BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN042O10

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006353173.1|  PREDICTED: uncharacterized protein At1g04910...    174   3e-48   Solanum tuberosum [potatoes]
ref|XP_006353172.1|  PREDICTED: uncharacterized protein At1g04910...    174   3e-48   
ref|XP_009797993.1|  PREDICTED: uncharacterized protein At1g04910...    174   5e-48   Nicotiana sylvestris
ref|XP_009797995.1|  PREDICTED: uncharacterized protein At1g04910...    174   5e-48   Nicotiana sylvestris
gb|AAK84479.1|  putative auxin growth promotor protein                  172   1e-47   Solanum lycopersicum
ref|XP_011097478.1|  PREDICTED: uncharacterized protein At1g04910...    173   1e-47   Sesamum indicum [beniseed]
ref|XP_010312649.1|  PREDICTED: uncharacterized protein At1g04910...    172   2e-47   Solanum lycopersicum
ref|XP_010312648.1|  PREDICTED: uncharacterized protein At1g04910...    172   2e-47   
ref|XP_010312647.1|  PREDICTED: uncharacterized protein At1g04910...    172   2e-47   
gb|KDP29763.1|  hypothetical protein JCGZ_18698                         171   9e-47   Jatropha curcas
gb|KJB18177.1|  hypothetical protein B456_003G038000                    166   5e-46   Gossypium raimondii
gb|KJB18178.1|  hypothetical protein B456_003G038000                    166   8e-46   Gossypium raimondii
ref|XP_003534239.1|  PREDICTED: uncharacterized protein At1g04910...    168   9e-46   Glycine max [soybeans]
ref|XP_006587571.1|  PREDICTED: uncharacterized protein At1g04910...    168   9e-46   Glycine max [soybeans]
gb|KCW54611.1|  hypothetical protein EUGRSUZ_I00557                     167   9e-46   Eucalyptus grandis [rose gum]
gb|KCW54609.1|  hypothetical protein EUGRSUZ_I00557                     167   1e-45   Eucalyptus grandis [rose gum]
ref|XP_010027954.1|  PREDICTED: uncharacterized protein At1g04910       167   1e-45   Eucalyptus grandis [rose gum]
ref|XP_009623753.1|  PREDICTED: uncharacterized protein At1g04910...    166   2e-45   
ref|XP_009623754.1|  PREDICTED: uncharacterized protein At1g04910...    166   3e-45   Nicotiana tomentosiformis
ref|XP_009783617.1|  PREDICTED: uncharacterized protein At1g04910...    166   4e-45   Nicotiana sylvestris
emb|CDP01562.1|  unnamed protein product                                166   4e-45   Coffea canephora [robusta coffee]
gb|KHN14510.1|  DUF246 domain-containing protein                        166   5e-45   Glycine soja [wild soybean]
ref|XP_003517397.1|  PREDICTED: uncharacterized protein At1g04910...    166   6e-45   Glycine max [soybeans]
ref|XP_006573005.1|  PREDICTED: uncharacterized protein At1g04910...    166   6e-45   Glycine max [soybeans]
gb|KJB18182.1|  hypothetical protein B456_003G038000                    166   7e-45   Gossypium raimondii
ref|XP_002268599.2|  PREDICTED: uncharacterized protein At1g04910       166   7e-45   Vitis vinifera
gb|KJB18179.1|  hypothetical protein B456_003G038000                    166   7e-45   Gossypium raimondii
gb|KJB44061.1|  hypothetical protein B456_007G232700                    162   1e-44   Gossypium raimondii
ref|XP_002310868.1|  hypothetical protein POPTR_0007s14280g             164   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_007158370.1|  hypothetical protein PHAVU_002G147300g             164   2e-44   Phaseolus vulgaris [French bean]
ref|XP_011021848.1|  PREDICTED: uncharacterized protein At1g04910       164   2e-44   Populus euphratica
ref|XP_007207425.1|  hypothetical protein PRUPE_ppa004921mg             164   2e-44   
ref|XP_007207426.1|  hypothetical protein PRUPE_ppa004921mg             164   2e-44   
gb|AGV54211.1|  O-fucosyltransferase family protein                     164   4e-44   Phaseolus vulgaris [French bean]
ref|XP_011099984.1|  PREDICTED: uncharacterized protein At1g04910...    163   7e-44   Sesamum indicum [beniseed]
ref|XP_011099981.1|  PREDICTED: uncharacterized protein At1g04910...    163   7e-44   Sesamum indicum [beniseed]
ref|XP_009350347.1|  PREDICTED: uncharacterized protein At1g04910...    162   1e-43   Pyrus x bretschneideri [bai li]
ref|XP_009350346.1|  PREDICTED: uncharacterized protein At1g04910...    162   1e-43   Pyrus x bretschneideri [bai li]
gb|KJB44059.1|  hypothetical protein B456_007G232700                    162   1e-43   Gossypium raimondii
ref|XP_009364252.1|  PREDICTED: uncharacterized protein At1g04910...    161   2e-43   Pyrus x bretschneideri [bai li]
ref|XP_009364251.1|  PREDICTED: uncharacterized protein At1g04910...    162   2e-43   Pyrus x bretschneideri [bai li]
gb|KHG27420.1|  hypothetical protein F383_15612                         161   3e-43   Gossypium arboreum [tree cotton]
ref|XP_004288516.2|  PREDICTED: uncharacterized protein At1g04910       161   3e-43   Fragaria vesca subsp. vesca
ref|XP_008440542.1|  PREDICTED: uncharacterized protein At1g04910       161   3e-43   Cucumis melo [Oriental melon]
ref|XP_002533683.1|  conserved hypothetical protein                     161   3e-43   Ricinus communis
ref|XP_008385667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    161   3e-43   Malus domestica [apple tree]
gb|KHG05570.1|  hypothetical protein F383_31127                         161   4e-43   Gossypium arboreum [tree cotton]
dbj|BAE71212.1|  hypothetical protein                                   159   4e-43   Trifolium pratense [peavine clover]
gb|KDO60569.1|  hypothetical protein CISIN_1g009234mg                   159   6e-43   Citrus sinensis [apfelsine]
ref|XP_008347790.1|  PREDICTED: uncharacterized protein At1g04910...    160   7e-43   
ref|XP_008236140.1|  PREDICTED: uncharacterized protein At1g04910...    160   7e-43   Prunus mume [ume]
ref|XP_008347789.1|  PREDICTED: uncharacterized protein At1g04910...    160   7e-43   
ref|XP_008236135.1|  PREDICTED: uncharacterized protein At1g04910...    160   7e-43   Prunus mume [ume]
ref|XP_010523310.1|  PREDICTED: uncharacterized protein At1g04910...    159   1e-42   
gb|AFK40388.1|  unknown                                                 159   1e-42   Lotus japonicus
ref|XP_007047791.1|  O-fucosyltransferase family protein isoform 1      159   1e-42   
ref|XP_006426272.1|  hypothetical protein CICLE_v10025329mg             159   1e-42   Citrus clementina [clementine]
ref|XP_006466306.1|  PREDICTED: uncharacterized protein At1g04910...    159   1e-42   Citrus sinensis [apfelsine]
ref|XP_006280335.1|  hypothetical protein CARUB_v10026260mg             159   2e-42   
ref|XP_004509777.1|  PREDICTED: uncharacterized protein At1g04910...    158   2e-42   Cicer arietinum [garbanzo]
ref|XP_010113429.1|  hypothetical protein L484_026763                   159   3e-42   
ref|XP_010523312.1|  PREDICTED: uncharacterized protein At1g04910...    158   3e-42   Tarenaya hassleriana [spider flower]
ref|XP_010444520.1|  PREDICTED: uncharacterized protein At1g04910...    158   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006394028.1|  hypothetical protein EUTSA_v10004041mg             158   3e-42   
ref|XP_006394027.1|  hypothetical protein EUTSA_v10004041mg             158   3e-42   Eutrema salsugineum [saltwater cress]
ref|XP_003613050.1|  DUF246 domain-containing protein                   154   3e-42   
ref|XP_010484355.1|  PREDICTED: uncharacterized protein At1g04910...    158   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_002864958.1|  hypothetical protein ARALYDRAFT_496780             158   3e-42   
ref|XP_010463027.1|  PREDICTED: uncharacterized protein At1g04910...    158   4e-42   Camelina sativa [gold-of-pleasure]
gb|EYU39303.1|  hypothetical protein MIMGU_mgv1a004838mg                158   4e-42   Erythranthe guttata [common monkey flower]
ref|XP_009150636.1|  PREDICTED: uncharacterized protein At1g04910       158   4e-42   Brassica rapa
dbj|BAB11569.1|  unnamed protein product                                158   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130514.1|  PREDICTED: uncharacterized protein At1g04910...    158   4e-42   Brassica rapa
ref|XP_009130513.1|  PREDICTED: uncharacterized protein At1g04910...    158   4e-42   Brassica rapa
emb|CDY14569.1|  BnaC03g48900D                                          157   4e-42   Brassica napus [oilseed rape]
emb|CDY37829.1|  BnaAnng04900D                                          157   5e-42   Brassica napus [oilseed rape]
gb|AAM13166.1|  unknown protein                                         157   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201350.2|  O-fucosyltransferase family protein                   157   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523308.1|  PREDICTED: uncharacterized protein At1g04910...    158   5e-42   Tarenaya hassleriana [spider flower]
emb|CDY33958.1|  BnaC02g43790D                                          157   5e-42   Brassica napus [oilseed rape]
ref|XP_004143441.1|  PREDICTED: DUF246 domain-containing protein ...    157   8e-42   Cucumis sativus [cucumbers]
ref|XP_010547595.1|  PREDICTED: uncharacterized protein At1g04910...    157   1e-41   Tarenaya hassleriana [spider flower]
gb|EYU30935.1|  hypothetical protein MIMGU_mgv1a004530mg                156   1e-41   Erythranthe guttata [common monkey flower]
gb|EYU30936.1|  hypothetical protein MIMGU_mgv1a004530mg                156   1e-41   Erythranthe guttata [common monkey flower]
ref|XP_010519195.1|  PREDICTED: uncharacterized protein At1g04910...    156   2e-41   Tarenaya hassleriana [spider flower]
ref|XP_010107675.1|  hypothetical protein L484_007693                   156   3e-41   
ref|XP_010254530.1|  PREDICTED: uncharacterized protein At1g04910...    155   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010277497.1|  PREDICTED: uncharacterized protein At1g04910...    154   7e-41   Nelumbo nucifera [Indian lotus]
ref|XP_003613049.1|  DUF246 domain-containing protein                   154   1e-40   Medicago truncatula
tpg|DAA61413.1|  TPA: hypothetical protein ZEAMMB73_640362              144   2e-40   
ref|XP_010680342.1|  PREDICTED: uncharacterized protein At1g04910       152   4e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010692399.1|  PREDICTED: uncharacterized protein At1g04910       152   5e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS72903.1|  hypothetical protein M569_01846                         152   5e-40   Genlisea aurea
ref|XP_009401410.1|  PREDICTED: uncharacterized protein At1g04910...    151   9e-40   
emb|CDP11502.1|  unnamed protein product                                151   1e-39   Coffea canephora [robusta coffee]
ref|XP_003602912.1|  PsRT17-1 like protein                              151   1e-39   Medicago truncatula
ref|XP_004501643.1|  PREDICTED: uncharacterized protein At1g04910...    150   2e-39   Cicer arietinum [garbanzo]
ref|XP_008444924.1|  PREDICTED: uncharacterized protein At1g04910...    150   3e-39   Cucumis melo [Oriental melon]
ref|XP_009785662.1|  PREDICTED: uncharacterized protein At1g04910...    149   5e-39   Nicotiana sylvestris
ref|XP_006338062.1|  PREDICTED: uncharacterized protein At1g04910...    149   7e-39   Solanum tuberosum [potatoes]
emb|CAN78778.1|  hypothetical protein VITISV_029752                     148   1e-38   Vitis vinifera
ref|XP_002283844.1|  PREDICTED: uncharacterized protein At1g04910...    148   1e-38   Vitis vinifera
gb|KCW68511.1|  hypothetical protein EUGRSUZ_F02148                     148   1e-38   Eucalyptus grandis [rose gum]
ref|XP_004237994.1|  PREDICTED: uncharacterized protein At1g04910       148   1e-38   Solanum lycopersicum
ref|XP_006852943.1|  hypothetical protein AMTR_s00033p00238220          147   1e-38   
ref|XP_010061545.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    148   1e-38   Eucalyptus grandis [rose gum]
ref|XP_010523344.1|  PREDICTED: uncharacterized protein At1g04910       148   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_010937178.1|  PREDICTED: uncharacterized protein At1g04910...    148   2e-38   Elaeis guineensis
ref|XP_009624657.1|  PREDICTED: uncharacterized protein At1g04910...    147   4e-38   Nicotiana tomentosiformis
gb|ABJ96379.1|  expressed protein                                       147   4e-38   Prunus persica
ref|XP_003526543.1|  PREDICTED: uncharacterized protein At1g04910...    147   4e-38   Glycine max [soybeans]
gb|KGN62755.1|  hypothetical protein Csa_2G370540                       150   4e-38   Cucumis sativus [cucumbers]
ref|XP_007018221.1|  O-fucosyltransferase family protein                147   5e-38   
gb|KHN09000.1|  DUF246 domain-containing protein                        147   5e-38   Glycine soja [wild soybean]
ref|XP_008219267.1|  PREDICTED: uncharacterized protein At1g04910...    147   5e-38   Prunus mume [ume]
ref|XP_007222858.1|  hypothetical protein PRUPE_ppa004255mg             147   5e-38   Prunus persica
ref|XP_002514041.1|  conserved hypothetical protein                     146   5e-38   Ricinus communis
ref|XP_004301363.1|  PREDICTED: uncharacterized protein At1g04910       146   6e-38   Fragaria vesca subsp. vesca
ref|XP_010939815.1|  PREDICTED: uncharacterized protein At1g04910...    146   7e-38   
gb|KJB58883.1|  hypothetical protein B456_009G229500                    146   7e-38   Gossypium raimondii
ref|XP_006661225.1|  PREDICTED: uncharacterized protein At1g04910...    146   7e-38   
gb|KJB58881.1|  hypothetical protein B456_009G229500                    146   8e-38   Gossypium raimondii
ref|XP_004152738.1|  PREDICTED: DUF246 domain-containing protein ...    146   9e-38   Cucumis sativus [cucumbers]
ref|XP_002867661.1|  predicted protein                                  146   1e-37   Arabidopsis lyrata subsp. lyrata
gb|AGV54860.1|  O-fucosyltransferase family protein                     145   2e-37   Phaseolus vulgaris [French bean]
dbj|BAK06980.1|  predicted protein                                      145   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006472461.1|  PREDICTED: uncharacterized protein At1g04910...    144   4e-37   Citrus sinensis [apfelsine]
ref|XP_006472463.1|  PREDICTED: uncharacterized protein At1g04910...    144   4e-37   
ref|XP_004956798.1|  PREDICTED: uncharacterized protein At1g04910...    144   4e-37   Setaria italica
ref|NP_001063155.1|  Os09g0412200                                       144   4e-37   
ref|XP_008651492.1|  PREDICTED: LOC100283829 isoform X1                 143   5e-37   Zea mays [maize]
emb|CAA23010.1|  PsRT17-1 like protein                                  143   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008368388.1|  PREDICTED: uncharacterized protein At1g04910...    143   7e-37   
gb|EMT16885.1|  hypothetical protein F775_06176                         143   8e-37   
ref|XP_003523785.1|  PREDICTED: uncharacterized protein At1g04910...    143   9e-37   Glycine max [soybeans]
ref|XP_009376221.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    143   9e-37   Pyrus x bretschneideri [bai li]
gb|KHN08263.1|  DUF246 domain-containing protein                        143   9e-37   Glycine soja [wild soybean]
ref|XP_011016934.1|  PREDICTED: uncharacterized protein At1g04910...    142   1e-36   Populus euphratica
ref|XP_011016933.1|  PREDICTED: uncharacterized protein At1g04910...    143   1e-36   Populus euphratica
ref|NP_001150199.1|  LOC100283829                                       142   1e-36   Zea mays [maize]
gb|EPS73888.1|  hypothetical protein M569_00867                         142   1e-36   Genlisea aurea
ref|XP_002301095.2|  hypothetical protein POPTR_0002s10600g             142   1e-36   
gb|KFK28724.1|  hypothetical protein AALP_AA7G039000                    142   2e-36   Arabis alpina [alpine rockcress]
ref|NP_194184.2|  O-fucosyltransferase family protein                   142   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006433827.1|  hypothetical protein CICLE_v10000880mg             142   2e-36   Citrus clementina [clementine]
ref|XP_006433826.1|  hypothetical protein CICLE_v10000880mg             142   2e-36   
ref|XP_002462371.1|  hypothetical protein SORBIDRAFT_02g024540          141   4e-36   Sorghum bicolor [broomcorn]
gb|EMS64135.1|  hypothetical protein TRIUR3_23110                       141   5e-36   Triticum urartu
ref|XP_009138156.1|  PREDICTED: uncharacterized protein At1g04910       140   7e-36   Brassica rapa
ref|XP_010448552.1|  PREDICTED: uncharacterized protein At1g04910...    140   9e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010433755.1|  PREDICTED: uncharacterized protein At1g04910...    140   1e-35   Camelina sativa [gold-of-pleasure]
emb|CDY03446.1|  BnaC01g16360D                                          140   1e-35   
ref|XP_010439017.1|  PREDICTED: uncharacterized protein At1g04910...    140   1e-35   
emb|CDY34289.1|  BnaA01g13920D                                          142   2e-35   Brassica napus [oilseed rape]
ref|XP_006285210.1|  hypothetical protein CARUB_v10006569mg             139   2e-35   Capsella rubella
gb|KDP41479.1|  hypothetical protein JCGZ_15886                         139   2e-35   Jatropha curcas
gb|EEC84568.1|  hypothetical protein OsI_31345                          137   1e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_006413418.1|  hypothetical protein EUTSA_v10024936mg             136   2e-34   Eutrema salsugineum [saltwater cress]
ref|XP_003578106.1|  PREDICTED: uncharacterized protein At1g04910...    134   1e-33   Brachypodium distachyon [annual false brome]
gb|EEE69695.1|  hypothetical protein OsJ_29339                          135   2e-33   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA61415.1|  TPA: hypothetical protein ZEAMMB73_640362              133   2e-33   
ref|XP_001777077.1|  predicted protein                                  133   3e-33   
ref|XP_010312650.1|  PREDICTED: uncharacterized protein At1g04910...    132   8e-33   Solanum lycopersicum
ref|XP_002967262.1|  hypothetical protein SELMODRAFT_87093              130   2e-32   
ref|XP_002960458.1|  hypothetical protein SELMODRAFT_75338              129   4e-32   
emb|CDX92640.1|  BnaC07g38980D                                          121   5e-30   
gb|KJB48896.1|  hypothetical protein B456_008G092600                    122   3e-29   Gossypium raimondii
ref|XP_007136337.1|  hypothetical protein PHAVU_009G0371001g            107   1e-26   Phaseolus vulgaris [French bean]
emb|CDY11018.1|  BnaA03g46770D                                        98.2    8e-23   Brassica napus [oilseed rape]
ref|XP_006383813.1|  hypothetical protein POPTR_0005s28420g           87.8    2e-18   
gb|AAB72114.1|  PsRT17-1                                              88.6    2e-17   Pisum sativum [garden pea]
ref|XP_001765982.1|  predicted protein                                79.3    5e-14   
ref|XP_010104478.1|  hypothetical protein L484_025447                 75.9    2e-13   
gb|EPS68582.1|  hypothetical protein M569_06186                       73.6    2e-13   Genlisea aurea
ref|XP_010538926.1|  PREDICTED: uncharacterized protein At1g04910...  77.0    4e-13   Tarenaya hassleriana [spider flower]
emb|CDP10650.1|  unnamed protein product                              77.0    5e-13   Coffea canephora [robusta coffee]
ref|XP_006826849.1|  hypothetical protein AMTR_s00010p00112560        75.5    1e-12   Amborella trichopoda
ref|XP_009362464.1|  PREDICTED: uncharacterized protein At1g04910...  75.1    1e-12   Pyrus x bretschneideri [bai li]
ref|XP_009362462.1|  PREDICTED: uncharacterized protein At1g04910...  74.7    3e-12   Pyrus x bretschneideri [bai li]
gb|KHG19963.1|  hypothetical protein F383_04918                       74.7    3e-12   Gossypium arboreum [tree cotton]
ref|XP_010274715.1|  PREDICTED: uncharacterized protein At1g04910...  74.3    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_004299893.1|  PREDICTED: uncharacterized protein At1g04910     74.3    3e-12   Fragaria vesca subsp. vesca
ref|XP_011096470.1|  PREDICTED: uncharacterized protein At1g04910     74.3    4e-12   Sesamum indicum [beniseed]
gb|KJB30799.1|  hypothetical protein B456_005G161000                  73.9    4e-12   Gossypium raimondii
ref|XP_008378761.1|  PREDICTED: uncharacterized protein At1g04910     73.6    5e-12   
ref|XP_006473173.1|  PREDICTED: uncharacterized protein At1g04910...  72.8    7e-12   Citrus sinensis [apfelsine]
ref|XP_006434582.1|  hypothetical protein CICLE_v10000533mg           72.8    7e-12   Citrus clementina [clementine]
ref|XP_004505284.1|  PREDICTED: uncharacterized protein At1g04910...  73.2    8e-12   Cicer arietinum [garbanzo]
ref|XP_004238827.1|  PREDICTED: uncharacterized protein At1g04910     73.2    8e-12   Solanum lycopersicum
ref|XP_010093364.1|  hypothetical protein L484_022926                 73.2    8e-12   Morus notabilis
ref|XP_007222464.1|  hypothetical protein PRUPE_ppa003505mg           73.2    8e-12   
ref|XP_006434581.1|  hypothetical protein CICLE_v10000533mg           73.2    1e-11   
ref|XP_008389203.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    1e-11   
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...  72.8    1e-11   
ref|XP_010695805.1|  PREDICTED: uncharacterized protein At1g04910...  72.8    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007045152.1|  O-fucosyltransferase family protein              72.8    1e-11   Theobroma cacao [chocolate]
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg           72.8    1e-11   
ref|XP_006469184.1|  PREDICTED: uncharacterized protein At1g04910...  72.8    1e-11   Citrus sinensis [apfelsine]
gb|KDO64642.1|  hypothetical protein CISIN_1g008637mg                 72.8    1e-11   Citrus sinensis [apfelsine]
ref|XP_006448248.1|  hypothetical protein CICLE_v10014776mg           72.8    1e-11   Citrus clementina [clementine]
gb|EYU22809.1|  hypothetical protein MIMGU_mgv1a003510mg              72.8    1e-11   Erythranthe guttata [common monkey flower]
ref|XP_006397450.1|  hypothetical protein EUTSA_v10001813mg           72.4    1e-11   Eutrema salsugineum [saltwater cress]
emb|CBI18521.3|  unnamed protein product                              72.0    1e-11   Vitis vinifera
ref|XP_009407491.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB15425.1|  hypothetical protein B456_002G178200                  72.0    2e-11   Gossypium raimondii
ref|XP_002272758.2|  PREDICTED: uncharacterized protein At1g04910     72.0    2e-11   Vitis vinifera
ref|XP_002284457.1|  PREDICTED: uncharacterized protein At1g04910     72.0    2e-11   Vitis vinifera
gb|KJB15424.1|  hypothetical protein B456_002G178200                  72.0    2e-11   Gossypium raimondii
ref|XP_007157752.1|  hypothetical protein PHAVU_002G095600g           72.0    2e-11   Phaseolus vulgaris [French bean]
ref|XP_006355100.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   Solanum tuberosum [potatoes]
ref|XP_009785418.1|  PREDICTED: uncharacterized protein At1g04910...  72.0    2e-11   Nicotiana sylvestris
ref|XP_010461317.1|  PREDICTED: uncharacterized protein At1g04910...  71.6    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010500036.1|  PREDICTED: uncharacterized protein At1g04910...  71.6    2e-11   Camelina sativa [gold-of-pleasure]
gb|EYU30069.1|  hypothetical protein MIMGU_mgv1a003875mg              71.6    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_009420104.1|  PREDICTED: uncharacterized protein At1g04910...  71.6    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN08072.1|  DUF246 domain-containing protein                      71.2    3e-11   Glycine soja [wild soybean]
gb|KHG09805.1|  hypothetical protein F383_15167                       71.6    3e-11   Gossypium arboreum [tree cotton]
ref|XP_004297377.1|  PREDICTED: uncharacterized protein At1g04910     71.2    3e-11   Fragaria vesca subsp. vesca
gb|KFK27807.1|  hypothetical protein AALP_AA8G431600                  71.2    3e-11   Arabis alpina [alpine rockcress]
ref|XP_009379518.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    3e-11   Pyrus x bretschneideri [bai li]
gb|EPS61269.1|  hypothetical protein M569_13528                       68.2    3e-11   Genlisea aurea
ref|XP_010262622.1|  PREDICTED: uncharacterized protein At1g04910...  71.2    3e-11   Nelumbo nucifera [Indian lotus]
gb|KEH30846.1|  O-fucosyltransferase family protein                   71.2    4e-11   Medicago truncatula
ref|XP_010066619.1|  PREDICTED: uncharacterized protein At1g04910     71.2    4e-11   Eucalyptus grandis [rose gum]
ref|XP_006307153.1|  hypothetical protein CARUB_v10008744mg           71.2    4e-11   Capsella rubella
