BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN042G21

Length=305
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS59611.1|  pyruvate kinase, cytosolic isozyme                      148   8e-40   Genlisea aurea
ref|XP_009757909.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      146   3e-39   Nicotiana sylvestris
ref|XP_006356872.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    146   4e-39   Solanum tuberosum [potatoes]
ref|XP_011089747.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate kin...    145   1e-38   Sesamum indicum [beniseed]
ref|XP_007157825.1|  hypothetical protein PHAVU_002G101300g             145   1e-38   Phaseolus vulgaris [French bean]
ref|XP_009339208.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      144   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_008220908.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      144   2e-38   Prunus mume [ume]
ref|XP_010536812.1|  PREDICTED: probable pyruvate kinase, cytosol...    144   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_008366126.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      144   2e-38   
ref|XP_008358829.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      144   2e-38   
ref|XP_006401343.1|  hypothetical protein EUTSA_v10013331mg             144   2e-38   Eutrema salsugineum [saltwater cress]
ref|XP_010443292.1|  PREDICTED: probable pyruvate kinase, cytosol...    144   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010451061.1|  PREDICTED: probable pyruvate kinase, cytosol...    144   2e-38   
ref|XP_010921331.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      144   2e-38   Elaeis guineensis
ref|XP_009602713.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      144   3e-38   Nicotiana tomentosiformis
sp|Q42954.1|KPYC_TOBAC  RecName: Full=Pyruvate kinase, cytosolic ...    144   3e-38   Nicotiana tabacum [American tobacco]
ref|XP_006280237.1|  hypothetical protein CARUB_v10026152mg             144   4e-38   
ref|XP_004294938.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      143   5e-38   Fragaria vesca subsp. vesca
ref|XP_003529451.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    143   5e-38   Glycine max [soybeans]
ref|NP_001236431.1|  pyruvate kinase                                    143   5e-38   Glycine max [soybeans]
ref|XP_004505347.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    143   6e-38   Cicer arietinum [garbanzo]
ref|XP_007207417.1|  hypothetical protein PRUPE_ppa004703mg             143   6e-38   Prunus persica
gb|KFK27186.1|  hypothetical protein AALP_AA8G347400                    143   7e-38   Arabis alpina [alpine rockcress]
gb|AFK41735.1|  unknown                                                 142   8e-38   Medicago truncatula
ref|XP_003607827.1|  Pyruvate kinase                                    142   1e-37   
ref|XP_006445557.1|  hypothetical protein CICLE_v10014977mg             142   1e-37   Citrus clementina [clementine]
gb|ACJ85596.1|  unknown                                                 142   1e-37   Medicago truncatula
ref|XP_002299092.2|  pyruvate kinase family protein                     142   1e-37   Populus trichocarpa [western balsam poplar]
ref|XP_003625586.1|  Pyruvate kinase                                    142   1e-37   Medicago truncatula
ref|XP_010276427.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      142   1e-37   Nelumbo nucifera [Indian lotus]
gb|ACJ85597.1|  unknown                                                 142   1e-37   Medicago truncatula
ref|XP_008792548.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    142   1e-37   Phoenix dactylifera
gb|EYU32822.1|  hypothetical protein MIMGU_mgv1a004734mg                142   1e-37   Erythranthe guttata [common monkey flower]
gb|KDP21048.1|  hypothetical protein JCGZ_21519                         142   1e-37   Jatropha curcas
ref|XP_004149636.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    142   1e-37   Cucumis sativus [cucumbers]
ref|XP_008449903.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      142   2e-37   Cucumis melo [Oriental melon]
ref|NP_200446.1|  pyruvate kinase                                       142   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376168.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      142   2e-37   Pyrus x bretschneideri [bai li]
ref|XP_006829825.1|  hypothetical protein AMTR_s00119p00089160          142   2e-37   Amborella trichopoda
ref|XP_010521454.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    142   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_008781216.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      141   2e-37   Phoenix dactylifera
