261

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  262  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  321



>ref|XP_009811839.1| PREDICTED: V-type proton ATPase subunit H, partial [Gavia stellata]
Length=323

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L ++++ LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S
Sbjct  202  LGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVS  261

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
             DP+ LAVA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  262  DDPQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  321



>ref|XP_003879871.1| putative vacuolar ATP synthase subunit h [Neospora caninum Liverpool]
 emb|CBZ49836.1| putative vacuolar ATP synthase subunit h [Neospora caninum Liverpool]
Length=481

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 82/120 (68%), Gaps = 1/120 (1%)
 Frame = +2

Query  5    LKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS  184
            L+   ++ ++FD+Y  E+  G L WS +H +  FWR+N+  FE ++F+ ++ L+ +LDTS
Sbjct  352  LEQKTRQFNNFDRYCHELDKGKLTWSVIHSEK-FWRENVMAFENDEFRAVKKLVKLLDTS  410

Query  185  SDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  364
            +D  TLAVAC+DL +F + HPAG+ +   LK K+R M +++ ++ EV   ALLCIQ+L L
Sbjct  411  TDKTTLAVACYDLGEFARLHPAGKKVCQQLKVKDRVMLMISDKDREVAGEALLCIQKLML  470



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250