ref|XP_004150597.1|  PREDICTED: DUF246 domain-containing protein ...  70.9    4e-11   
ref|XP_003556095.1|  PREDICTED: uncharacterized protein At1g04910...  70.9    4e-11   Glycine max [soybeans]
ref|XP_006304663.1|  hypothetical protein CARUB_v10011867mg           70.9    5e-11   Capsella rubella
ref|XP_008243446.1|  PREDICTED: uncharacterized protein At1g04910     70.9    5e-11   Prunus mume [ume]
gb|KDP34835.1|  hypothetical protein JCGZ_11197                       70.9    5e-11   Jatropha curcas
ref|XP_009598681.1|  PREDICTED: uncharacterized protein At1g04910     70.1    5e-11   
ref|XP_008776785.1|  PREDICTED: uncharacterized protein At1g04910...  70.9    5e-11   
ref|XP_010553860.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    5e-11   Tarenaya hassleriana [spider flower]
ref|XP_010527785.1|  PREDICTED: uncharacterized protein At1g04910     70.5    6e-11   Tarenaya hassleriana [spider flower]
gb|KJB50369.1|  hypothetical protein B456_008G166900                  70.5    6e-11   Gossypium raimondii
ref|XP_008219032.1|  PREDICTED: uncharacterized protein At1g04910     70.5    6e-11   Prunus mume [ume]
ref|XP_010496695.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009778494.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    6e-11   Nicotiana sylvestris
ref|XP_010496702.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    6e-11   
ref|XP_009626180.1|  PREDICTED: uncharacterized protein At1g04910...  70.5    6e-11   Nicotiana tomentosiformis
ref|XP_007148603.1|  hypothetical protein PHAVU_005G000400g           70.5    6e-11   Phaseolus vulgaris [French bean]
ref|XP_006398540.1|  hypothetical protein EUTSA_v10000838mg           70.5    6e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006579000.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    7e-11   
gb|EMT10519.1|  hypothetical protein F775_32922                       67.0    7e-11   
ref|XP_007225729.1|  hypothetical protein PRUPE_ppa003622mg           70.5    7e-11   Prunus persica
gb|KHN47089.1|  DUF246 domain-containing protein                      70.5    7e-11   Glycine soja [wild soybean]
gb|KFK43757.1|  hypothetical protein AALP_AA1G168900                  70.1    7e-11   Arabis alpina [alpine rockcress]
ref|XP_009390143.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006578999.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    7e-11   Glycine max [soybeans]
ref|NP_001132122.1|  uncharacterized protein LOC100193539             68.9    8e-11   
ref|XP_002526030.1|  conserved hypothetical protein                   70.1    8e-11   Ricinus communis
emb|CDY03127.1|  BnaC06g08460D                                        70.1    8e-11   
ref|XP_010476572.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010476573.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    8e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009604992.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    8e-11   Nicotiana tomentosiformis
ref|XP_009339689.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    8e-11   Pyrus x bretschneideri [bai li]
ref|XP_010459015.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    9e-11   Camelina sativa [gold-of-pleasure]
gb|AAK93632.1|  putative growth regulator protein                     70.1    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564461.1|  O-fucosyltransferase-like protein                   70.1    9e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010246043.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    9e-11   Nelumbo nucifera [Indian lotus]
ref|XP_009782231.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    9e-11   Nicotiana sylvestris
ref|XP_010459016.1|  PREDICTED: uncharacterized protein At1g04910...  70.1    9e-11   
emb|CDY66921.1|  BnaAnng23210D                                        70.1    9e-11   Brassica napus [oilseed rape]
ref|XP_002891187.1|  hypothetical protein ARALYDRAFT_473680           70.1    9e-11   
ref|XP_009390064.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    9e-11   
ref|XP_009390063.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    9e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009114709.1|  PREDICTED: uncharacterized protein At1g04910     70.1    9e-11   Brassica rapa
ref|XP_006582446.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    9e-11   Glycine max [soybeans]
ref|XP_010327510.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    1e-10   Solanum lycopersicum
ref|XP_010478945.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    1e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010246042.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    1e-10   Nelumbo nucifera [Indian lotus]
gb|AAF79365.1|AC007887_24  F15O4.45                                   70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010246041.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_008467134.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    1e-10   Cucumis melo [Oriental melon]
ref|XP_003526401.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    1e-10   Glycine max [soybeans]
gb|AFK46212.1|  unknown                                               68.9    1e-10   Medicago truncatula
ref|XP_004498294.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    1e-10   Cicer arietinum [garbanzo]
ref|XP_010246040.1|  PREDICTED: uncharacterized protein At1g04910...  69.7    1e-10   Nelumbo nucifera [Indian lotus]
ref|XP_008339538.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    1e-10   Malus domestica [apple tree]
ref|XP_004498293.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    1e-10   
ref|XP_003598018.1|  DUF246 domain-containing protein                 69.3    2e-10   
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_006349651.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_010319880.1|  PREDICTED: uncharacterized protein At1g04910...  69.3    2e-10   
ref|XP_004237568.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_004248822.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_009351481.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_004229593.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_009351480.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|NP_178257.1|  O-fucosyltransferase family protein                 68.9    2e-10   
gb|AFW56213.1|  hypothetical protein ZEAMMB73_697257                  68.9    2e-10   
ref|XP_002875074.1|  hypothetical protein ARALYDRAFT_484066           68.9    2e-10   
ref|XP_010513871.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_004963730.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_010502128.1|  PREDICTED: uncharacterized protein At1g04910...  68.9    2e-10   
ref|XP_006290827.1|  hypothetical protein CARUB_v10016938mg           68.9    2e-10   
ref|XP_002984324.1|  hypothetical protein SELMODRAFT_268854           68.9    2e-10   
gb|KFK33363.1|  hypothetical protein AALP_AA5G004000                  68.9    2e-10   
ref|XP_008661414.1|  PREDICTED: uncharacterized protein LOC100193...  68.6    2e-10   
ref|XP_009781764.1|  PREDICTED: uncharacterized protein At1g04910     68.6    3e-10   
gb|AES59903.2|  O-fucosyltransferase family protein                   68.6    3e-10   
gb|EPS67731.1|  hypothetical protein M569_07044                       65.5    3e-10   
ref|XP_009148881.1|  PREDICTED: uncharacterized protein At1g04910     68.6    3e-10   
ref|XP_009594772.1|  PREDICTED: uncharacterized protein At1g04910     68.6    3e-10   
emb|CDY36519.1|  BnaA06g09720D                                        68.6    3e-10   
ref|XP_003589652.1|  hypothetical protein MTR_1g031590                68.6    3e-10   
ref|XP_002972493.1|  hypothetical protein SELMODRAFT_441812           68.9    3e-10   
ref|XP_004499553.1|  PREDICTED: uncharacterized protein At1g04910...  68.6    3e-10   
ref|XP_006341331.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    3e-10   
ref|XP_011038632.1|  PREDICTED: uncharacterized protein At1g04910     68.2    4e-10   
ref|XP_002315879.1|  hypothetical protein POPTR_0010s12160g           68.2    4e-10   
ref|XP_009129233.1|  PREDICTED: uncharacterized protein At1g04910...  68.2    4e-10   
emb|CDY52384.1|  BnaCnng22220D                                        68.2    4e-10   
ref|XP_009101345.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    4e-10   
ref|XP_002892842.1|  hypothetical protein ARALYDRAFT_471685           67.8    4e-10   
ref|XP_008669808.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    4e-10   
gb|KDP38063.1|  hypothetical protein JCGZ_04706                       67.8    4e-10   
emb|CDX81687.1|  BnaC08g39140D                                        67.8    5e-10   
emb|CDY65925.1|  BnaC07g48790D                                        67.8    5e-10   
ref|XP_009101344.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    5e-10   
emb|CDY33727.1|  BnaA09g45330D                                        67.8    5e-10   
ref|XP_009117860.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    5e-10   
emb|CDY28009.1|  BnaC05g44110D                                        67.4    5e-10   
ref|XP_006366494.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    5e-10   
ref|XP_008669806.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    5e-10   
gb|ACJ85641.1|  unknown                                               65.1    5e-10   
ref|XP_010922337.1|  PREDICTED: uncharacterized protein At1g04910...  67.8    6e-10   
ref|XP_008669805.1|  PREDICTED: uncharacterized protein At1g04910...  67.4    6e-10   
emb|CAN77011.1|  hypothetical protein VITISV_036881                   67.4    7e-10   
ref|XP_006416955.1|  hypothetical protein EUTSA_v10007261mg           67.4    7e-10   
ref|XP_010931259.1|  PREDICTED: uncharacterized protein At1g04910...  67.0    7e-10   
ref|XP_010931258.1|  PREDICTED: uncharacterized protein At1g04910...  67.0    8e-10   
gb|EMT33054.1|  hypothetical protein F775_09106                       67.0    8e-10   
gb|KHN43011.1|  DUF246 domain-containing protein                      66.6    9e-10   
ref|XP_011023536.1|  PREDICTED: uncharacterized protein At1g04910...  67.0    1e-09   
ref|XP_002325978.2|  hypothetical protein POPTR_0019s11020g           67.0    1e-09   
ref|XP_010543575.1|  PREDICTED: uncharacterized protein At1g04910...  67.0    1e-09   
ref|XP_002311505.2|  hypothetical protein POPTR_0008s12960g           67.0    1e-09   
ref|XP_010543593.1|  PREDICTED: uncharacterized protein At1g04910...  67.0    1e-09   
ref|XP_011003993.1|  PREDICTED: uncharacterized protein At1g04910     67.0    1e-09   
gb|EMS55867.1|  hypothetical protein TRIUR3_34733                     66.6    1e-09   
ref|XP_004235088.1|  PREDICTED: uncharacterized protein At1g04910...  66.6    1e-09   
ref|XP_009416135.1|  PREDICTED: uncharacterized protein At1g04910...  66.6    1e-09   
gb|AAL16192.1|AF428423_1  AT3g07900/F17A17_24                         65.5    1e-09   
ref|XP_003529417.1|  PREDICTED: uncharacterized protein At1g04910...  66.2    1e-09   
gb|AAF79229.1|AC006917_14  F10B6.36                                   65.9    2e-09   
gb|EMT24938.1|  hypothetical protein F775_20364                       65.5    2e-09   
emb|CDX84250.1|  BnaC04g10120D                                        62.0    2e-09   
emb|CDP00784.1|  unnamed protein product                              65.9    2e-09   
ref|XP_002987806.1|  hypothetical protein SELMODRAFT_126689           65.5    2e-09   
ref|NP_172950.1|  O-fucosyltransferase family protein                 65.9    2e-09   
gb|KDO83491.1|  hypothetical protein CISIN_1g008992mg                 65.9    2e-09   
ref|XP_008795748.1|  PREDICTED: uncharacterized protein At1g04910...  65.9    3e-09   
emb|CDY35972.1|  BnaA05g29780D                                        65.5    3e-09   
ref|XP_007133850.1|  hypothetical protein PHAVU_011G214200g           65.5    3e-09   
ref|XP_009147015.1|  PREDICTED: uncharacterized protein At1g04910     65.5    3e-09   
gb|KJB28879.1|  hypothetical protein B456_005G074200                  65.5    3e-09   
gb|KJB28877.1|  hypothetical protein B456_005G074200                  65.5    3e-09   
ref|XP_003578848.1|  PREDICTED: uncharacterized protein At1g04910...  65.5    3e-09   
ref|NP_187447.1|  O-fucosyltransferase-like protein                   65.5    3e-09   
ref|XP_006407782.1|  hypothetical protein EUTSA_v10022290mg           65.1    4e-09   
dbj|BAD81763.1|  putative auxin-independent growth promoter           64.3    4e-09   
ref|XP_008645342.1|  PREDICTED: uncharacterized protein At1g04910...  63.5    4e-09   
ref|XP_008459666.1|  PREDICTED: uncharacterized protein At1g04910     65.1    4e-09   
ref|XP_004141562.1|  PREDICTED: DUF246 domain-containing protein ...  65.1    4e-09   
ref|XP_003605027.1|  DUF246 domain-containing protein                 65.1    5e-09   
ref|XP_002533585.1|  conserved hypothetical protein                   64.7    5e-09   
ref|XP_003564587.1|  PREDICTED: uncharacterized protein At1g04910...  64.7    5e-09   
emb|CDY67173.1|  BnaUnng01980D                                        60.8    5e-09   
ref|XP_010677955.1|  PREDICTED: uncharacterized protein At1g04910     64.7    5e-09   
ref|XP_002441904.1|  hypothetical protein SORBIDRAFT_08g004650        64.7    5e-09   
ref|NP_001044765.1|  Os01g0841200                                     63.9    5e-09   
ref|XP_010093500.1|  hypothetical protein L484_001877                 64.3    6e-09   
ref|XP_011093377.1|  PREDICTED: uncharacterized protein At1g04910...  64.3    6e-09   
ref|XP_004506509.1|  PREDICTED: uncharacterized protein At1g04910...  64.7    6e-09   
gb|KHG28222.1|  hypothetical protein F383_11890                       64.3    6e-09   
ref|XP_002450409.1|  hypothetical protein SORBIDRAFT_05g004890        64.3    6e-09   
ref|XP_002882556.1|  hypothetical protein ARALYDRAFT_478129           64.3    6e-09   
gb|EEE55649.1|  hypothetical protein OsJ_04031                        63.9    6e-09   
gb|EEC71770.1|  hypothetical protein OsI_04380                        63.9    7e-09   
ref|XP_008784225.1|  PREDICTED: uncharacterized protein At1g04910...  64.3    7e-09   
ref|XP_006482836.1|  PREDICTED: uncharacterized protein At1g04910...  64.3    7e-09   
ref|XP_001764198.1|  predicted protein                                63.9    7e-09   
ref|XP_004970534.1|  PREDICTED: uncharacterized protein At1g04910...  64.3    8e-09   
ref|XP_003568305.1|  PREDICTED: uncharacterized protein At1g04910...  63.9    8e-09   
ref|XP_008674839.1|  PREDICTED: uncharacterized protein At1g04910...  63.9    8e-09   
ref|XP_006482837.1|  PREDICTED: uncharacterized protein At1g04910...  63.9    8e-09   
ref|XP_006644988.1|  PREDICTED: uncharacterized protein At1g04910...  63.5    9e-09   
ref|XP_002458744.1|  hypothetical protein SORBIDRAFT_03g039450        63.9    9e-09   
gb|AFW82218.1|  hypothetical protein ZEAMMB73_014086                  63.9    9e-09   
ref|XP_008656362.1|  PREDICTED: uncharacterized protein At1g04910...  63.9    9e-09   
ref|XP_002980115.1|  hypothetical protein SELMODRAFT_111978           63.5    1e-08   
gb|EYU31341.1|  hypothetical protein MIMGU_mgv1a006110mg              63.5    1e-08   
ref|XP_008674838.1|  PREDICTED: uncharacterized protein At1g04910...  63.9    1e-08   
ref|XP_004977274.1|  PREDICTED: uncharacterized protein At1g04910...  63.5    1e-08   
gb|EMT14891.1|  hypothetical protein F775_28466                       63.5    1e-08   
gb|KFK38242.1|  hypothetical protein AALP_AA3G087900                  63.5    1e-08   
dbj|BAJ88036.1|  predicted protein                                    63.5    1e-08   
ref|XP_002266606.1|  PREDICTED: uncharacterized protein At1g04910     63.5    1e-08   
ref|XP_011070621.1|  PREDICTED: uncharacterized protein At1g04910...  63.5    1e-08   
ref|XP_006850060.1|  hypothetical protein AMTR_s00022p00204610        63.5    1e-08   
emb|CDP07710.1|  unnamed protein product                              63.2    1e-08   
ref|XP_010930931.1|  PREDICTED: uncharacterized protein At1g04910...  63.2    1e-08   
ref|XP_010673474.1|  PREDICTED: uncharacterized protein At1g04910...  63.2    1e-08   
ref|XP_010928447.1|  PREDICTED: uncharacterized protein At1g04910...  63.2    2e-08   
ref|XP_009379852.1|  PREDICTED: uncharacterized protein At1g04910...  63.2    2e-08   
ref|XP_011087180.1|  PREDICTED: uncharacterized protein At1g04910     63.2    2e-08   
ref|XP_007020035.1|  O-fucosyltransferase family protein isoform 1    63.2    2e-08   
ref|XP_009356548.1|  PREDICTED: uncharacterized protein At1g04910...  62.8    2e-08   
ref|XP_003539654.1|  PREDICTED: uncharacterized protein At1g04910...  62.8    2e-08   
ref|XP_010534148.1|  PREDICTED: uncharacterized protein At1g04910...  60.8    2e-08   
gb|KJB78809.1|  hypothetical protein B456_013G020100                  62.4    2e-08   
ref|XP_009624336.1|  PREDICTED: uncharacterized protein At1g04910     62.4    3e-08   
dbj|BAJ97328.1|  predicted protein                                    62.4    3e-08   
ref|XP_006841300.1|  hypothetical protein AMTR_s00134p00086190        62.4    3e-08   
ref|XP_004236554.2|  PREDICTED: uncharacterized protein At1g04910     62.0    3e-08   
ref|XP_006351561.1|  PREDICTED: uncharacterized protein At1g04910...  62.4    3e-08   
ref|XP_010943561.1|  PREDICTED: uncharacterized protein At1g04910...  62.4    3e-08   
ref|XP_006342311.1|  PREDICTED: uncharacterized protein At1g04910...  62.4    3e-08   
ref|XP_006342312.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    3e-08   
ref|XP_006849667.1|  hypothetical protein AMTR_s00024p00231820        62.4    3e-08   
ref|XP_002990403.1|  hypothetical protein SELMODRAFT_131659           62.0    3e-08   
ref|XP_010543246.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    4e-08   
ref|XP_011077663.1|  PREDICTED: uncharacterized protein At1g04910...  62.0    4e-08   
gb|EEC68940.1|  hypothetical protein OsI_37646                        61.6    4e-08   
ref|XP_010930789.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  61.6    5e-08   
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...  61.6    5e-08   
gb|EYU27099.1|  hypothetical protein MIMGU_mgv1a004188mg              61.2    6e-08   
ref|XP_010067896.1|  PREDICTED: uncharacterized protein At1g04910     61.2    6e-08   
ref|XP_009365036.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    7e-08   
tpg|DAA59674.1|  TPA: hypothetical protein ZEAMMB73_298098            58.5    7e-08   
ref|XP_008649711.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    7e-08   
ref|XP_004161417.1|  PREDICTED: DUF246 domain-containing protein ...  61.2    7e-08   
gb|KGN58618.1|  hypothetical protein Csa_3G702070                     61.2    7e-08   
ref|XP_008649712.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    7e-08   
ref|XP_003534702.1|  PREDICTED: uncharacterized protein At1g04910...  61.2    7e-08   
ref|XP_008461772.1|  PREDICTED: uncharacterized protein At1g04910     61.2    8e-08   
ref|XP_004149620.1|  PREDICTED: DUF246 domain-containing protein ...  61.2    8e-08   
ref|XP_003599015.1|  Growth regulator like protein                    61.2    8e-08   
ref|NP_001066285.2|  Os12g0174100                                     60.8    8e-08   
gb|AFW78262.1|  hypothetical protein ZEAMMB73_416738                  60.8    8e-08   
gb|AES69266.2|  GDP-fucose protein O-fucosyltransferase               60.8    8e-08   
gb|EEE52851.1|  hypothetical protein OsJ_35390                        60.8    9e-08   
ref|XP_006664382.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    9e-08   
ref|XP_010464437.1|  PREDICTED: uncharacterized protein At1g04910...  60.8    9e-08   
gb|KDP24505.1|  hypothetical protein JCGZ_25069                       60.8    9e-08   
ref|XP_010486367.1|  PREDICTED: uncharacterized protein At1g04910...  60.8    1e-07   
gb|KHN26223.1|  DUF246 domain-containing protein                      60.5    1e-07   
ref|XP_003516326.1|  PREDICTED: uncharacterized protein At1g04910...  60.8    1e-07   
ref|XP_010459424.1|  PREDICTED: uncharacterized protein At1g04910...  60.8    1e-07   
ref|XP_011042011.1|  PREDICTED: uncharacterized protein At1g04910     60.5    1e-07   
ref|XP_002313473.2|  hypothetical protein POPTR_0009s02760g           60.5    1e-07   
ref|XP_001780693.1|  predicted protein                                60.1    1e-07   
ref|XP_010553068.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    1e-07   
ref|XP_002520639.1|  conserved hypothetical protein                   60.5    1e-07   
ref|XP_010265849.1|  PREDICTED: uncharacterized protein At1g04910...  60.5    1e-07   
ref|XP_010691586.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    1e-07   
ref|XP_004513144.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    1e-07   
ref|XP_010102888.1|  hypothetical protein L484_002686                 60.1    1e-07   
ref|XP_002973931.1|  hypothetical protein SELMODRAFT_100522           60.1    2e-07   
ref|XP_004513143.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    2e-07   
ref|XP_002969133.1|  hypothetical protein SELMODRAFT_90475            60.1    2e-07   
ref|XP_008350154.1|  PREDICTED: uncharacterized protein At1g04910...  60.1    2e-07   
ref|XP_008655749.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    2e-07   
ref|XP_009772998.1|  PREDICTED: uncharacterized protein At1g04910     59.7    2e-07   
ref|XP_004141177.1|  PREDICTED: DUF246 domain-containing protein ...  59.7    2e-07   
ref|XP_011007093.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    2e-07   
ref|XP_008231325.1|  PREDICTED: uncharacterized protein At1g04910...  59.7    2e-07   
ref|XP_001776351.1|  predicted protein                                59.3    2e-07   
gb|KGN60506.1|  hypothetical protein Csa_2G000150                     59.7    2e-07   
ref|XP_002298576.2|  hypothetical protein POPTR_0001s23420g           59.7    2e-07   
ref|XP_004157938.1|  PREDICTED: DUF246 domain-containing protein ...  59.7    2e-07   
gb|KDP43418.1|  hypothetical protein JCGZ_16705                       59.3    2e-07   
ref|XP_010547235.1|  PREDICTED: uncharacterized protein At1g04910     59.3    2e-07   
ref|XP_004156659.1|  PREDICTED: DUF246 domain-containing protein ...  59.7    2e-07   
ref|XP_008242314.1|  PREDICTED: uncharacterized protein At1g04910     59.3    3e-07   
ref|XP_010257422.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    3e-07   
ref|XP_010318378.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    3e-07   
ref|XP_008349183.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    3e-07   
ref|XP_010932414.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    3e-07   
ref|XP_004137916.1|  PREDICTED: DUF246 domain-containing protein ...  59.3    3e-07   
ref|XP_008383543.1|  PREDICTED: uncharacterized protein At1g04910...  58.5    3e-07   
gb|KGN58804.1|  hypothetical protein Csa_3G732610                     59.3    3e-07   
ref|XP_008375138.1|  PREDICTED: uncharacterized protein At1g04910...  59.3    3e-07   
ref|XP_007012658.1|  O-fucosyltransferase family protein isoform 3    59.3    3e-07   
ref|XP_007012656.1|  O-fucosyltransferase family protein isoform 1    59.3    3e-07   
emb|CAN67382.1|  hypothetical protein VITISV_017920                   58.9    3e-07   
ref|XP_010680324.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    4e-07   
ref|XP_010680244.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    4e-07   
ref|XP_010544540.1|  PREDICTED: uncharacterized protein At1g04910     58.9    4e-07   
ref|XP_004308914.1|  PREDICTED: uncharacterized protein At1g04910...  58.9    4e-07   
gb|EEC67779.1|  hypothetical protein OsI_35317                        58.9    4e-07   
ref|XP_010090143.1|  hypothetical protein L484_027375                 58.9    4e-07   
ref|XP_007052598.1|  O-fucosyltransferase family protein              58.9    4e-07   
gb|AFW80351.1|  hypothetical protein ZEAMMB73_842533                  58.5    4e-07   
ref|XP_008786733.1|  PREDICTED: uncharacterized protein At1g04910     58.9    4e-07   
ref|XP_011090093.1|  PREDICTED: uncharacterized protein At1g04910     58.9    4e-07   
gb|EEE51747.1|  hypothetical protein OsJ_33163                        58.5    4e-07   
ref|XP_007204604.1|  hypothetical protein PRUPE_ppa002708mg           58.9    4e-07   
gb|KDO80742.1|  hypothetical protein CISIN_1g047008mg                 57.4    4e-07   