emb|CDY11933.1|  BnaC03g13590D                                          140   2e-37   Brassica napus [oilseed rape]
ref|XP_002448775.1|  hypothetical protein SORBIDRAFT_06g032940          141   3e-37   Sorghum bicolor [broomcorn]
ref|XP_010923031.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    141   3e-37   Elaeis guineensis
ref|XP_004505349.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    141   3e-37   Cicer arietinum [garbanzo]
gb|KHN20509.1|  Pyruvate kinase, cytosolic isozyme                      141   3e-37   Glycine soja [wild soybean]
ref|XP_010938149.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    141   3e-37   Elaeis guineensis
ref|XP_002523396.1|  pyruvate kinase, putative                          140   4e-37   Ricinus communis
gb|KHG16228.1|  Pyruvate kinase, cytosolic isozyme                      140   5e-37   Gossypium arboreum [tree cotton]
gb|KJB31911.1|  hypothetical protein B456_005G214000                    140   5e-37   Gossypium raimondii
ref|XP_008351255.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      140   5e-37   
gb|KHG28967.1|  Pyruvate kinase, cytosolic isozyme                      140   5e-37   Gossypium arboreum [tree cotton]
ref|XP_004960072.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    140   6e-37   Setaria italica
ref|XP_008793321.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      140   7e-37   Phoenix dactylifera
ref|XP_010248420.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    140   7e-37   Nelumbo nucifera [Indian lotus]
ref|XP_004228967.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      139   9e-37   Solanum lycopersicum
ref|XP_010032839.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      139   1e-36   Eucalyptus grandis [rose gum]
ref|XP_010539372.1|  PREDICTED: probable pyruvate kinase, cytosol...    139   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_009132308.1|  PREDICTED: LOW QUALITY PROTEIN: probable pyr...    139   1e-36   
gb|AIZ68206.1|  Pyruvate kinase, cytosolic isozyme isoform 1            139   1e-36   Ornithogalum longebracteatum [sea-onion]
emb|CDX81194.1|  BnaC09g06050D                                          134   1e-36   
ref|XP_011048153.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    139   1e-36   Populus euphratica
ref|NP_001149825.1|  pyruvate kinase, cytosolic isozyme                 139   1e-36   Zea mays [maize]
gb|ACR35425.1|  unknown                                                 139   1e-36   Zea mays [maize]
ref|NP_001150269.1|  pyruvate kinase, cytosolic isozyme                 139   1e-36   
emb|CBI35347.3|  unnamed protein product                                139   2e-36   Vitis vinifera
ref|XP_006653027.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    139   2e-36   Oryza brachyantha
ref|NP_001054265.1|  Os04g0677500                                       139   2e-36   
ref|XP_010438767.1|  PREDICTED: probable pyruvate kinase, cytosol...    139   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010433512.1|  PREDICTED: probable pyruvate kinase, cytosol...    139   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010105293.1|  Pyruvate kinase, cytosolic isozyme                 139   2e-36   Morus notabilis
emb|CDY46578.1|  BnaCnng14000D                                          138   2e-36   Brassica napus [oilseed rape]
ref|XP_003580822.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      139   2e-36   Brachypodium distachyon [annual false brome]
gb|AES90025.2|  pyruvate kinase family protein                          139   2e-36   Medicago truncatula
ref|XP_003607828.1|  Pyruvate kinase                                    139   2e-36   
ref|XP_002270400.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      139   2e-36   Vitis vinifera
ref|XP_008800432.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      139   2e-36   Phoenix dactylifera
ref|XP_010257721.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      138   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004308255.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    138   3e-36   Fragaria vesca subsp. vesca
ref|XP_008661999.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    139   3e-36   
ref|XP_010549615.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      138   4e-36   Tarenaya hassleriana [spider flower]
ref|XP_009120154.1|  PREDICTED: probable pyruvate kinase, cytosol...    138   4e-36   Brassica rapa
ref|XP_009402438.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    138   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420246.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      137   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006286182.1|  hypothetical protein CARUB_v10007746mg             137   5e-36   Capsella rubella