>ref|XP_006353173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=505

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VIEG
Sbjct  417  VGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEG  476

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  477  HQNRQGQIRLRKPKQSLYTYPAPDCMCQA  505



>ref|XP_006353172.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=506

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VIEG
Sbjct  418  VGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEG  477

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  478  HQNRQGQIRLRKPKQSLYTYPAPDCMCQA  506



>ref|XP_009797993.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797994.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
Length=504

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++V+EG
Sbjct  416  VGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVVEG  475

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  476  HKNRQGQIRLRKPKQSLYTYPAPDCMCQA  504



>ref|XP_009797995.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana sylvestris]
Length=503

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++V+EG
Sbjct  415  VGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVVEG  474

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  475  HKNRQGQIRLRKPKQSLYTYPAPDCMCQA  503



>gb|AAK84479.1| putative auxin growth promotor protein [Solanum lycopersicum]
Length=478

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VIEG
Sbjct  390  VGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEG  449

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  450  HQNRQGQIRLRKPKQSLYTYPAPDCMCQA  478



>ref|XP_011097478.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=516

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY N KTIRP+M LLGQLFLNKNLTWPEFQDAV+EG
Sbjct  428  VSMHSDIFISASPGNMHNAVVGHRTYENKKTIRPSMTLLGQLFLNKNLTWPEFQDAVVEG  487

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMCNA
Sbjct  488  HKNRQGQLRLRKPQQSIYTYPAPDCMCNA  516



>ref|XP_010312649.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Solanum 
lycopersicum]
Length=470

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VIEG
Sbjct  382  VGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEG  441

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  442  HQNRQGQIRLRKPKQSLYTYPAPDCMCQA  470



>ref|XP_010312648.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=505

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VIEG
Sbjct  417  VGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEG  476

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  477  HQNRQGQIRLRKPKQSLYTYPAPDCMCQA  505



>ref|XP_010312647.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=506

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VIEG
Sbjct  418  VGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEG  477

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  478  HQNRQGQIRLRKPKQSLYTYPAPDCMCQA  506



>gb|KDP29763.1| hypothetical protein JCGZ_18698 [Jatropha curcas]
Length=509

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNKN++W +FQ AV+EG
Sbjct  421  VGLHSDIFISASPGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKNISWSDFQQAVLEG  480

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQGEIRLRKP KS+YTYPAPDCMC A
Sbjct  481  HENRQGEIRLRKPKKSIYTYPAPDCMCQA  509



>gb|KJB18177.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=367

 Score =   166 bits (419),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ AV+EG
Sbjct  279  VGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVVEG  338

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  339  HQNRQGQLRLRKPKQSIYTYPAPDCMCQA  367



>gb|KJB18178.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=401

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ AV+EG
Sbjct  313  VGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVVEG  372

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  373  HQNRQGQLRLRKPKQSIYTYPAPDCMCQA  401



>ref|XP_003534239.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN38876.1| DUF246 domain-containing protein [Glycine soja]
Length=515

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQDAV+EG
Sbjct  427  VGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVVEG  486

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQGE+RLRKP +S+YTYPAPDCMC A
Sbjct  487  HQNRQGELRLRKPKQSIYTYPAPDCMCQA  515



>ref|XP_006587571.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=516

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQDAV+EG
Sbjct  428  VGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVVEG  487

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQGE+RLRKP +S+YTYPAPDCMC A
Sbjct  488  HQNRQGELRLRKPKQSIYTYPAPDCMCQA  516



>gb|KCW54611.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=484

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA+VGHRTY N+KTIRP+M LLGQLFLNKN++W EFQ+A+IEG
Sbjct  396  ISMHSDIFISASPGNMHNALVGHRTYENMKTIRPSMALLGQLFLNKNISWSEFQEAIIEG  455

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC+A
Sbjct  456  HKNRQGQIRLRKPKQSLYTYPAPDCMCSA  484



>gb|KCW54609.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=506

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA+VGHRTY N+KTIRP+M LLGQLFLNKN++W EFQ+A+IEG
Sbjct  418  ISMHSDIFISASPGNMHNALVGHRTYENMKTIRPSMALLGQLFLNKNISWSEFQEAIIEG  477

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC+A
Sbjct  478  HKNRQGQIRLRKPKQSLYTYPAPDCMCSA  506



>ref|XP_010027954.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW54610.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=505

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA+VGHRTY N+KTIRP+M LLGQLFLNKN++W EFQ+A+IEG
Sbjct  417  ISMHSDIFISASPGNMHNALVGHRTYENMKTIRPSMALLGQLFLNKNISWSEFQEAIIEG  476

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC+A
Sbjct  477  HKNRQGQIRLRKPKQSLYTYPAPDCMCSA  505



>ref|XP_009623753.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana tomentosiformis]
Length=504

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNAMVGHRTY+N+K IRPNM LLGQLFLNK L WPEFQ++V+EG
Sbjct  416  VGMHSDIFVSASPGNMHNAMVGHRTYNNMKIIRPNMALLGQLFLNKTLNWPEFQESVVEG  475

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +SLYTYPAPDCMC A
Sbjct  476  HKNRQGQIRLRKAKQSLYTYPAPDCMCQA  504



>ref|XP_009623754.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana tomentosiformis]
Length=503

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNAMVGHRTY+N+K IRPNM LLGQLFLNK L WPEFQ++V+EG
Sbjct  415  VGMHSDIFVSASPGNMHNAMVGHRTYNNMKIIRPNMALLGQLFLNKTLNWPEFQESVVEG  474

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +SLYTYPAPDCMC A
Sbjct  475  HKNRQGQIRLRKAKQSLYTYPAPDCMCQA  503



>ref|XP_009783617.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=512

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNAMVGHRTY+NLKTIRP M LLGQLFLNK L+WPEF++AV+EG
Sbjct  424  VSMHSDIFISASPGNMHNAMVGHRTYYNLKTIRPKMALLGQLFLNKTLSWPEFKEAVVEG  483

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR+G+IRLRKP +SLYTYPAPDCMC  
Sbjct  484  HKNRKGQIRLRKPNQSLYTYPAPDCMCQG  512



>emb|CDP01562.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIF+SASPGNMHNAMVGHRTY N+KTIRPNM LLG LFLNKNLTWPEFQ+A+IEG
Sbjct  426  VSMHSDIFVSASPGNMHNAMVGHRTYINMKTIRPNMALLGPLFLNKNLTWPEFQEAIIEG  485

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG IRLRK  +SLYTYPAPDCMC A
Sbjct  486  HKNRQGIIRLRKKEQSLYTYPAPDCMCQA  514



>gb|KHN14510.1| DUF246 domain-containing protein [Glycine soja]
Length=516

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQDAV+EG
Sbjct  428  VGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVVEG  487

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQGE RLRKP +S+YTYPAPDCMC A
Sbjct  488  HQNRQGEPRLRKPKQSIYTYPAPDCMCQA  516



>ref|XP_003517397.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=516

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQDAV+EG
Sbjct  428  VGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVVEG  487

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQGE RLRKP +S+YTYPAPDCMC A
Sbjct  488  HQNRQGEPRLRKPKQSIYTYPAPDCMCQA  516



>ref|XP_006573005.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=515

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQDAV+EG
Sbjct  427  VGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVVEG  486

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQGE RLRKP +S+YTYPAPDCMC A
Sbjct  487  HQNRQGEPRLRKPKQSIYTYPAPDCMCQA  515



>gb|KJB18182.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=519

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ AV+EG
Sbjct  431  VGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVVEG  490

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  491  HQNRQGQLRLRKPKQSIYTYPAPDCMCQA  519



>ref|XP_002268599.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI38269.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK++ W EFQ AV+EG
Sbjct  422  VSMHSDIFISASPGNMHNALVGHRTYENLKTIRPNMALLGQLFLNKSIGWSEFQQAVVEG  481

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +SLYTYPAPDCMCNA
Sbjct  482  HENRQGQIRLRKSEQSLYTYPAPDCMCNA  510



>gb|KJB18179.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18180.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18183.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18184.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=518

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ AV+EG
Sbjct  430  VGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVVEG  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  490  HQNRQGQLRLRKPKQSIYTYPAPDCMCQA  518



>gb|KJB44061.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=401

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F+ AV+EG
Sbjct  313  VGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQAVVEG  372

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC+A
Sbjct  373  HQNRQGQLRLRKPKQSIYTYPAPDCMCHA  401



>ref|XP_002310868.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
 gb|ABK95421.1| unknown [Populus trichocarpa]
 gb|EEE91318.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
Length=506

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIF+SASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK ++W +FQ AV+EG
Sbjct  418  VGLHSDIFVSASPGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKTISWTDFQQAVVEG  477

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  478  HENRQGQIRLRKPKQSIYTYPAPDCMCYA  506



>ref|XP_007158370.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
 gb|ESW30364.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
Length=514

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF DAV+EG
Sbjct  426  VGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFHDAVVEG  485

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  486  HQNRQGQVRLRKPKQSIYTYPAPDCMCQA  514



>ref|XP_011021848.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=506

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIF+SASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK ++W +FQ AV+EG
Sbjct  418  VGLHSDIFVSASPGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKTISWTDFQQAVVEG  477

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  478  HENRQGQIRLRKPKQSIYTYPAPDCMCYA  506



>ref|XP_007207425.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08624.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=474

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ +V+EG
Sbjct  386  VSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQSVVEG  445

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  446  HQNRQGQIRLRKPKQSIYTYPAPDCMCQA  474



>ref|XP_007207426.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08625.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=485

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ +V+EG
Sbjct  397  VSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQSVVEG  456

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  457  HQNRQGQIRLRKPKQSIYTYPAPDCMCQA  485



>gb|AGV54211.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=511

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF DAV+EG
Sbjct  423  VGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFHDAVVEG  482

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  483  HQNRQGQVRLRKPKQSIYTYPAPDCMCQA  511



>ref|XP_011099984.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Sesamum indicum]
Length=517

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK+LTW EFQ+AV++G
Sbjct  429  VSMHSDIFISASPGNMHNAVVGHRTYENLKTIRPNMALLGQLFLNKSLTWLEFQEAVVKG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG +RLRKP +S+YTYPAPDCMC+A
Sbjct  489  HKSRQGLLRLRKPEQSIYTYPAPDCMCSA  517



>ref|XP_011099981.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099982.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099983.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
Length=518

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK+LTW EFQ+AV++G
Sbjct  430  VSMHSDIFISASPGNMHNAVVGHRTYENLKTIRPNMALLGQLFLNKSLTWLEFQEAVVKG  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG +RLRKP +S+YTYPAPDCMC+A
Sbjct  490  HKSRQGLLRLRKPEQSIYTYPAPDCMCSA  518



>ref|XP_009350347.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=513

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V++G
Sbjct  425  VSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQSVVKG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IR+RKP KS+YTYPAPDCMC A
Sbjct  485  HESRQGQIRIRKPKKSIYTYPAPDCMCEA  513



>ref|XP_009350346.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=524

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V++G
Sbjct  436  VSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQSVVKG  495

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IR+RKP KS+YTYPAPDCMC A
Sbjct  496  HESRQGQIRIRKPKKSIYTYPAPDCMCEA  524



>gb|KJB44059.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=518

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F+ AV+EG
Sbjct  430  VGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQAVVEG  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC+A
Sbjct  490  HQNRQGQLRLRKPKQSIYTYPAPDCMCHA  518



>ref|XP_009364252.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Pyrus 
x bretschneideri]
Length=513

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V++G
Sbjct  425  VSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMPLLGQLFLNKTLSWSEFQQSVVKG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IR+RKP +S+YTYPAPDCMC A
Sbjct  485  HENRQGQIRIRKPKQSIYTYPAPDCMCQA  513



>ref|XP_009364251.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Pyrus 
x bretschneideri]
Length=524

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V++G
Sbjct  436  VSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMPLLGQLFLNKTLSWSEFQQSVVKG  495

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IR+RKP +S+YTYPAPDCMC A
Sbjct  496  HENRQGQIRIRKPKQSIYTYPAPDCMCQA  524



>gb|KHG27420.1| hypothetical protein F383_15612 [Gossypium arboreum]
Length=498

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F+ A++EG
Sbjct  410  VGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQAMVEG  469

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC+A
Sbjct  470  HQNRQGQLRLRKPKQSIYTYPAPDCMCHA  498



>ref|XP_004288516.2| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK++TW +FQ +V+EG
Sbjct  441  VSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMGLLGQLFLNKSITWSDFQQSVVEG  500

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IR RKP +S+YTYPAPDCMC A
Sbjct  501  HENRQGQIRFRKPKQSIYTYPAPDCMCQA  529



>ref|XP_008440542.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=513

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNAMVGHRTY NLKTIRPNM LLGQLF+NK++ W +FQ A +EG
Sbjct  425  VSMHSDIFISASPGNMHNAMVGHRTYENLKTIRPNMALLGQLFMNKSIIWSDFQQATVEG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +S+YTYPAPDC+C+A
Sbjct  485  HKNRQGQIRLRKPKQSIYTYPAPDCVCHA  513



>ref|XP_002533683.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28699.1| conserved hypothetical protein [Ricinus communis]
Length=509

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIF+SAS GNMHNA+VGHRTY NLKTIRPNM LLGQLFLNKN++W EFQ +V+EG
Sbjct  421  VAMHSDIFLSASRGNMHNALVGHRTYENLKTIRPNMPLLGQLFLNKNISWSEFQQSVLEG  480

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQGEIR+R+P +SLYTYPAPDCMC A
Sbjct  481  HEDRQGEIRVRRPKQSLYTYPAPDCMCQA  509



>ref|XP_008385667.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Malus domestica]
Length=524

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V++G
Sbjct  436  VSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMPLLGQLFLNKTLSWSEFQQSVVKG  495

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IR+RKP +S+YTYPAPDCMC A
Sbjct  496  HENRQGQIRIRKPKQSIYTYPAPDCMCQA  524



>gb|KHG05570.1| hypothetical protein F383_31127 [Gossypium arboreum]
Length=518

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFL+KN+TW EF+ AV EG
Sbjct  430  VGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMALLGQLFLDKNITWLEFRQAVAEG  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+++LRKP +S+YTYPAPDCMC A
Sbjct  490  HQNRQGQLKLRKPKQSIYTYPAPDCMCRA  518



>dbj|BAE71212.1| hypothetical protein [Trifolium pratense]
Length=404

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA+VGHR+Y NLKTIRPNMQL+GQLFLNK + W EF+ AV+EG
Sbjct  316  ISMHSDIFISASPGNMHNALVGHRSYLNLKTIRPNMQLMGQLFLNKTMEWSEFEHAVVEG  375

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  RQG++RLRKP +S+YTYPAPDCMC A
Sbjct  376  HETRQGQLRLRKPKQSIYTYPAPDCMCQA  404



>gb|KDO60569.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=473

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHS+IFISASPGNMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EFQ AV+EG
Sbjct  385  VSMHSNIFISASPGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQAVVEG  444

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IR+RKP +S+YTYPAPDCMC
Sbjct  445  HENRQGQIRIRKPKQSIYTYPAPDCMC  471



>ref|XP_008347790.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Malus domestica]
Length=513

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V++G
Sbjct  425  VSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQSVVKG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H NRQG+IR+RKP +S+YTYPAPDCMC 
Sbjct  485  HENRQGQIRIRKPKQSIYTYPAPDCMCE  512



>ref|XP_008236140.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Prunus 
mume]
Length=518

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ +V+EG
Sbjct  430  VSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQSVVEG  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR G+IRLRKP +S+YTYPAPDCMC A
Sbjct  490  HQNRHGQIRLRKPKQSIYTYPAPDCMCQA  518



>ref|XP_008347789.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Malus domestica]
Length=524

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V++G
Sbjct  436  VSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQSVVKG  495

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H NRQG+IR+RKP +S+YTYPAPDCMC 
Sbjct  496  HENRQGQIRIRKPKQSIYTYPAPDCMCE  523



>ref|XP_008236135.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Prunus 
mume]
Length=529

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ +V+EG
Sbjct  441  VSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQSVVEG  500

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR G+IRLRKP +S+YTYPAPDCMC A
Sbjct  501  HQNRHGQIRLRKPKQSIYTYPAPDCMCQA  529



>ref|XP_010523310.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Tarenaya hassleriana]
Length=445

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EFQ  V EG
Sbjct  357  VSMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQKVGEG  416

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  417  HVNRQGQIRLRKPKQSLYTYPAPDCMCHV  445



>gb|AFK40388.1| unknown [Lotus japonicus]
Length=502

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPN+ L+GQLFLNK + W EF+ AV+EG
Sbjct  414  VGLHSDIFISASPGNMHNAVVGHRTYLNLKTIRPNLVLMGQLFLNKTMEWSEFEHAVVEG  473

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  474  HQNRQGQLRLRKPKQSIYTYPAPDCMCQA  502



>ref|XP_007047791.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOX91948.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=518

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGMHSDIF+SASPGNMHNA++GHRT+ NLKTI+PNM LLGQLFLNK+++W EF+ AV+EG
Sbjct  430  VGMHSDIFVSASPGNMHNALMGHRTFENLKTIKPNMALLGQLFLNKSISWSEFRQAVVEG  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+++LRKP +S+YTYPAPDCMC A
Sbjct  490  HQNRQGQLKLRKPKQSIYTYPAPDCMCQA  518



>ref|XP_006426272.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|ESR39512.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|KDO60568.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=539

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHS+IFISASPGNMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EFQ AV+EG
Sbjct  451  VSMHSNIFISASPGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQAVVEG  510

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IR+RKP +S+YTYPAPDCMC
Sbjct  511  HENRQGQIRIRKPKQSIYTYPAPDCMC  537



>ref|XP_006466306.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=539

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHS+IFISASPGNMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EFQ AV+EG
Sbjct  451  VSMHSNIFISASPGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQAVVEG  510

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IR+RKP +S+YTYPAPDCMC
Sbjct  511  HENRQGQIRIRKPKQSIYTYPAPDCMC  537



>ref|XP_006280335.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
 gb|EOA13233.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
Length=508

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  420  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWADFQQALGEG  479

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  480  HVNRQGQIRLRKPKQSIYTYPAPDCMC  506



>ref|XP_004509777.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=501

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF+ AV+EG
Sbjct  413  ISVHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTMEWSEFEHAVVEG  472

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  473  HENRQGQLRLRKPKQSIYTYPAPDCMCQA  501



>ref|XP_010113429.1| hypothetical protein L484_026763 [Morus notabilis]
 gb|EXC35456.1| hypothetical protein L484_026763 [Morus notabilis]
Length=553

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNAMVGHRTY+NLKTIRPNM L+GQLFLNK+++W +FQ +V+EG
Sbjct  465  VSMHSDIFISASPGNMHNAMVGHRTYNNLKTIRPNMALMGQLFLNKSISWSDFQQSVMEG  524

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IRLR P +S+YTYP+PDCMC A
Sbjct  525  HQSRQGQIRLRNPKQSIYTYPSPDCMCEA  553



>ref|XP_010523312.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=517

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EFQ  V EG
Sbjct  429  VSMHSDIFISASPGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQKVGEG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  489  HVNRQGQIRLRKPKQSLYTYPAPDCMCHV  517



>ref|XP_010444520.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=507

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  419  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  478

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  479  HVNRQGQIRLRKPKQSIYTYPAPDCMC  505



>ref|XP_006394028.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31314.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=507

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  419  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  478

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  479  HVNRQGQIRLRKPKQSIYTYPAPDCMC  505



>ref|XP_006394027.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31313.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=506

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  418  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  477

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  478  HVNRQGQIRLRKPKQSIYTYPAPDCMC  504



>ref|XP_003613050.1| DUF246 domain-containing protein [Medicago truncatula]
Length=282

 Score =   154 bits (388),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF+ AV+EG
Sbjct  194  ISIHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTMEWSEFEHAVVEG  253

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG++RLRKP +S+YTYP PDCMC  
Sbjct  254  HESRQGQLRLRKPKQSIYTYPVPDCMCQG  282



>ref|XP_010484355.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  420  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  479

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  480  HVNRQGQIRLRKPKQSIYTYPAPDCMC  506



>ref|XP_002864958.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41217.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  416  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  475

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  476  HVNRQGQIRLRKPKQSIYTYPAPDCMC  502



>ref|XP_010463027.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  420  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  479

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  480  HVNRQGQIRLRKPKQSIYTYPAPDCMC  506



>gb|EYU39303.1| hypothetical protein MIMGU_mgv1a004838mg [Erythranthe guttata]
Length=507

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY N+KTIRPNM LLGQLFLNK+L W EF++AV++G
Sbjct  418  VSMHSDIFISASPGNMHNAVVGHRTYENMKTIRPNMGLLGQLFLNKSLIWTEFEEAVMQG  477

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H +RQG++RLRKP +S+YTYPAPDCMC+
Sbjct  478  HKSRQGQLRLRKPRQSIYTYPAPDCMCS  505



>ref|XP_009150636.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 emb|CDY08790.1| BnaA06g24340D [Brassica napus]
Length=503

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  415  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  474

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  475  HVNRQGQIRLRKPKQSIYTYPAPDCMC  501