gb|KHG14965.1|  Pyruvate kinase, cytosolic isozyme                      137   5e-36   Gossypium arboreum [tree cotton]
emb|CDY60038.1|  BnaA09g52300D                                          133   5e-36   Brassica napus [oilseed rape]
gb|AIS24261.1|  cytosolic pyruvate kinase 1                             137   6e-36   Gossypium hirsutum [American cotton]
ref|XP_010427376.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    137   6e-36   Camelina sativa [gold-of-pleasure]
gb|KDP40458.1|  hypothetical protein JCGZ_24457                         137   7e-36   Jatropha curcas
ref|XP_007043166.1|  Pyruvate kinase family protein isoform 1           137   7e-36   
dbj|BAJ85672.1|  predicted protein                                      137   7e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010940385.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      137   8e-36   Elaeis guineensis
ref|XP_010935595.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    137   9e-36   
ref|XP_010918024.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      137   1e-35   Elaeis guineensis
gb|ABR18162.1|  unknown                                                 137   1e-35   Picea sitchensis
emb|CDY21551.1|  BnaC09g47410D                                          137   1e-35   Brassica napus [oilseed rape]
gb|ABR16411.1|  unknown                                                 137   1e-35   Picea sitchensis
ref|XP_009122472.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      136   1e-35   Brassica rapa
emb|CDX69938.1|  BnaA10g22870D                                          136   1e-35   
ref|XP_006394248.1|  hypothetical protein EUTSA_v10004034mg             136   1e-35   Eutrema salsugineum [saltwater cress]
emb|CDY41529.1|  BnaA06g22820D                                          136   2e-35   Brassica napus [oilseed rape]
ref|NP_194369.1|  probable pyruvate kinase                              136   2e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150421.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    136   2e-35   Brassica rapa
ref|XP_008778170.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      136   2e-35   Phoenix dactylifera
ref|XP_010274948.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    135   2e-35   
ref|XP_010274945.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    136   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_009612061.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      135   2e-35   
ref|XP_003567112.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    135   2e-35   Brachypodium distachyon [annual false brome]
gb|AFK43671.1|  unknown                                                 135   2e-35   Lotus japonicus
ref|XP_010448281.1|  PREDICTED: probable pyruvate kinase, cytosol...    135   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010507467.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    131   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007014033.1|  Pyruvate kinase family protein isoform 1           135   3e-35   
emb|CDY39852.1|  BnaC02g42660D                                          135   3e-35   Brassica napus [oilseed rape]
ref|XP_009385981.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    135   3e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB20555.1|  hypothetical protein B456_003G154200                    135   3e-35   Gossypium raimondii
ref|XP_010546281.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      135   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_007014034.1|  Pyruvate kinase family protein isoform 2           133   4e-35   
ref|XP_002285763.2|  PREDICTED: pyruvate kinase, cytosolic isozyme      135   4e-35   Vitis vinifera
ref|XP_010103561.1|  Pyruvate kinase, cytosolic isozyme                 135   5e-35   
ref|XP_004147096.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    135   5e-35   Cucumis sativus [cucumbers]
ref|XP_008445909.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      135   5e-35   Cucumis melo [Oriental melon]
ref|XP_009418646.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      135   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO43103.1|  hypothetical protein CISIN_1g0123352mg                  132   6e-35   Citrus sinensis [apfelsine]
ref|XP_008802624.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      134   6e-35   Phoenix dactylifera
gb|AAZ86534.1|  pyruvate kinase                                         134   6e-35   Capsicum annuum
ref|XP_002266160.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      134   7e-35   Vitis vinifera