>dbj|BAB11569.1| unnamed protein product [Arabidopsis thaliana]
Length=523

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  435  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  494

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  495  HVNRQGQIRLRKPKQSIYTYPAPDCMCHV  523



>ref|XP_009130514.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
Length=505

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  417  VSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQAIGEG  476

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  477  HVNRQGQIRLRKPKQSIYTYPAPDCMC  503



>ref|XP_009130513.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=506

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  418  VSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQAIGEG  477

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  478  HVNRQGQIRLRKPKQSIYTYPAPDCMC  504



>emb|CDY14569.1| BnaC03g48900D [Brassica napus]
Length=503

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  415  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  474

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  475  HVNRQGQIRLRKPKQSIYTYPAPDCMC  501



>emb|CDY37829.1| BnaAnng04900D [Brassica napus]
Length=505

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  417  VSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQAIGEG  476

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  477  HVNRQGQIRLRKPKQSIYTYPAPDCMC  503



>gb|AAM13166.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91219.1| unknown protein [Arabidopsis thaliana]
Length=504

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  416  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  475

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  476  HVNRQGQIRLRKPKQSIYTYPAPDCMC  502



>ref|NP_201350.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAE99053.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED98060.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  416  VSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  475

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRKP +S+YTYPAPDCMC
Sbjct  476  HVNRQGQIRLRKPKQSIYTYPAPDCMC  502



>ref|XP_010523308.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010523309.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
Length=517

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EFQ  V EG
Sbjct  429  VSMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQKVGEG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  489  HVNRQGQIRLRKPKQSLYTYPAPDCMCHV  517



>emb|CDY33958.1| BnaC02g43790D [Brassica napus]
Length=505

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ EG
Sbjct  417  VSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALGEG  476

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  477  HVNRQGQIRLRKPKQSIYTYPAPDCMCHV  505



>ref|XP_004143441.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004160919.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN48703.1| hypothetical protein Csa_6G498990 [Cucumis sativus]
Length=513

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M+SDIFISASPGNMHNAMVGHRTY NLKTIRPNM LLGQLF+NK++ W +F  A +EG
Sbjct  425  VSMYSDIFISASPGNMHNAMVGHRTYENLKTIRPNMALLGQLFMNKSIIWSDFHQATVEG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +S+YTYPAPDC+C+A
Sbjct  485  HKNRQGQIRLRKPKQSIYTYPAPDCVCHA  513



>ref|XP_010547595.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=513

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ N+KT+RPNM L+ QLFL KN+TW EFQ AV EG
Sbjct  425  VSMHSDIFISASPGNMHNALVGHRTFENMKTVRPNMALIEQLFLRKNITWMEFQQAVGEG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  485  HVNRQGQIRLRKPKQSLYTYPAPDCMCHV  513



>gb|EYU30935.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=522

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V +HSDIF+SASPGNMHNA+VGHRTY N KTIRPNM LLGQLFLNK+L W EF+ AV+EG
Sbjct  433  VSIHSDIFVSASPGNMHNAVVGHRTYRNTKTIRPNMALLGQLFLNKSLDWAEFEKAVVEG  492

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG +RLRK  +S+YTYPAPDCMCNA
Sbjct  493  HKSRQGMLRLRKSEQSIYTYPAPDCMCNA  521



>gb|EYU30936.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
 gb|EYU30937.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=511

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V +HSDIF+SASPGNMHNA+VGHRTY N KTIRPNM LLGQLFLNK+L W EF+ AV+EG
Sbjct  422  VSIHSDIFVSASPGNMHNAVVGHRTYRNTKTIRPNMALLGQLFLNKSLDWAEFEKAVVEG  481

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG +RLRK  +S+YTYPAPDCMCNA
Sbjct  482  HKSRQGMLRLRKSEQSIYTYPAPDCMCNA  510



>ref|XP_010519195.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=518

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ N KTIRPNM L+GQLFLNKN+TW EFQ AV EG
Sbjct  430  VSMHSDIFISASPGNMHNALVGHRTFENRKTIRPNMALIGQLFLNKNITWTEFQQAVGEG  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NR G+IRLRK  +SLYTYPAPDCMC
Sbjct  490  HVNRHGQIRLRKTKQSLYTYPAPDCMC  516



>ref|XP_010107675.1| hypothetical protein L484_007693 [Morus notabilis]
 gb|EXC16648.1| hypothetical protein L484_007693 [Morus notabilis]
Length=529

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHR   N+KTIRPNM LLGQLFLNK + WPEFQ AV++G
Sbjct  441  VSMHSDIFISASPGNMHNALVGHRALLNMKTIRPNMGLLGQLFLNKTMEWPEFQQAVVDG  500

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +S+YTYPAPDCMC+A
Sbjct  501  HKNRQGQIRLRKEKQSIYTYPAPDCMCSA  529



>ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=522

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W +FQ AV+EG
Sbjct  425  VSMHSDIFISASPGNMHNALVGHRAYQNLKTIRPNMALLGQLFLNKSMGWSDFQRAVLEG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IRL+K  +S+YTYPAPDCMC A
Sbjct  485  HKDRQGQIRLKKEKQSIYTYPAPDCMCRA  513



>ref|XP_010277497.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=514

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQL LNK++ W +FQ AV+EG
Sbjct  426  VSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMALLGQLLLNKSIEWSKFQQAVLEG  485

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H NRQG+IRLRK  +S+YTYPAPDCMC+
Sbjct  486  HKNRQGQIRLRKEKQSIYTYPAPDCMCH  513



>ref|XP_003613049.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES96007.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=503

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF+ AV+EG
Sbjct  415  ISIHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTMEWSEFEHAVVEG  474

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H +RQG++RLRKP +S+YTYP PDCMC
Sbjct  475  HESRQGQLRLRKPKQSIYTYPVPDCMC  501



>tpg|DAA61413.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=118

 Score =   144 bits (363),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEFQ  V  G
Sbjct  30   ISMHSDIFISASPGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQVVQAG  89

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H  R G+IRLRK  +S+YTYPAPDCMC
Sbjct  90   HKGRYGQIRLRKATQSIYTYPAPDCMC  116



>ref|XP_010680342.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=506

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHRT+ +LKTIRPNM LLGQLFL+KN++W +F+ AV+EG
Sbjct  418  VSMHSDIFISASPGNMHNALVGHRTFESLKTIRPNMGLLGQLFLDKNMSWVDFRQAVVEG  477

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  R G++RLRKP +S+YTYPAPDCMC A
Sbjct  478  HHYRHGQLRLRKPKQSIYTYPAPDCMCRA  506



>ref|XP_010692399.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=503

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNAM+GHR Y NLKTIRPNM LLGQLFLN+++ WP FQ+AV+ G
Sbjct  415  VSMHSDIFISASPGNMHNAMLGHRAYQNLKTIRPNMALLGQLFLNQSIDWPGFQNAVVVG  474

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IR+RK  +S+YTYP PDCMC
Sbjct  475  HKNRQGQIRVRKEKQSIYTYPVPDCMC  501



>gb|EPS72903.1| hypothetical protein M569_01846, partial [Genlisea aurea]
Length=497

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+VGHRT  N KTIRPNM LLGQLFLNK+LTW EF+D+V  G
Sbjct  410  VSMQSDIFISASPGNMHNALVGHRTLENKKTIRPNMPLLGQLFLNKSLTWSEFRDSVFVG  469

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H +RQG++R RKP +SLYTYPAPDCMC+
Sbjct  470  HKSRQGQLRFRKPQQSLYTYPAPDCMCS  497



>ref|XP_009401410.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401411.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=518

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA++G+RTY NLKTIRPNM LLGQLFLNK + W EFQ AV  G
Sbjct  430  VSMHSDIFISASPGNMHNAVLGYRTYENLKTIRPNMGLLGQLFLNKTMDWSEFQRAVQAG  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  RQG+IRLRKP +S+YTYPAPDCMC  
Sbjct  490  HKARQGQIRLRKPKQSIYTYPAPDCMCQG  518



>emb|CDP11502.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            VGM SDIF+SASPGNMHNA+VGHRTY+NLKTIRPNM LLG+LFLNK L W +FQ AV  G
Sbjct  427  VGMQSDIFVSASPGNMHNALVGHRTYNNLKTIRPNMVLLGKLFLNKTLEWSDFQQAVKNG  486

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRK  +S+YTYP PDCMC A
Sbjct  487  HKNRQGQLRLRKEKQSIYTYPIPDCMCQA  515



>ref|XP_003602912.1| PsRT17-1 like protein [Medicago truncatula]
 gb|AES73163.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=517

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+V HR Y NLKTIRPNM LLGQLF NK++ W +FQ AV++G
Sbjct  429  VSMHSDIFISASPGNMHNALVAHRAYKNLKTIRPNMALLGQLFQNKSIGWSDFQRAVLDG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  489  HKNRQGQIRLRKEKQSIYTYPAPDCMCRA  517



>ref|XP_004501643.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=513

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V +HSDIFISASPGNMHNA+V HR Y NLKTIRPNM LLGQLF NK++ W EFQ  V++G
Sbjct  425  VSLHSDIFISASPGNMHNALVAHRAYRNLKTIRPNMALLGQLFQNKSIGWSEFQRTVLDG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  485  HKNRQGQIRLRKEKQSIYTYPAPDCMCKA  513



>ref|XP_008444924.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=515

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V +HSD+FISASPGNMHNA+VGHR Y N+KTIRPNM LLGQLFLNK++ W EF+ AV+ G
Sbjct  426  VSLHSDVFISASPGNMHNALVGHRAYLNMKTIRPNMVLLGQLFLNKSMEWSEFKKAVLTG  485

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRK  +S+YTYPAPDCMC
Sbjct  486  HRNRQGQIRLRKEKQSIYTYPAPDCMC  512



>ref|XP_009785662.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=516

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EFQ AV +G
Sbjct  428  VSMQSDIFISASPGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMEWSEFQRAVQQG  487

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  488  HKNRQGQMRLRKEKQSIYTYPAPDCMCKA  516



>ref|XP_006338062.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=516

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EFQ AV +G
Sbjct  428  VSMQSDIFISASPGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMQWSEFQQAVQQG  487

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++R+RK  +S+YTYPAPDCMC A
Sbjct  488  HKNRQGQMRIRKEKQSIYTYPAPDCMCKA  516



>emb|CAN78778.1| hypothetical protein VITISV_029752 [Vitis vinifera]
Length=507

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W EFQ AV+ G
Sbjct  419  VSMHSDIFISASPGNMHNALVGHRAYKNLKTIRPNMALLGQLFLNKSIEWSEFQQAVLNG  478

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IR RK  +S+YTYP  DCMC A
Sbjct  479  HKSRQGQIRFRKENQSIYTYPITDCMCQA  507



>ref|XP_002283844.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Vitis 
vinifera]
 emb|CBI19265.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W EFQ AV+ G
Sbjct  427  VSMHSDIFISASPGNMHNALVGHRAYKNLKTIRPNMALLGQLFLNKSIEWSEFQQAVLNG  486

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IR RK  +S+YTYP  DCMC A
Sbjct  487  HKSRQGQIRFRKENQSIYTYPITDCMCQA  515



>gb|KCW68511.1| hypothetical protein EUGRSUZ_F02148 [Eucalyptus grandis]
Length=491

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SD+FISASPGNMHNA++GHR + NLKTIRPNM LLGQLFLNK++ W +FQ AVIEG
Sbjct  403  VSMQSDVFISASPGNMHNAVLGHRAFLNLKTIRPNMALLGQLFLNKSMEWSDFQHAVIEG  462

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  RQG IRLRK  +S+YTYPAPDCMC A
Sbjct  463  HIKRQGHIRLRKEKQSIYTYPAPDCMCQA  491



>ref|XP_004237994.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=516

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++GHR Y NLKT+RPNM LLG+LFLNK + W EFQ AV +G
Sbjct  428  VSMQSDIFISASPGNMHNALLGHRAYKNLKTVRPNMTLLGKLFLNKTIEWSEFQQAVQQG  487

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++R+RK  +S+YTYPAPDCMC A
Sbjct  488  HKNRQGQMRIRKEKQSIYTYPAPDCMCKA  516



>ref|XP_006852943.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
 gb|ERN14410.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
Length=446

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V +HSD+FISASPGNMHNAMVGHRTY NLKTIRPNM LLGQL+LNK++ W +FQ AV +G
Sbjct  357  VSLHSDVFISASPGNMHNAMVGHRTYLNLKTIRPNMGLLGQLYLNKSMGWSDFQAAVRKG  416

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  RQG++RLRK  +S+YTYPAPDCMC +
Sbjct  417  HEQRQGKMRLRKAKQSIYTYPAPDCMCGS  445



>ref|XP_010061545.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Eucalyptus grandis]
Length=517

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SD+FISASPGNMHNA++GHR + NLKTIRPNM LLGQLFLNK++ W +FQ AVIEG
Sbjct  429  VSMQSDVFISASPGNMHNAVLGHRAFLNLKTIRPNMALLGQLFLNKSMEWSDFQHAVIEG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  RQG IRLRK  +S+YTYPAPDCMC A
Sbjct  489  HIKRQGHIRLRKEKQSIYTYPAPDCMCQA  517



>ref|XP_010523344.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
 ref|XP_010523345.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=519

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQLFLNK++ WPEF+ AV+  
Sbjct  429  VSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMVLLGQLFLNKSIGWPEFERAVVNS  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IR+RK  +S+YTYPAPDCMC A
Sbjct  489  HKNRQGQIRIRKEKQSIYTYPAPDCMCKA  517



>ref|XP_010937178.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=560

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SD+FISASPGNMHNA+VG RTY NLKTIRPNM LLGQLFLNK++ W EFQ  V  G
Sbjct  472  VSMQSDVFISASPGNMHNAVVGRRTYLNLKTIRPNMSLLGQLFLNKSMEWSEFQQVVQAG  531

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H NRQG+IR RKP +S+YTYPAPDCMC 
Sbjct  532  HKNRQGQIRPRKPKQSIYTYPAPDCMCQ  559



>ref|XP_009624657.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=516

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EFQ A+ +G
Sbjct  428  VSMQSDIFISASPGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMEWSEFQRAIQQG  487

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  488  HKNRQGQMRLRKEKQSIYTYPAPDCMC  514



>gb|ABJ96379.1| expressed protein [Prunus persica]
Length=517

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EFQ AV++G
Sbjct  429  VSMQSDIFISASPGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQHAVLDG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  489  HKSRQGQIRLRKEKQSIYTYPAPDCMCQA  517



>ref|XP_003526543.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+  HR Y NLKTIRPNM+LLGQLF NK++ W EFQ AV++G
Sbjct  423  VSMQSDIFISASPGNMHNALEAHRAYMNLKTIRPNMRLLGQLFQNKSIGWSEFQLAVLDG  482

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  483  HKNRQGQIRLRKENQSIYTYPAPDCMCRA  511



>gb|KGN62755.1| hypothetical protein Csa_2G370540 [Cucumis sativus]
Length=1445

 Score =   150 bits (379),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  2     VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
             V +HSD+FISASPGNMHNA++GHR Y N+KTIRPNM LLG LFLNK++ W EF+ AV+ G
Sbjct  1356  VSLHSDVFISASPGNMHNALLGHRAYLNMKTIRPNMVLLGPLFLNKSMEWSEFKKAVLTG  1415

Query  182   HANRQGEIRLRKPAKSLYTYPAPDCMC  262
             H NRQG+IRLRK  +S+YTYPAPDCMC
Sbjct  1416  HRNRQGQIRLRKETQSIYTYPAPDCMC  1442



>ref|XP_007018221.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY15446.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=540

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG LFLNK++ W EFQ AVI  
Sbjct  452  VSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMLLLGPLFLNKSMEWSEFQHAVINR  511

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  512  HKNRQGQIRLRKEEQSIYTYPAPDCMCRA  540



>gb|KHN09000.1| DUF246 domain-containing protein [Glycine soja]
Length=510

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+  HR Y NLKTIRPNM+LLGQLF NK++ W EFQ AV++G
Sbjct  422  VSMQSDIFISASPGNMHNALEAHRAYMNLKTIRPNMRLLGQLFQNKSIGWSEFQLAVLDG  481

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  482  HKNRQGQIRLRKENQSIYTYPAPDCMCRA  510



>ref|XP_008219267.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=520

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EFQ AV++G
Sbjct  432  VSMQSDIFISASPGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQHAVLDG  491

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  492  HKSRQGQIRLRKEKQSIYTYPAPDCMCRA  520



>ref|XP_007222858.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
 gb|EMJ24057.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
Length=520

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EFQ AV++G
Sbjct  432  VSMQSDIFISASPGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQHAVLDG  491

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  492  HKSRQGQIRLRKEKQSIYTYPAPDCMCQA  520



>ref|XP_002514041.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48624.1| conserved hypothetical protein [Ricinus communis]
Length=519

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG LFLNK++ W EFQ AV++G
Sbjct  424  VSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVLLGPLFLNKSVEWSEFQTAVVKG  483

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H NRQG+IRLRK  +S+YTYP PDCMC 
Sbjct  484  HKNRQGQIRLRKEKQSIYTYPIPDCMCQ  511



>ref|XP_004301363.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=513

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LL +LFLNK++ W EFQ AV++G
Sbjct  425  VSMQSDIFISASPGNMHNALVCHRAYMNLKTIRPSMTLLSKLFLNKSMQWSEFQQAVLDG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  485  HKNRQGQIRLRKEKQSIYTYPAPDCMCQA  513



>ref|XP_010939815.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=558

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SD+FISASPGNMHNA+VG RTY NLKTIRPNM LLGQLFLNK++ W EFQ  +  G
Sbjct  470  VSMRSDVFISASPGNMHNAVVGRRTYLNLKTIRPNMALLGQLFLNKSMEWSEFQQVIQSG  529

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H NRQG+IR RKP +S+YTYP+PDCMC 
Sbjct  530  HKNRQGQIRQRKPKQSIYTYPSPDCMCQ  557



>gb|KJB58883.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=489

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V + SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG LFLNK + W EFQ AVI G
Sbjct  401  VSLKSDIFISASPGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKTIEWSEFQHAVING  460

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  461  HKNRQGQMRLRKEKQSIYTYPAPDCMCRA  489



>ref|XP_006661225.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Oryza 
brachyantha]
Length=492

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA++ HRT+ NLKTIRPNM LLG++F+NK++ W EFQ+AV  G
Sbjct  404  ISMHSDIFISASPGNMHNALMAHRTFENLKTIRPNMALLGRIFVNKSMEWSEFQEAVQAG  463

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  464  HKGRYGQIRLRKPKQSIYTYPAPDCMCQ  491



>gb|KJB58881.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
 gb|KJB58882.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=518

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V + SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG LFLNK + W EFQ AVI G
Sbjct  430  VSLKSDIFISASPGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKTIEWSEFQHAVING  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  490  HKNRQGQMRLRKEKQSIYTYPAPDCMCRA  518



>ref|XP_004152738.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004163454.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=515

 Score =   146 bits (368),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V +HSD+FISASPGNMHNA++GHR Y N+KTIRPNM LLG LFLNK++ W EF+ AV+ G
Sbjct  426  VSLHSDVFISASPGNMHNALLGHRAYLNMKTIRPNMVLLGPLFLNKSMEWSEFKKAVLTG  485

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG+IRLRK  +S+YTYPAPDCMC
Sbjct  486  HRNRQGQIRLRKETQSIYTYPAPDCMC  512



>ref|XP_002867661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+ G
Sbjct  430  VSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLEWSEFEGAVVNG  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  490  HRNRQGQLRLRKQKQSIYTYPAPDCMCKA  518



>gb|AGV54860.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=516

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V MHSDIFISASPGNMHNA+V HR Y NLKTIRP+M  LG LF NK+++W EFQ  V++G
Sbjct  428  VSMHSDIFISASPGNMHNALVAHRAYMNLKTIRPSMGSLGHLFQNKSVSWSEFQRVVLDG  487

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  488  HKNRQGQIRLRKEKQSIYTYPAPDCMCRA  516



>dbj|BAK06980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSD+FISASPGNMHNA++ HRTY NLKTIRPNM LLG +F+NK++ W EFQ AV  G
Sbjct  424  ISMHSDVFISASPGNMHNALLAHRTYRNLKTIRPNMTLLGHIFVNKSMEWSEFQQAVQAG  483

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H  R G+IRLRKP +S+YTYPAPDCMC
Sbjct  484  HKGRYGQIRLRKPKQSIYTYPAPDCMC  510



>ref|XP_006472461.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 ref|XP_006472462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=517

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LFLNK++ W EFQ AV  G
Sbjct  429  VSMQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMTLLGKLFLNKSMGWTEFQHAVRNG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  489  HKNRLGHIRLRKSKQSIYTYPAPDCMCQS  517



>ref|XP_006472463.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
Length=514

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LFLNK++ W EFQ AV  G
Sbjct  426  VSMQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMTLLGKLFLNKSMGWTEFQHAVRNG  485

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  486  HKNRLGHIRLRKSKQSIYTYPAPDCMCQS  514



>ref|XP_004956798.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=512

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA++ HRTY NLKTIRPNM LLG++F+NK++ W +FQ AV  G
Sbjct  424  ISMHSDIFISASPGNMHNALLAHRTYENLKTIRPNMALLGRIFVNKSMEWLDFQQAVQAG  483

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H  R G+IRLRKP +S+YTYPAPDCMC+
Sbjct  484  HKGRYGQIRLRKPKQSIYTYPAPDCMCH  511



>ref|NP_001063155.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAD28369.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAF25069.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAG90088.1| unnamed protein product [Oryza sativa Japonica Group]
Length=512

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EFQ+AV  G
Sbjct  424  ISMHSDIFISASPGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQEAVQAG  483

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  R G+IRLRKP +S+YTYPAPDCMC  
Sbjct  484  HKGRYGQIRLRKPKQSIYTYPAPDCMCQG  512



>ref|XP_008651492.1| PREDICTED: LOC100283829 isoform X1 [Zea mays]
 gb|ACF82519.1| unknown [Zea mays]
 tpg|DAA61414.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=447

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEFQ  V  G
Sbjct  359  ISMHSDIFISASPGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQVVQAG  418

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  R G+IRLRK  +S+YTYPAPDCMC  
Sbjct  419  HKGRYGQIRLRKATQSIYTYPAPDCMCQG  447



>emb|CAA23010.1| PsRT17-1 like protein [Arabidopsis thaliana]
 emb|CAB79363.1| PsRT17-1 like protein [Arabidopsis thaliana]
Length=431

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+  HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+ G
Sbjct  342  VSMKSDIFISASPGNMHNALQAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVMNG  401

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  402  HKNRQGQLRLRKQKQSIYTYPAPDCMC  428



>ref|XP_008368388.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=519

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LF+NK+  W +FQ AV +G
Sbjct  431  VSMQSDIFISASPGNMHNALVGHRAYMNLKTIRPNMALLGKLFVNKSXEWSDFQRAVSDG  490

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  RQG++RLRK  +S+YTYPAPDCMC +
Sbjct  491  HKTRQGQMRLRKEKQSIYTYPAPDCMCQS  519



>gb|EMT16885.1| hypothetical protein F775_06176 [Aegilops tauschii]
Length=511

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSD+FISASPGNMHNA++ HR Y NLKTIRPNM LLG +F+NK++ W EFQ AV  G
Sbjct  423  ISMHSDVFISASPGNMHNALLAHRAYRNLKTIRPNMTLLGHIFVNKSMEWSEFQQAVQAG  482

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  483  HKGRYGQIRLRKPKQSIYTYPAPDCMCQ  510



>ref|XP_003523785.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+  +R Y NLKTIRP+M LLGQLF NK++ W EFQ A+++G
Sbjct  423  VSMQSDIFISASPGNMHNALAANRAYMNLKTIRPSMGLLGQLFQNKSIGWSEFQRAILDG  482

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  483  HKNRQGQIRLRKEKQSIYTYPAPDCMCRA  511



>ref|XP_009376221.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Pyrus x bretschneideri]
Length=520

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LF+NK++ W +FQ AV +G
Sbjct  432  VSMQSDIFISASPGNMHNALVGHRAYMNLKTIRPNMALLGKLFVNKSMEWSDFQRAVSDG  491

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  R G++RLRK  +S+YTYPAPDCMC A
Sbjct  492  HKTRXGQMRLRKEKQSIYTYPAPDCMCRA  520



>gb|KHN08263.1| DUF246 domain-containing protein [Glycine soja]
Length=511

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+  +R Y NLKTIRP+M LLGQLF NK++ W EFQ A+++G
Sbjct  423  VSMQSDIFISASPGNMHNALAANRAYMNLKTIRPSMGLLGQLFQNKSIGWSEFQRAILDG  482

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  483  HKNRQGQIRLRKEKQSIYTYPAPDCMCRA  511



>ref|XP_011016934.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Populus 
euphratica]
Length=495

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEFQ AV+ G
Sbjct  407  VSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQHAVLSG  466

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IRLRK  +S+YTYP PDC C +
Sbjct  467  HKSRQGQIRLRKERQSIYTYPIPDCSCQS  495



>ref|XP_011016933.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Populus 
euphratica]
Length=513

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEFQ AV+ G
Sbjct  425  VSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQHAVLSG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IRLRK  +S+YTYP PDC C +
Sbjct  485  HKSRQGQIRLRKERQSIYTYPIPDCSCQS  513



>ref|NP_001150199.1| LOC100283829 [Zea mays]
 gb|ACG38224.1| psRT17-1 like protein [Zea mays]
 tpg|DAA61416.1| TPA: psRT17-1 like protein [Zea mays]
Length=511

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEFQ  V  G
Sbjct  423  ISMHSDIFISASPGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQVVQAG  482

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  R G+IRLRK  +S+YTYPAPDCMC  
Sbjct  483  HKGRYGQIRLRKATQSIYTYPAPDCMCQG  511



>gb|EPS73888.1| hypothetical protein M569_00867, partial [Genlisea aurea]
Length=498

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 76/88 (86%), Gaps = 1/88 (1%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFL-NKNLTWPEFQDAVIE  178
            VG+ SDIF+SASPGNMHN MVGHR+Y N KTIRPNM LLGQLFL  KNL+W EF++ VI+
Sbjct  411  VGLRSDIFVSASPGNMHNLMVGHRSYENKKTIRPNMALLGQLFLTTKNLSWTEFENGVID  470

Query  179  GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            GH +R+G ++LR+P +S+YTYPAPDCMC
Sbjct  471  GHKDRRGILKLRRPKQSIYTYPAPDCMC  498



>ref|XP_002301095.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
 gb|EEE80368.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
Length=513

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEFQ AV+ G
Sbjct  425  VSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQYAVLSG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H +RQG+IRLRK  +S+YTYP PDC C +
Sbjct  485  HKSRQGQIRLRKERQSIYTYPIPDCSCQS  513



>gb|KFK28724.1| hypothetical protein AALP_AA7G039000 [Arabis alpina]
Length=513

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+ +NK+L W EF+ +V+ G
Sbjct  423  VSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVLVNKSLDWSEFEGSVLNG  482

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  483  HKNRQGQLRLRKEKQSIYTYPAPDCMCKA  511



>ref|NP_194184.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAP68214.1| At4g24530 [Arabidopsis thaliana]
 dbj|BAE99793.1| PsRT17-1 like protein [Arabidopsis thaliana]
 gb|AEE84921.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=519

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+  HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+ G
Sbjct  430  VSMKSDIFISASPGNMHNALQAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVMNG  489

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  490  HKNRQGQLRLRKQKQSIYTYPAPDCMC  516



>ref|XP_006433827.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47067.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=517

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+VGHR Y  LKTIRPNM LLG+LFLNK++ W EFQ AV  G
Sbjct  429  VSMQSDIFISASPGNMHNALVGHRAYLKLKTIRPNMTLLGKLFLNKSMGWTEFQHAVRNG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  489  HKNRLGHIRLRKTKQSIYTYPAPDCMCQS  517



>ref|XP_006433826.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47066.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=514

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA+VGHR Y  LKTIRPNM LLG+LFLNK++ W EFQ AV  G
Sbjct  426  VSMQSDIFISASPGNMHNALVGHRAYLKLKTIRPNMTLLGKLFLNKSMGWTEFQHAVRNG  485

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  486  HKNRLGHIRLRKTKQSIYTYPAPDCMCQS  514



>ref|XP_002462371.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
 gb|EER98892.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
Length=511

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA++ HRTY NLKTIRPNM LLG++F+NK++ W EFQ  V  G
Sbjct  423  ISMHSDIFISASPGNMHNALMAHRTYENLKTIRPNMALLGRIFVNKSMEWQEFQQVVQAG  482

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H  R G+IRLRK  +S+YTYPAPDCMC  
Sbjct  483  HKGRYGQIRLRKATQSIYTYPAPDCMCQG  511



>gb|EMS64135.1| hypothetical protein TRIUR3_23110 [Triticum urartu]
Length=493

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSD+FISASPGNMHNA++ HR Y N KTIRPNM LLG +F NK++ W EFQ AV  G
Sbjct  405  ISMHSDVFISASPGNMHNALLAHRAYRNFKTIRPNMTLLGHIFANKSMEWSEFQQAVQAG  464

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  465  HKGRYGQIRLRKPKQSIYTYPAPDCMCQ  492



>ref|XP_009138156.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=515

 Score =   140 bits (354),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+ AV+ G
Sbjct  426  VSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEGAVVNG  485

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  486  HKNRQGQLRLRKQKQSIYTYPAPDCMCKA  514



>ref|XP_010448552.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=518

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+ G
Sbjct  429  VSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVVNG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR G++RLRK  +S+YTYP PDCMC  
Sbjct  489  HKNRHGQLRLRKQKQSIYTYPVPDCMCKV  517



>ref|XP_010433755.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=529

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+ G
Sbjct  440  VSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVVNG  499

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR G++R+RK  +S+YTYPAPDCMC  
Sbjct  500  HKNRHGQLRIRKQNQSIYTYPAPDCMCKV  528



>emb|CDY03446.1| BnaC01g16360D [Brassica napus]
Length=613

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+ AV+ G
Sbjct  524  VSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEGAVVNG  583

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  584  HKNRQGQLRLRKQKQSIYTYPAPDCMCKA  612



>ref|XP_010439017.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
 ref|XP_010439018.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
 ref|XP_010439019.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=518

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+ G
Sbjct  429  VSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVVNG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR G++RLRK  +S+YTYP PDCMC  
Sbjct  489  HKNRHGQLRLRKQKQSIYTYPVPDCMCKV  517



>emb|CDY34289.1| BnaA01g13920D [Brassica napus]
Length=792

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+ AV+ G
Sbjct  703  VSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEGAVVNG  762

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  763  HKNRQGQLRLRKQKQSIYTYPAPDCMCKA  791



>ref|XP_006285210.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
 gb|EOA18108.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
Length=521

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+ +NK+L W EF+ AV+ G
Sbjct  432  VSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVLVNKSLDWSEFEGAVVNG  491

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NR G++RLRK  +S+YTYPAPDCMC  
Sbjct  492  HKNRHGQLRLRKQKQSIYTYPAPDCMCKV  520



>gb|KDP41479.1| hypothetical protein JCGZ_15886 [Jatropha curcas]
Length=513

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V + SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG LFLNK+L W  FQ AV+ G
Sbjct  425  VSLQSDIFISASPGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKSLEWSAFQVAVVNG  484

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H NRQG++R RK  +S+YTYP PDCMC 
Sbjct  485  HKNRQGQVRSRKEKQSIYTYPIPDCMCQ  512



>gb|EEC84568.1| hypothetical protein OsI_31345 [Oryza sativa Indica Group]
Length=519

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EFQ+AV  G
Sbjct  396  ISMHSDIFISASPGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQEAVQAG  455

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMC  262
            H  R G+IRLRKP +S+YTYPAPD  C
Sbjct  456  HKGRYGQIRLRKPKQSIYTYPAPDFCC  482



>ref|XP_006413418.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
 gb|ESQ54871.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
Length=518

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+  V+ G
Sbjct  429  VSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLEWSEFEGRVLNG  488

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            H NRQG++RLRK  +S+YTYPAPDCMC  
Sbjct  489  HKNRQGQLRLRKQKQSIYTYPAPDCMCKV  517



>ref|XP_003578106.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=512

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + +HSDIFISASPGNMHNA++  R Y+N+KTI+PNM LLG +F+NK+  W EFQ AV  G
Sbjct  424  ISIHSDIFISASPGNMHNAVMAQRAYNNMKTIKPNMALLGHIFVNKSNEWSEFQQAVQAG  483

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  484  HKGRYGQIRLRKPKQSIYTYPAPDCMCQ  511



>gb|EEE69695.1| hypothetical protein OsJ_29339 [Oryza sativa Japonica Group]
Length=722

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EFQ+AV  G
Sbjct  424  ISMHSDIFISASPGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQEAVQAG  483

Query  182  HANRQGEIRLRKPAKSLYTYPAPD  253
            H  R G+IRLRKP +S+YTYPAPD
Sbjct  484  HKGRYGQIRLRKPKQSIYTYPAPD  507



>tpg|DAA61415.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=486

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            + MHSDIFISASPGNMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEFQ  V  G
Sbjct  388  ISMHSDIFISASPGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQVVQAG  447

Query  182  HANRQGEIRLRKPAKSLYTYPAPD  253
            H  R G+IRLRK  +S+YTYPAPD
Sbjct  448  HKGRYGQIRLRKATQSIYTYPAPD  471



>ref|XP_001777077.1| predicted protein [Physcomitrella patens]
 gb|EDQ58070.1| predicted protein, partial [Physcomitrella patens]
Length=437

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNL-KTIRPNMQLLGQLFLNKNLTWPEFQDAVIE  178
            V +HSDIF+SAS GNMHN++  HRTY N+ KTI+P+M L+ +LF +KNLTWPEF+ +V+E
Sbjct  330  VSLHSDIFLSASRGNMHNSLAAHRTYLNVRKTIKPDMNLMARLFAHKNLTWPEFRRSVVE  389

Query  179  GHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            GH NR G++ LR+P +S+YTYPAPDCMC +
Sbjct  390  GHKNRMGQVALRQPTQSIYTYPAPDCMCTS  419



>ref|XP_010312650.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Solanum 
lycopersicum]
Length=468

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +2

Query  44   NMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEGHANRQGEIRLRKPA  223
            ++ ++ VG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VIEGH NRQG+IRLRKP 
Sbjct  394  SLASSEVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVIEGHQNRQGQIRLRKPK  453

Query  224  KSLYTYPAPDCMCNA  268
            +SLYTYPAPDCMC A
Sbjct  454  QSLYTYPAPDCMCQA  468



>ref|XP_002967262.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
 gb|EFJ31861.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
Length=476

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNL-KTIRPNMQLLGQLFLNKNLTWPEFQDAVIE  178
            V + SD F+SASPGNMHNA++GHRTY N+ KT+RP+M LL +LF N ++ WPEFQ+ V  
Sbjct  380  VCLKSDFFLSASPGNMHNAVIGHRTYQNVQKTLRPDMVLLSRLFSNSSMEWPEFQNRVYN  439

Query  179  GHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            GH NR G++RLR+P +S+YTYPAPDCMC +
Sbjct  440  GHRNRLGQVRLRQPKQSIYTYPAPDCMCKS  469



>ref|XP_002960458.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
 gb|EFJ37997.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
Length=464