emb|CAQ58629.1|  pyruvate kinase                                        134   7e-35   Vitis vinifera
gb|KFK28069.1|  pyruvate kinase                                         134   7e-35   Arabis alpina [alpine rockcress]
ref|XP_009411188.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    135   7e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010274940.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      134   7e-35   Nelumbo nucifera [Indian lotus]
ref|XP_009785561.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      134   7e-35   Nicotiana sylvestris
ref|XP_009112104.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    134   7e-35   Brassica rapa
dbj|BAJ93484.1|  predicted protein                                      134   8e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009383729.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    134   8e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001042731.1|  Os01g0276700                                       134   8e-35   
ref|XP_008340410.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      134   9e-35   
ref|XP_009351777.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      134   9e-35   Pyrus x bretschneideri [bai li]
gb|KJB23443.1|  hypothetical protein B456_004G098000                    134   1e-34   Gossypium raimondii
ref|XP_009392838.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    134   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010248392.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      134   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006448503.1|  hypothetical protein CICLE_v10014963mg             134   1e-34   Citrus clementina [clementine]
gb|KHG23023.1|  Pyruvate kinase, cytosolic isozyme                      134   1e-34   Gossypium arboreum [tree cotton]
ref|NP_001275820.1|  pyruvate kinase                                    134   1e-34   Citrus sinensis [apfelsine]
ref|XP_004236881.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      134   1e-34   Solanum lycopersicum
ref|XP_006468679.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    134   1e-34   
ref|XP_006287542.1|  hypothetical protein CARUB_v10000751mg             134   1e-34   Capsella rubella
ref|XP_011046575.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      134   1e-34   Populus euphratica
ref|XP_006647265.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    134   1e-34   Oryza brachyantha
ref|XP_009351354.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    133   1e-34   Pyrus x bretschneideri [bai li]
gb|EMT31952.1|  Pyruvate kinase, cytosolic isozyme                      133   2e-34   
ref|XP_006399365.1|  hypothetical protein EUTSA_v10013288mg             133   2e-34   Eutrema salsugineum [saltwater cress]
ref|XP_010031356.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      133   2e-34   Eucalyptus grandis [rose gum]
ref|XP_010427378.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    133   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009775114.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      133   2e-34   Nicotiana sylvestris
ref|XP_002304847.2|  pyruvate kinase family protein                     133   2e-34   
ref|XP_009131089.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    133   2e-34   Brassica rapa
gb|KJB80843.1|  hypothetical protein B456_013G117600                    133   2e-34   Gossypium raimondii
emb|CDX78344.1|  BnaA03g02560D                                          133   2e-34   
emb|CDX81114.1|  BnaC03g03680D                                          133   2e-34   
ref|XP_006848640.1|  hypothetical protein AMTR_s00171p00048400          133   2e-34   Amborella trichopoda
ref|NP_001236056.1|  pyruvate kinase                                    133   2e-34   Glycine max [soybeans]
ref|XP_006378878.1|  hypothetical protein POPTR_0010s26150g             133   2e-34   
ref|XP_008226194.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    133   2e-34   
ref|XP_007212555.1|  hypothetical protein PRUPE_ppa015432mg             133   2e-34   Prunus persica
gb|KFK37840.1|  hypothetical protein AALP_AA3G036000                    133   2e-34   Arabis alpina [alpine rockcress]
ref|XP_006603614.1|  PREDICTED: pyruvate kinase isoform X1              133   2e-34   Glycine max [soybeans]
ref|NP_001237968.1|  pyruvate kinase, cytosolic isozyme                 133   3e-34   Glycine max [soybeans]
gb|AAM94348.1|  pyruvate kinase                                         133   3e-34   Glycine max [soybeans]
ref|XP_006644058.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    133   3e-34   Oryza brachyantha