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNL-KTIRPNMQLLGQLFLNKNLTWPEFQDAVIE  178
            V + SD F+SASPGNMHNA++GHRTY N+ KT+RP+M LL +LF N ++ WPEFQ+ V  
Sbjct  368  VCLKSDFFLSASPGNMHNAVIGHRTYQNVQKTLRPDMVLLSRLFSNSSMEWPEFQNRVYN  427

Query  179  GHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            GH NR G++RLR+P +S+YTYPAPDCMC 
Sbjct  428  GHRNRLGQVRLRQPKQSIYTYPAPDCMCK  456



>emb|CDX92640.1| BnaC07g38980D [Brassica napus]
Length=261

 Score =   121 bits (303),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 68/88 (77%), Gaps = 3/88 (3%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V M SDIFISASPGNMHNA++ H  Y NL T+ PN  LLGQ+ +N+++ W EF+ AV++G
Sbjct  175  VSMKSDIFISASPGNMHNALLAHGAYLNLMTVNPNTILLGQVLVNRSIGWSEFEGAVLKG  234

Query  182  HANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            H N QG++RLR   KS+YTYPAPDCMC 
Sbjct  235  HKNSQGQLRLR---KSIYTYPAPDCMCK  259



>gb|KJB48896.1| hypothetical protein B456_008G092600, partial [Gossypium raimondii]
Length=495

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 75/123 (61%), Gaps = 34/123 (28%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVG----HRTYHNLKTI------------------------  97
            VGMHSDIF+SASPGNMHNA+ G    +R +H   T+                        
Sbjct  373  VGMHSDIFVSASPGNMHNALPGITYRYRAFHFAATVPKVYMWKISNNYVQLQCFYNFFLF  432

Query  98   ------RPNMQLLGQLFLNKNLTWPEFQDAVIEGHANRQGEIRLRKPAKSLYTYPAPDCM  259
                    +M LLGQLFLNKN+TW EF+ AV EGH NRQG+++LRKP +S+YTYPAPDCM
Sbjct  433  PSASVNEHDMALLGQLFLNKNITWLEFRQAVAEGHQNRQGQLKLRKPKQSIYTYPAPDCM  492

Query  260  CNA  268
            C A
Sbjct  493  CRA  495



>ref|XP_007136337.1| hypothetical protein PHAVU_009G0371001g, partial [Phaseolus vulgaris]
 gb|ESW08331.1| hypothetical protein PHAVU_009G0371001g, partial [Phaseolus vulgaris]
Length=69

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +2

Query  62   VGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEGHANRQGEIRLRKPAKSLYTY  241
            V HR Y NLKTIRP+M  LG LF NK+++W EFQ  V++GH NRQG+IRLRK  +S+YTY
Sbjct  1    VAHRAYMNLKTIRPSMGSLGHLFQNKSVSWSEFQRVVLDGHKNRQGQIRLRKEKQSIYTY  60

Query  242  PAPDCMCNA  268
            PAPDCMC A
Sbjct  61   PAPDCMCRA  69



>emb|CDY11018.1| BnaA03g46770D [Brassica napus]
Length=95

 Score = 98.2 bits (243),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEG  181
            V + SDIF+SASPGNMHNA++ HR Y NLKT+ PNM LLGQ+ +NK+L W EF+ AV+ G
Sbjct  30   VSVKSDIFVSASPGNMHNALLPHRAYLNLKTVNPNMILLGQVLVNKSLGWSEFEGAVLNG  89

Query  182  HANRQG  199
            H NRQG
Sbjct  90   HKNRQG  95



>ref|XP_006383813.1| hypothetical protein POPTR_0005s28420g, partial [Populus trichocarpa]
 gb|ERP61610.1| hypothetical protein POPTR_0005s28420g, partial [Populus trichocarpa]
Length=133

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 54/88 (61%), Gaps = 14/88 (16%)
 Frame = +2

Query  5    GMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEGH  184
             + SDIFISASPGNMHNA+          T R NM ++G LFLNK++ WPEFQ AV+ GH
Sbjct  60   SLQSDIFISASPGNMHNAL----------TTRANMVMVGSLFLNKSMEWPEFQRAVLNGH  109

Query  185  ANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
             +RQG  +  K A+       PDC C +
Sbjct  110  KSRQGPDQFEKEAE----VAIPDCTCQS  133



>gb|AAB72114.1| PsRT17-1 [Pisum sativum]
Length=406

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNL  145
            + +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK +
Sbjct  354  ISIHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTM  401



>ref|XP_001765982.1| predicted protein [Physcomitrella patens]
 gb|EDQ69303.1| predicted protein, partial [Physcomitrella patens]
Length=451

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHN-LKTIRPNMQLLGQLFLNKNLTWPEFQDAVIE  178
            V ++SD+F+S + GN  N + G RT++   K+I  + +LL  LF   +++W EF   V E
Sbjct  356  VLLNSDVFMSNAAGNFPNVLSGQRTFYGPRKSIHADKRLLAHLFSKSSISWLEFSSQVTE  415

Query  179  GHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            GH +R G    R P  S++ YPAPDCMC 
Sbjct  416  GHLSRLGSPVRRMPKYSIFRYPAPDCMCQ  444



>ref|XP_010104478.1| hypothetical protein L484_025447 [Morus notabilis]
 gb|EXC01079.1| hypothetical protein L484_025447 [Morus notabilis]
Length=256

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 60/93 (65%), Gaps = 6/93 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N  + W +F+  +
Sbjct  150  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLAVLFDNPKIRWEDFKRQM  209

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
             +   H++++G I LRKP+ SLYT+P PDCMC 
Sbjct  210  RDMLRHSDQKG-IELRKPSGSLYTFPMPDCMCK  241



>gb|EPS68582.1| hypothetical protein M569_06186, partial [Genlisea aurea]
Length=117

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 56/93 (60%), Gaps = 4/93 (4%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS +F++   GN  + +VGHR Y    + +TI+P+ + L QLF + N+ W +F+  +
Sbjct  15   VCLHSQVFVTTQGGNFPHFLVGHRRYTYGGHARTIKPDKRKLVQLFDDTNIRWQDFKKHL  74

Query  173  IEG-HANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
             +    N    + LRKP  SLY +P PDCMCNA
Sbjct  75   RDMLRRNDLKGVELRKPGGSLYMHPMPDCMCNA  107



>ref|XP_010538926.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=571

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F+S   GN  + ++GHR Y    + KTI+P+ + L QLF N N+ W  F+  +
Sbjct  472  VCLHSEVFVSTQGGNFPHFLMGHRRYLYKGHAKTIKPDKRKLVQLFDNPNIRWDYFKKQM  531

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
             +   H + +G + LRKPA SLYT+P PDCMC 
Sbjct  532  QDMLRHNDAKG-VELRKPASSLYTFPMPDCMCK  563



>emb|CDP10650.1| unnamed protein product [Coffea canephora]
Length=573

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F+S   GN  + +VGHR Y    + KTI+P+ + L  LF N N+ W +F+  +
Sbjct  467  VCLHSEVFVSTQGGNFPHFLVGHRRYLYEGHAKTIKPDKRKLALLFDNPNIRWKDFKRQL  526

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++ +G +  RKP+ SLYTYP PDCMC
Sbjct  527  QDMLRHSDVKG-VETRKPSGSLYTYPMPDCMC  557



>ref|XP_006826849.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
 gb|ERM94086.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
Length=554

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 60/94 (64%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF--QD  166
            V +HS++F++   GN  + ++GHR +    + KTIRP+ + L Q+F N N+ W  F  Q 
Sbjct  450  VCLHSEVFVTTQGGNFPHFLMGHRRFLYGGHSKTIRPDKRKLVQIFGNPNIGWKNFKRQM  509

Query  167  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
             V+  H++ +G + +R+P  S+YT+P PDCMC A
Sbjct  510  LVMRSHSDAKG-MEIRRPNDSIYTFPCPDCMCRA  542



>ref|XP_009362464.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=442

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 61/92 (66%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W +F+  +
Sbjct  341  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIKPDKRKLALLFDNPNIRWEDFKRQM  400

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++++G + L+KP+ SLYT+P PDCMC
Sbjct  401  QDMLRHSDQKG-VELKKPSASLYTFPMPDCMC  431



>ref|XP_009362462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=582

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 61/92 (66%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W +F+  +
Sbjct  481  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIKPDKRKLALLFDNPNIRWEDFKRQM  540

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++++G + L+KP+ SLYT+P PDCMC
Sbjct  541  QDMLRHSDQKG-VELKKPSASLYTFPMPDCMC  571



>gb|KHG19963.1| hypothetical protein F383_04918 [Gossypium arboreum]
Length=561

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  457  VCLHSEVFVTTQGGNFPHFLMGHRRYLFGGHSKTIRPDKRKLALLFDNPNIGWKSFKRQM  516

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L+KP  S+YT+P PDCMC
Sbjct  517  LNMRSHSDSKG-FELKKPVDSIYTFPCPDCMC  547



>ref|XP_010274715.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=558

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  V
Sbjct  454  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKTFKRHV  513

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G I L++P  S+YT+P PDCMC
Sbjct  514  LNMRSHSDAKG-IELKRPNDSIYTFPCPDCMC  544



>ref|XP_004299893.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=564

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 61/93 (66%), Gaps = 6/93 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N ++ W +F+  +
Sbjct  459  VCLHSEVFVTTQGGNFPHFLIGHRRYLYGGHSKTIKPDKRKLALLFDNPSIRWEDFKRQM  518

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
             +   H++++G + +RKP+ SLYT+P PDCMC 
Sbjct  519  QDMLRHSDQKG-VEVRKPSASLYTFPMPDCMCK  550



>ref|XP_011096470.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=586

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + +VGHR Y    + KTIRP+ + L QLF   ++ W +F+  +
Sbjct  480  VCLHSEVFVTTQGGNFPHFLVGHRRYFYEGHAKTIRPDKRKLAQLFDKPSIRWQDFKRQL  539

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H + +G   LRKP+ SLY YP PDCMC
Sbjct  540  QDMLRHNDVKGS-ELRKPSNSLYMYPMPDCMC  570



>gb|KJB30799.1| hypothetical protein B456_005G161000 [Gossypium raimondii]
Length=561

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  457  VCLHSEVFVTTQGGNFPHFLMGHRRYLHGGHSKTIRPDKRKLALLFDNPNIGWKSFKRQM  516

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P+ S+YT+P PDCMC
Sbjct  517  LNMRSHSDSKG-FELKRPSDSIYTFPCPDCMC  547



>ref|XP_008378761.1| PREDICTED: uncharacterized protein At1g04910 [Malus domestica]
Length=455

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 60/92 (65%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W +F+  +
Sbjct  345  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIKPDKRKLALLFDBPNIRWEDFKRQM  404

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++++G   L+KP+ SLYT+P PDCMC
Sbjct  405  QDMLRHSDQKG-FELKKPSASLYTFPMPDCMC  435



>ref|XP_006473173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
 gb|KDO83869.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=445

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +F+  +
Sbjct  338  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDDFKRQM  397

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  398  KDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  428



>ref|XP_006434582.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47822.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=445

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +F+  +
Sbjct  338  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDDFKRQM  397

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  398  KDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  428



>ref|XP_004505284.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=560

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  F+  +
Sbjct  456  VCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSKTIKPDKRKLALLFDNPNIGWKSFKRQL  515

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H++ +G + L++P  S+Y++P PDCMC A
Sbjct  516  MSMRSHSDSKG-VELKRPNDSIYSFPCPDCMCRA  548



>ref|XP_004238827.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
 ref|XP_010320701.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=581

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + +TIRP+ + L  L+ N N+ W  F+  +
Sbjct  477  VCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSRTIRPDKRKLALLYDNPNIGWKSFKRQM  536

Query  173  --IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
              I  H++ +G I +++P  S+YT+P PDCMC +
Sbjct  537  HSIRAHSDSKG-IEIKRPNDSIYTFPCPDCMCRS  569



>ref|XP_010093364.1| hypothetical protein L484_022926 [Morus notabilis]
 gb|EXB53958.1| hypothetical protein L484_022926 [Morus notabilis]
Length=562

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  458  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKSFKRQM  517

Query  173  --IEGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
              I  H++ +G   L++P  S+YT+P PDCMC
Sbjct  518  LGIRSHSDLKG-FELKRPNDSIYTFPCPDCMC  548



>ref|XP_007222464.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
 gb|EMJ23663.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
Length=569

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 60/92 (65%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI P+ + L  LF N ++ W +F+  V
Sbjct  459  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTINPDKRKLALLFDNPSIRWEDFKRQV  518

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++++G + L+KP+ SLYT+P PDCMC
Sbjct  519  QDMLRHSDQKG-VELKKPSASLYTFPMPDCMC  549



>ref|XP_006434581.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47821.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=656

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +F+  +
Sbjct  549  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDDFKRQM  608

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
             +   H++ +G   LRKP+ SLYT+P PDCMC 
Sbjct  609  KDMLSHSDVKGS-ELRKPSASLYTFPMPDCMCK  640



>ref|XP_008389203.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=228

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 57/94 (61%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N  + W  F+  +
Sbjct  124  VCLHSEVFVTTQGGNFPHFLIGHRRYMYGGHSKTIRPDKRKLALLFDNPQIGWKTFKRHL  183

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H++ +G   +++P  S+YT+P PDCMC +
Sbjct  184  LGMRSHSDSKG-YEIKRPNDSIYTFPCPDCMCRS  216



>ref|XP_006473171.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 gb|KDO83865.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
 gb|KDO83866.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=570

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +F+  +
Sbjct  463  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDDFKRQM  522

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  523  KDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  553



>ref|XP_010695805.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L Q+F N N+ W  F+  +
Sbjct  468  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIRPDKRKLAQIFDNPNIGWKTFKRHM  527

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P  S+Y++P PDCMC
Sbjct  528  LNMRSHSDSKG-FELKRPNDSIYSFPCPDCMC  558



>ref|XP_007045152.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY00984.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=561

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  457  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKSFKRQM  516

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P  S+YT+P PDCMC
Sbjct  517  LNMRSHSDSKG-FELKRPNDSIYTFPCPDCMC  547



>ref|XP_006434583.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 ref|XP_006434584.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47823.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47824.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=570

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +F+  +
Sbjct  463  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDDFKRQM  522

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  523  KDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  553



>ref|XP_006469184.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=558

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  460  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWRSFKRQM  519

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H++ +G   L++P+ S YT+P PDCMC A
Sbjct  520  LSMRSHSDSKG-YELKRPSDSPYTFPCPDCMCRA  552



>gb|KDO64642.1| hypothetical protein CISIN_1g008637mg [Citrus sinensis]
Length=558

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  460  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWRSFKRQM  519

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H++ +G   L++P+ S YT+P PDCMC A
Sbjct  520  LSMRSHSDSKG-YELKRPSDSPYTFPCPDCMCRA  552



>ref|XP_006448248.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
 gb|ESR61488.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
Length=558

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  460  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWRSFKRQM  519

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H++ +G   L++P+ S YT+P PDCMC A
Sbjct  520  LSMRSHSDSKG-YELKRPSDSPYTFPCPDCMCRA  552



>gb|EYU22809.1| hypothetical protein MIMGU_mgv1a003510mg [Erythranthe guttata]
Length=580

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 55/91 (60%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + +VGHR Y    + KTI+P+ + L QLF   ++ W +F+  +
Sbjct  474  VCLHSEVFVTTQGGNFPHFLVGHRRYFYEGHSKTIKPDKRKLAQLFDKPSIRWQDFKRQL  533

Query  173  IEG-HANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +  H N    I LRK + SLY YP PDCMC
Sbjct  534  QDMLHHNDVKGIELRKSSSSLYMYPMPDCMC  564



>ref|XP_006397450.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
 gb|ESQ38903.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
Length=571

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QLF   ++ W  F+  +
Sbjct  469  VCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLFDKPSIRWDYFKKQM  528

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
             +   H + +G + LRKPA SLYT+P PDCMC 
Sbjct  529  QDMLRHNDAKG-VELRKPAASLYTFPMPDCMCK  560



>emb|CBI18521.3| unnamed protein product [Vitis vinifera]
Length=492

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + +++W  F+  +
Sbjct  386  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDSPDISWDNFKSQM  445

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  446  QDMLRHSDSKGS-ELRKPSSSLYTFPMPDCMC  476



>ref|XP_009407491.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=569

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F+S   GN    ++GHR Y    + KTI+P+ + L  LF N N+ W   +  +
Sbjct  465  VCLHSEVFVSTQGGNFPQILIGHRRYLYGGHSKTIKPDKRKLALLFDNPNIGWKSLKRQL  524

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G I +++P  S+Y+YP PDCMC
Sbjct  525  LNMRAHSDAKG-IEMKRPNDSIYSYPCPDCMC  555



>gb|KJB15425.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
Length=539

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  435  VCLHSEVFVTTQGGNFPHFLMGHRRYLYSGHSKTIRPDKRRLALLFDNPNIGWRTFKRQM  494

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P  S+YT+P PDCMC
Sbjct  495  LNMRSHSDTKG-FELKRPNDSIYTFPCPDCMC  525



>ref|XP_002272758.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=582

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + +++W  F+  +
Sbjct  476  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDSPDISWDNFKSQM  535

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  536  QDMLRHSDSKGS-ELRKPSSSLYTFPMPDCMC  566



>ref|XP_002284457.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI26895.3| unnamed protein product [Vitis vinifera]
Length=561

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KT+RP+ + L  LF N N+ W  F+  +
Sbjct  457  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTVRPDKRKLALLFDNPNIGWKSFKRQM  516

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P  S+YT+P PDCMC
Sbjct  517  LNMRAHSDAKG-FELKRPNDSIYTFPCPDCMC  547



>gb|KJB15424.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
 gb|KJB15426.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
Length=561

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  457  VCLHSEVFVTTQGGNFPHFLMGHRRYLYSGHSKTIRPDKRRLALLFDNPNIGWRTFKRQM  516