ref|XP_010504451.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    132   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004162031.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate kin...    132   3e-34   
ref|XP_006280327.1|  hypothetical protein CARUB_v10026251mg             132   3e-34   Capsella rubella
ref|XP_006479069.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    132   3e-34   Citrus sinensis [apfelsine]
ref|XP_010680471.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    132   3e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|ADZ96382.2|  pyruvate kinase                                         132   3e-34   Eriobotrya japonica [loquat]
ref|NP_201173.1|  pyruvate kinase                                       132   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KFK36990.1|  hypothetical protein AALP_AA4G198100                    132   3e-34   Arabis alpina [alpine rockcress]
ref|XP_002878046.1|  predicted protein                                  132   3e-34   
dbj|BAF01483.1|  pyruvate kinase                                        132   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869613.1|  hypothetical protein ARALYDRAFT_329043             132   3e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_010427343.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    132   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_011025111.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      132   4e-34   Populus euphratica
emb|CDY27175.1|  BnaA09g36270D                                          132   4e-34   Brassica napus [oilseed rape]
gb|EPS70224.1|  pyruvate kinase                                         132   4e-34   Genlisea aurea
ref|NP_001275085.1|  pyruvate kinase, cytosolic isozyme                 132   4e-34   Solanum tuberosum [potatoes]
gb|AAA13372.2|  cytosolic pyruvate kinase                               132   4e-34   Solanum tuberosum [potatoes]
ref|XP_007150867.1|  hypothetical protein PHAVU_004G000800g             132   4e-34   Phaseolus vulgaris [French bean]
gb|EEC70399.1|  hypothetical protein OsI_01382                          132   5e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_008383188.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    132   5e-34   
ref|XP_010423047.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      132   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_002513157.1|  pyruvate kinase, putative                          132   6e-34   
ref|XP_002864862.1|  hypothetical protein ARALYDRAFT_919664             132   6e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_010491502.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    132   7e-34   Camelina sativa [gold-of-pleasure]
emb|CDP16888.1|  unnamed protein product                                132   7e-34   Coffea canephora [robusta coffee]
ref|NP_189225.1|  pyruvate kinase                                       131   8e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004489183.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    131   9e-34   Cicer arietinum [garbanzo]
ref|XP_002876321.1|  predicted protein                                  131   9e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_011033100.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    131   1e-33   Populus euphratica
ref|XP_002310914.1|  pyruvate kinase family protein                     131   1e-33   Populus trichocarpa [western balsam poplar]
emb|CDM82952.1|  unnamed protein product                                131   1e-33   Triticum aestivum [Canadian hard winter wheat]
gb|KHG01431.1|  Pyruvate kinase, cytosolic isozyme                      131   1e-33   Gossypium arboreum [tree cotton]
gb|KDP20274.1|  hypothetical protein JCGZ_06860                         131   1e-33   Jatropha curcas
ref|XP_002525455.1|  pyruvate kinase, putative                          131   1e-33   Ricinus communis
ref|XP_009413101.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    131   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002457647.1|  hypothetical protein SORBIDRAFT_03g011130          131   1e-33   Sorghum bicolor [broomcorn]
ref|XP_010444284.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    131   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010427374.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    130   1e-33   Camelina sativa [gold-of-pleasure]
gb|KFK34626.1|  hypothetical protein AALP_AA5G170500                    130   1e-33   Arabis alpina [alpine rockcress]
ref|NP_196474.1|  pyruvate kinase                                       130   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444283.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    130   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002871348.1|  hypothetical protein ARALYDRAFT_487699             130   2e-33   
ref|XP_010485774.1|  PREDICTED: probable pyruvate kinase, cytosol...    130   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008227713.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      130   2e-33   Prunus mume [ume]
gb|AGI60277.1|  pyruvate kinase                                         130   2e-33   Dendrobium officinale
ref|XP_006299321.1|  hypothetical protein CARUB_v10015478mg             130   2e-33   Capsella rubella
gb|EMT02217.1|  Pyruvate kinase, cytosolic isozyme                      130   2e-33   
gb|AFJ25032.1|  pyruvate kinase                                         130   2e-33   Lonicera japonica [Japanese honeysuckle]
gb|AAF44707.1|  cytosolic pyruvate kinase                               130   3e-33   Lilium longiflorum [Easter lily]
ref|XP_010463877.1|  PREDICTED: probable pyruvate kinase, cytosol...    130   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002992085.1|  hypothetical protein SELMODRAFT_134716             130   3e-33   Selaginella moellendorffii
ref|XP_007213928.1|  hypothetical protein PRUPE_ppa004434mg             130   3e-33   Prunus persica
gb|KEH24719.1|  pyruvate kinase family protein                          130   3e-33   Medicago truncatula
ref|XP_002982445.1|  hypothetical protein SELMODRAFT_116243             130   3e-33   Selaginella moellendorffii
ref|XP_008389051.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    129   4e-33   
ref|XP_008350807.1|  PREDICTED: LOW QUALITY PROTEIN: pyruvate kin...    129   4e-33   
ref|XP_002882328.1|  hypothetical protein ARALYDRAFT_340564             129   5e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_010516169.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    129   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004297699.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      129   5e-33   Fragaria vesca subsp. vesca
ref|XP_007030173.1|  Pyruvate kinase family protein                     129   5e-33   
gb|EMS59451.1|  Pyruvate kinase, cytosolic isozyme                      129   6e-33   Triticum urartu
ref|XP_010484121.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    129   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010460879.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    129   7e-33   
ref|XP_006651336.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    129   7e-33   Oryza brachyantha
ref|NP_187055.1|  pyruvate kinase                                       129   7e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KIZ06088.1|  pyruvate kinase                                         129   9e-33   Monoraphidium neglectum
gb|KJB83398.1|  hypothetical protein B456_013G245400                    128   9e-33   Gossypium raimondii
gb|ACN34281.1|  unknown                                                 128   9e-33   Zea mays [maize]
ref|NP_001105266.1|  PK protein                                         128   1e-32   
gb|ACG32257.1|  pyruvate kinase, cytosolic isozyme                      128   1e-32   Zea mays [maize]
ref|XP_010669400.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      128   1e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009134750.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    128   1e-32   Brassica rapa
ref|XP_002282379.2|  PREDICTED: pyruvate kinase, cytosolic isozyme      128   1e-32   Vitis vinifera
ref|XP_007512297.1|  predicted protein                                  128   1e-32   Bathycoccus prasinos
emb|CAN70030.1|  hypothetical protein VITISV_031893                     128   1e-32   Vitis vinifera
ref|NP_191124.1|  pyruvate kinase                                       128   2e-32   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK04454.1|  predicted protein                                      127   2e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007151826.1|  hypothetical protein PHAVU_004G078400g             127   3e-32   Phaseolus vulgaris [French bean]
ref|XP_004971545.1|  PREDICTED: uncharacterized protein LOC101758684    130   3e-32   
ref|XP_009102101.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    127   3e-32   Brassica rapa
ref|XP_002465336.1|  hypothetical protein SORBIDRAFT_01g036690          127   3e-32   Sorghum bicolor [broomcorn]
emb|CDY66490.1|  BnaA01g37400D                                          127   4e-32   Brassica napus [oilseed rape]
emb|CDY66977.1|  BnaCnng52980D                                          126   4e-32   Brassica napus [oilseed rape]