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P  S+YT+P PDCMC
Sbjct  517  LNMRSHSDTKG-FELKRPNDSIYTFPCPDCMC  547



>ref|XP_007157752.1| hypothetical protein PHAVU_002G095600g [Phaseolus vulgaris]
 gb|ESW29746.1| hypothetical protein PHAVU_002G095600g [Phaseolus vulgaris]
Length=563

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W   +  +
Sbjct  459  VCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHAKTIRPDKRKLALLFDNPNIGWKSLKRQL  518

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H++ +G + L++P  S+Y++P PDCMC A
Sbjct  519  LSMRWHSDSKG-VELKRPNDSIYSFPCPDCMCRA  551



>ref|XP_006355100.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=578

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + +TIRP+ + L  L+ N N+ W  F+  +
Sbjct  474  VCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSRTIRPDKRKLALLYDNPNIGWKSFKRQM  533

Query  173  --IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
              I  H++ +G I +++P  S+Y++P PDCMC +
Sbjct  534  LSIRAHSDSKG-IEIKRPNDSIYSFPCPDCMCRS  566



>ref|XP_009785418.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009785419.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nicotiana 
sylvestris]
Length=574

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + +TIRP+ + L  L+ N N+ W  F+  +
Sbjct  470  VCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSRTIRPDKRKLALLYDNPNIGWKSFKRQM  529

Query  173  --IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
              I  H++ +G I +++P  S+Y++P PDCMC +
Sbjct  530  LNIRAHSDSKG-IEIKRPNDSIYSFPCPDCMCRS  562



>ref|XP_010461317.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    N+ W  F+  +
Sbjct  475  VCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPNIRWDYFKKQM  534

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  535  QDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  565



>ref|XP_010500036.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    N+ W  F+  +
Sbjct  475  VCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPNIRWDYFKKQM  534

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  535  QDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  565



>gb|EYU30069.1| hypothetical protein MIMGU_mgv1a003875mg [Erythranthe guttata]
Length=558

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN    ++GHR Y    + +TIRP+ + L  LF N N+ W  F+  +
Sbjct  456  VCLHSEVFVTTQGGNFPQFLIGHRRYLYGGHSRTIRPDKRKLAILFDNPNIGWKSFKRQM  515

Query  173  --IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
              I  H++ +G I L++   S+Y+YP PDCMC  
Sbjct  516  LNIRAHSDLKG-IELKRRNDSIYSYPCPDCMCKV  548



>ref|XP_009420104.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=571

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W   +  +
Sbjct  467  VCLHSEVFVTTQGGNFPHFLIGHRRYLYGGHSKTIKPDKRKLALLFDNPNIGWKSLKRQL  526

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G + +++P+ SLYT+P PDCMC
Sbjct  527  LNMRAHSDAKG-MEMKRPSDSLYTFPCPDCMC  557



>gb|KHN08072.1| DUF246 domain-containing protein [Glycine soja]
Length=449

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W   +  +
Sbjct  345  VCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSKTIKPDKRKLALLFDNPNIGWKSLKRQL  404

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H++ +G + L++P  S+Y++P PDCMC A
Sbjct  405  LSMRSHSDSKG-VELKRPNDSIYSFPCPDCMCRA  437



>gb|KHG09805.1| hypothetical protein F383_15167 [Gossypium arboreum]
Length=561

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  457  VCLHSEVFLTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRRLALLFDNPNIGWRTFKRQM  516

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P  S+YT+P PDCMC
Sbjct  517  LNMRSHSDTKG-FELKRPNDSIYTFPCPDCMC  547



>ref|XP_004297377.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=569

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHN---LKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y N    KTIRP+ + L  +F N  + W  F+  +
Sbjct  465  VCLHSEVFVTTQGGNFPHFLMGHRRYLNGGHSKTIRPDKRKLALIFDNPKIGWKTFKRQL  524

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P  S+YT+P PDCMC
Sbjct  525  LSMRSHSDSKG-FELKRPNDSIYTFPCPDCMC  555



>gb|KFK27807.1| hypothetical protein AALP_AA8G431600 [Arabis alpina]
Length=569

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 58/93 (62%), Gaps = 6/93 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V ++S++F+S   GN  + ++GHR Y    + +TI+P+ + L QLF   ++ W  F+  +
Sbjct  467  VCLYSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLFDRPSIRWDYFKKQM  526

Query  173  --IEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
              I  H + +G + LRKPA SLYT+P PDCMC 
Sbjct  527  QDILRHNDAKG-VELRKPAASLYTFPMPDCMCK  558



>ref|XP_009379518.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=571

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 60/92 (65%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KT++P+ + L  LF N ++ W +F+  +
Sbjct  461  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTVKPDKRKLALLFDNPSIRWEDFKRQM  520

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++++G   L+KP+ SLYT+P PDCMC
Sbjct  521  QDMLRHSDQKG-FELKKPSASLYTFPMPDCMC  551



>gb|EPS61269.1| hypothetical protein M569_13528, partial [Genlisea aurea]
Length=174

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR +    + +TIRP+ + L  +F N N+ W  F+  +
Sbjct  70   VCLHSEVFVTTQGGNFPHFLLGHRRFLYGGHSRTIRPDKRKLAVIFDNPNIGWKSFKRQM  129

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G I L++P  S+Y+ P PDCMC
Sbjct  130  LNMRSHSDSKG-IELKRPNDSIYSVPCPDCMC  160



>ref|XP_010262622.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=563

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 54/91 (59%), Gaps = 4/91 (4%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  459  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKTFKHNM  518

Query  173  IEGHANRQGE-IRLRKPAKSLYTYPAPDCMC  262
            +   A    + I L++P  S YT+P PDCMC
Sbjct  519  LNMRAQSDAKGIELKRPNDSTYTFPCPDCMC  549



>gb|KEH30846.1| O-fucosyltransferase family protein [Medicago truncatula]
Length=561

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  F+  +
Sbjct  457  VCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSKTIKPDKRKLALLFDNPNIGWRSFKRQL  516

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H++ +G + L++P  S+Y++P P+CMC A
Sbjct  517  LNMRSHSDSKG-VELKRPNDSIYSFPCPECMCRA  549



>ref|XP_010066619.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW64583.1| hypothetical protein EUGRSUZ_G02181 [Eucalyptus grandis]
Length=564

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  +F N NL W  F+  +
Sbjct  460  VCLHSEVFVTTQGGNFPHFLLGHRRYMYGGHSKTIRPDKRKLALIFDNPNLGWKNFKRQM  519

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P  S+Y++P PDCMC
Sbjct  520  LNMRSHSDSKG-FELKRPNDSIYSFPCPDCMC  550



>ref|XP_006307153.1| hypothetical protein CARUB_v10008744mg [Capsella rubella]
 gb|EOA40051.1| hypothetical protein CARUB_v10008744mg [Capsella rubella]
Length=555

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N  L W  F+  +
Sbjct  455  VCLHSEVFVTTQGGNFPHFLMGHRRYLFGGHSKTIRPDKRKLAVLFDNPKLGWKSFKRQM  514

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G + L++P+ S+Y +P PDCMC
Sbjct  515  LSMRSHSDSKGFV-LKRPSDSIYIFPCPDCMC  545



>ref|XP_004150597.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004164435.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN51494.1| hypothetical protein Csa_5G570390 [Cucumis sativus]
Length=563

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N  + W  F+  +
Sbjct  459  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPTIGWKNFKRHM  518

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P+ S+YT+P PDCMC
Sbjct  519  LNMRSHSDSKG-FELKRPSDSIYTFPCPDCMC  549



>ref|XP_003556095.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 ref|XP_006605495.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=564

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W   +  +
Sbjct  460  VCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSKTIKPDKRKLALLFDNPNIGWKSLKRQL  519

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H++ +G + L++P  S+Y++P PDCMC A
Sbjct  520  LSMRSHSDSKG-VELKRPNDSIYSFPCPDCMCRA  552



>ref|XP_006304663.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
 gb|EOA37561.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
Length=580

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 57/93 (61%), Gaps = 6/93 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    ++ W  F+  +
Sbjct  476  VCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPSIRWDYFKKQM  535

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
             +   H + +G I LRKPA SLYT+P PDCMC 
Sbjct  536  QDMLRHNDAKG-IELRKPAASLYTFPMPDCMCK  567



>ref|XP_008243446.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=540

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N  + W  F+  +
Sbjct  436  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPKIGWKTFKRQL  495

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H + +G   L++P  S+YT+P PDCMC +
Sbjct  496  LGMRSHGDSKG-FELKRPNDSIYTFPCPDCMCRS  528



>gb|KDP34835.1| hypothetical protein JCGZ_11197 [Jatropha curcas]
Length=594

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYHN---LKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y N    KTI+P+ + L  LF   ++ W  F+  +
Sbjct  482  VCLHSEVFVTTQGGNFPHFLMGHRRYLNGGHAKTIKPDKRKLALLFDKPSIRWEVFKRQM  541

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  542  KDMLRHSDHKGS-ELRKPSGSLYTFPMPDCMC  572



>ref|XP_009598681.1| PREDICTED: uncharacterized protein At1g04910, partial [Nicotiana 
tomentosiformis]
Length=419

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V ++S++F++   GN  + ++GHR Y    + +TIRP+ + L  L+ N N+ W  F+  +
Sbjct  315  VCLYSEVFVTTQGGNFPHFLLGHRRYLYGGHSRTIRPDKRKLALLYDNPNIGWKSFKRQM  374

Query  173  --IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
              I  H++ +G I +++P  S+Y++P PDCMC +
Sbjct  375  LNIRAHSDSKG-IEIKRPNDSIYSFPCPDCMCRS  407



>ref|XP_008776785.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=563

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N  ++W   +  +
Sbjct  459  VCLHSEVFLTTQGGNFPHFLIGHRRYLYGGHSKTIKPDKRKLALLFDNPKVSWKALKRQL  518

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H++ +G I +++P  S+YTYP PDCMC +
Sbjct  519  LNMRAHSDAKG-IEIKRPNDSIYTYPCPDCMCRS  551



>ref|XP_010553860.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=566

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N ++ W  F+  +
Sbjct  461  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLAILFDNPSIGWRSFKRQM  520

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G + L++P  S+YT+P PDCMC
Sbjct  521  LNMRSHSDSKG-LELKRPNDSIYTFPCPDCMC  551



>ref|XP_010527785.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=567

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  459  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLAILFDNPNIGWRSFKRQM  518

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P  S+YT+P PDCMC
Sbjct  519  LNMRCHSDSKGH-ELKRPNDSIYTFPCPDCMC  549



>gb|KJB50369.1| hypothetical protein B456_008G166900 [Gossypium raimondii]
Length=561

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  457  VCLHSEVFVTTQGGNFPHFLMGHRRYLFGGHSKTIRPDKRKLALLFDNPNIGWKSFKRQM  516

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L+K   S+YT+P PDCMC
Sbjct  517  LNMRSHSDSKG-FELKKLVDSIYTFPCPDCMC  547



>ref|XP_008219032.1| PREDICTED: uncharacterized protein At1g04910 [Prunus mume]
Length=503

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 59/91 (65%), Gaps = 6/91 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI P+ + L  LF N ++ W +F+  V
Sbjct  393  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTINPDKRKLALLFDNPSIRWEDFKKQV  452

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCM  259
             +   H++++G + L+KP+ SLYT+P PDCM
Sbjct  453  QDMLRHSDQKG-VELKKPSASLYTFPMPDCM  482



>ref|XP_010496695.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=556

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N  L W  F+  +
Sbjct  456  VCLHSEVFVTTQGGNFPHFLMGHRRYLFGGHSKTIRPDKRKLAVLFDNPKLGWRSFKRQM  515

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P+ S+Y +P PDCMC
Sbjct  516  LSMRSHSDSKG-FELKRPSDSIYIFPCPDCMC  546



>ref|XP_009778494.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=547

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH-NLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIE  178
            V  +S++F+ +  GNM +A+ GHR Y  + KTI PN + + + FLN +L+  EF   ++E
Sbjct  451  VSANSNVFMPSHGGNMGHAIQGHRAYAGHKKTITPNKRQMLRHFLNSSLSETEFNRIILE  510

Query  179  GHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
             H +  G+  LRK  + +  YP P+CMCN 
Sbjct  511  LHRDSLGQPELRKAGRDVTKYPVPECMCNG  540



>ref|XP_010496702.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
Length=549

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N  L W  F+  +
Sbjct  449  VCLHSEVFVTTQGGNFPHFLMGHRRYLFGGHSKTIRPDKRKLAVLFDNPKLGWRSFKRQM  508

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P+ S+Y +P PDCMC
Sbjct  509  LSMRSHSDSKG-FELKRPSDSIYIFPCPDCMC  539



>ref|XP_009626180.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=546

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH-NLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIE  178
            V  +S++F+ +  GNM +A+ GHR Y  + KTI PN + + + FLN +L+  EF   ++E
Sbjct  450  VSANSNVFMPSHGGNMGHAIQGHRAYAGHKKTITPNKRQMLRHFLNSSLSETEFNRIILE  509

Query  179  GHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
             H +  G+  LRK  + +  YP P+CMCN 
Sbjct  510  LHRDSLGQPELRKAGRDVTKYPVPECMCNG  539



>ref|XP_007148603.1| hypothetical protein PHAVU_005G000400g [Phaseolus vulgaris]
 gb|ESW20597.1| hypothetical protein PHAVU_005G000400g [Phaseolus vulgaris]
Length=565

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W EF+  +
Sbjct  462  VCLHSEVFVTTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRKLALLFDNPNIRWEEFKQQM  521

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++++G   L+K   S+YT+P PDCMC
Sbjct  522  KDMLRHSDQKG-TELKKVGGSVYTFPMPDCMC  552



>ref|XP_006398540.1| hypothetical protein EUTSA_v10000838mg [Eutrema salsugineum]
 gb|ESQ39993.1| hypothetical protein EUTSA_v10000838mg [Eutrema salsugineum]
Length=565

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F+  +
Sbjct  459  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLAILFDNPNIGWRSFKRQM  518

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCM  259
            +    H++ +G I L++P  S+YT+P PDCM
Sbjct  519  LNMRSHSDSKG-IELKRPNDSIYTFPCPDCM  548



>ref|XP_006579000.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=500

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  F+  +
Sbjct  392  VCLHSEVFVTTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRRLALLFDNPNIRWEVFKQQM  451

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++++G   L+K  +SLYT+P PDCMC
Sbjct  452  KDMLRHSDQKG-TELKKAGESLYTFPMPDCMC  482



>gb|EMT10519.1| hypothetical protein F775_32922 [Aegilops tauschii]
Length=157

 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 6/93 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W  F+  +
Sbjct  62   VCVQSEVFVTTQGGNFPHFLMGHRRYLLGGNAKTIKPDKRKLVLSFDDPNIRWSRFKHHM  121

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
            +E   H++ +G I  RKP  S+YT+P PDCMC 
Sbjct  122  LEILHHSDIRG-IAFRKPNDSIYTFPMPDCMCQ  153



>ref|XP_007225729.1| hypothetical protein PRUPE_ppa003622mg [Prunus persica]
 gb|EMJ26928.1| hypothetical protein PRUPE_ppa003622mg [Prunus persica]
Length=561

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 56/94 (60%), Gaps = 6/94 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N  + W  F+  +
Sbjct  457  VCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPKIGWKTFKRQL  516

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  268
            +    H + +G   L++P  S+YT+P PDCMC +
Sbjct  517  LGMRTHGDSKG-FELKRPNDSIYTFPCPDCMCRS  549



>gb|KHN47089.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  F+  +
Sbjct  458  VCLHSEVFVTTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRRLALLFDNPNIRWEVFKQQM  517

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++++G   L+K  +SLYT+P PDCMC
Sbjct  518  KDMLRHSDQKG-TELKKAGESLYTFPMPDCMC  548



>gb|KFK43757.1| hypothetical protein AALP_AA1G168900 [Arabis alpina]
Length=557

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N  L W  F+  +
Sbjct  457  VCLHSEVFVTTQGGNFPHFLMGHRRYLFGGHSKTIRPDKRKLAILFDNPKLGWRSFKRQM  516

Query  173  I--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
            +    H++ +G   L++P+ S+Y +P PDCMC
Sbjct  517  LSMRSHSDSKG-FELKRPSDSIYIFPCPDCMC  547



>ref|XP_009390143.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=553

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF--QD  166
            V +HS++F++   GN  + M+GHR +    + KTI+PN   L  LF + N++W  F  Q 
Sbjct  442  VCLHSEVFVTTQGGNFPHFMMGHRRFLYGGHAKTIKPNKPKLAVLFQDTNISWKAFRGQL  501

Query  167  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             V+   + R+G + LRK ++S+Y++P+PDC C
Sbjct  502  EVMLDESERKGMV-LRKSSQSVYSFPSPDCAC  532



>ref|XP_006578999.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=566

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 6/92 (7%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  F+  +
Sbjct  458  VCLHSEVFVTTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRRLALLFDNPNIRWEVFKQQM  517

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  262
             +   H++++G   L+K  +SLYT+P PDCMC
Sbjct  518  KDMLRHSDQKG-TELKKAGESLYTFPMPDCMC  548



>ref|NP_001132122.1| uncharacterized protein LOC100193539 [Zea mays]
 gb|ACF80826.1| unknown [Zea mays]
Length=313

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 57/93 (61%), Gaps = 6/93 (6%)
 Frame = +2

Query  2    VGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  172
            V +HS++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ W +F+  +
Sbjct  217  VCVHSEVFVTTQGGNFPHFLMGHRRYMFGGNAKTIKPDKRKLVLSFDDPNIRWDQFKQNM  276

Query  173  IE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  265
             E   H++ +  I LRKP  S+YT+P PDCMC 
Sbjct  277  QEILQHSDMRS-IALRKPNDSVYTFPMPDCMCK  308



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800