ref|XP_011011685.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    126   4e-32   Populus euphratica
ref|XP_009405246.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    122   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002325825.2|  pyruvate kinase family protein                     126   5e-32   
ref|XP_004984522.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    126   5e-32   Setaria italica
gb|KHN32750.1|  Pyruvate kinase, cytosolic isozyme                      126   7e-32   Glycine soja [wild soybean]
emb|CDY50878.1|  BnaA05g37390D                                          125   8e-32   Brassica napus [oilseed rape]
ref|XP_003548937.2|  PREDICTED: pyruvate kinase, cytosolic isozym...    126   8e-32   Glycine max [soybeans]
ref|XP_006408228.1|  hypothetical protein EUTSA_v10022029mg             125   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_011034341.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    125   2e-31   Populus euphratica
ref|XP_009130417.1|  PREDICTED: pyruvate kinase, cytosolic isozyme      125   2e-31   Brassica rapa
ref|XP_003558007.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    124   2e-31   Brachypodium distachyon [annual false brome]
gb|EMT14971.1|  Pyruvate kinase, cytosolic isozyme                      124   5e-31   
gb|EMS48677.1|  Pyruvate kinase, cytosolic isozyme                      123   6e-31   Triticum urartu
ref|XP_009412990.1|  PREDICTED: pyruvate kinase, cytosolic isozym...    122   1e-30   
ref|XP_002983872.1|  hypothetical protein SELMODRAFT_180610             122   2e-30   
ref|XP_002319173.1|  pyruvate kinase family protein                     122   2e-30   
ref|XP_007512323.1|  predicted protein                                  122   2e-30   Bathycoccus prasinos
ref|XP_005645329.1|  pyruvate kinase                                    121   3e-30   Coccomyxa subellipsoidea C-169
ref|XP_001767090.1|  predicted protein                                  121   4e-30   
ref|XP_002960796.1|  hypothetical protein SELMODRAFT_139314             120   6e-30   
ref|XP_001693008.1|  pyruvate kinase                                    120   1e-29   Chlamydomonas reinhardtii
gb|KJB79787.1|  hypothetical protein B456_013G066700                    119   2e-29   Gossypium raimondii
emb|CDY04408.1|  BnaC02g28400D                                          112   2e-29   
emb|CDY47408.1|  BnaCnng15170D                                          110   9e-29   Brassica napus [oilseed rape]
ref|XP_001784162.1|  predicted protein                                  116   2e-28   
ref|XP_001767106.1|  predicted protein                                  116   3e-28   
ref|XP_002980394.1|  hypothetical protein SELMODRAFT_112650             115   6e-28   
ref|XP_002502746.1|  cytosolic pyruvate kinase                          115   6e-28   
ref|XP_002503101.1|  cytosolic pyruvate kinase                          115   9e-28   
emb|CDY42677.1|  BnaC04g22290D                                          108   1e-27   
ref|XP_001770322.1|  predicted protein                                  114   1e-27   
emb|CDY26450.1|  BnaC09g42180D                                          107   1e-27   
emb|CEG00276.1|  Pyruvate kinase, barrel                                114   3e-27   
emb|CEG00282.1|  Pyruvate kinase, barrel                                114   3e-27   
ref|XP_003055372.1|  predicted protein                                  113   3e-27   
ref|XP_007510967.1|  predicted protein                                  113   4e-27   
gb|ADD52598.1|  pyruvate kinase                                         113   5e-27   
ref|XP_001421558.1|  predicted protein                                  113   5e-27   
gb|KFK34829.1|  hypothetical protein AALP_AA5G198600                    113   5e-27   
ref|XP_003083503.1|  KPYC_SOLTU Pyruvate kinase, cytosolic isozym...    113   9e-27   
ref|XP_007508334.1|  predicted protein                                  113   1e-26   
ref|XP_001421695.1|  predicted protein                                  112   1e-26   
ref|XP_002957811.1|  cytosolic pyruvate kinase                          111   2e-26   
ref|XP_001775912.1|  predicted protein                                  111   2e-26   
ref|XP_002962699.1|  hypothetical protein SELMODRAFT_404685             110   2e-26   
ref|XP_003060853.1|  predicted protein                                  108   2e-25   
gb|KDD76665.1|  pyruvate kinase                                         110   2e-25   
ref|XP_003057955.1|  predicted protein                                  109   3e-25   
ref|XP_003061116.1|  predicted protein                                  108   3e-25   
ref|XP_002501554.1|  cytosolic pyruvate kinase                          107   8e-25   
ref|XP_002507623.1|  cytosolic pyruvate kinase                          104   7e-24   
ref|XP_002500945.1|  pyruvate kinase                                    104   8e-24   
gb|KJB73269.1|  hypothetical protein B456_011G224700                  97.1    1e-23   
ref|XP_006443367.1|  hypothetical protein CICLE_v10019997mg             100   1e-22   
emb|CDY00607.1|  BnaC04g23180D                                        97.8    5e-22   
ref|XP_007512361.1|  pyruvate kinase                                  98.2    2e-21   
gb|KJB32376.1|  hypothetical protein B456_005G237900                  91.3    2e-21   
ref|XP_011399767.1|  Pyruvate kinase, cytosolic isozyme               97.1    4e-21   
gb|EYU40742.1|  hypothetical protein MIMGU_mgv1a025703mg              95.1    1e-20   
ref|WP_027895304.1|  hypothetical protein                             91.7    1e-20   
ref|XP_001694900.1|  pyruvate kinase                                  95.5    1e-20   
ref|WP_026805076.1|  MULTISPECIES: pyruvate kinase                    95.1    1e-20   
ref|XP_003518039.2|  PREDICTED: pyruvate kinase, cytosolic isozym...  90.9    2e-20   
sp|Q04668.1|KPYK_LEIBR  RecName: Full=Pyruvate kinase; Short=PK       89.0    2e-20   
ref|WP_023391987.1|  pyruvate kinase                                  94.7    3e-20   
ref|WP_003261192.1|  pyruvate kinase                                  89.4    7e-20   
ref|XP_002907650.1|  pyruvate kinase                                  94.0    7e-20   
ref|WP_008880860.1|  MULTISPECIES: pyruvate kinase                    93.6    1e-19   
ref|WP_018394146.1|  pyruvate kinase                                  93.2    1e-19   
ref|XP_001568122.1|  putative pyruvate kinase                         90.1    1e-19   
ref|WP_034286311.1|  pyruvate kinase                                  93.2    1e-19   
ref|XP_010269337.1|  PREDICTED: probable pyruvate kinase, cytosol...  92.8    1e-19   
ref|WP_022329388.1|  pyruvate kinase                                  92.4    1e-19   
gb|KCW87041.1|  hypothetical protein EUGRSUZ_B03586                   92.4    1e-19   
ref|WP_020310356.1|  pyruvate kinase                                  92.4    1e-19   
ref|XP_005820147.1|  hypothetical protein GUITHDRAFT_98395            92.4    1e-19   
ref|WP_024774589.1|  pyruvate kinase                                  92.4    2e-19   
gb|EJK46402.1|  hypothetical protein THAOC_34937                      92.4    2e-19   
gb|AIT70015.1|  pyruvate kinase                                       92.4    2e-19   
ref|WP_020723764.1|  pyruvate kinase                                  92.4    2e-19   
ref|XP_007256960.1|  PREDICTED: pyruvate kinase PKM-like isoform X2   92.4    2e-19   
ref|XP_002501457.1|  predicted protein                                92.4    2e-19   
ref|XP_007256959.1|  PREDICTED: pyruvate kinase PKM-like isoform X1   92.4    2e-19   
ref|XP_008897335.1|  pyruvate kinase, variant 2                       92.0    2e-19   
ref|WP_036202961.1|  pyruvate kinase                                  92.4    2e-19   
ref|WP_014016291.1|  pyruvate kinase                                  92.4    2e-19   
ref|WP_036204844.1|  pyruvate kinase                                  92.4    2e-19   
ref|WP_014015593.1|  pyruvate kinase                                  92.4    2e-19   
ref|WP_033656966.1|  pyruvate kinase                                  89.0    2e-19   
ref|WP_024534230.1|  pyruvate kinase                                  92.4    3e-19   
ref|XP_001507421.1|  PREDICTED: pyruvate kinase PKM                   89.7    3e-19   
ref|WP_034424334.1|  pyruvate kinase                                  92.0    3e-19   
ref|XP_008897333.1|  pyruvate kinase                                  92.0    3e-19   
ref|WP_009381286.1|  pyruvate kinase                                  92.0    3e-19   
ref|WP_020756492.1|  Pyruvate kinase                                  89.0    3e-19   
ref|XP_001769376.1|  predicted protein                                91.7    3e-19   
dbj|GAM28678.1|  hypothetical protein SAMD00019534_118540             91.3    4e-19   
ref|WP_014473109.1|  pyruvate kinase                                  91.3    4e-19   
ref|WP_022291771.1|  pyruvate kinase                                  91.3    4e-19   
ref|XP_001468819.1|  pyruvate kinase, putative                        87.4    4e-19   
ref|XP_007550013.1|  PREDICTED: pyruvate kinase PKLR-like isoform X2  91.3    4e-19   
ref|WP_020847279.1|  pyruvate kinase I                                91.3    4e-19   
ref|WP_014468082.1|  pyruvate kinase                                  91.3    4e-19   
ref|XP_002954743.1|  pyruvate kinase                                  91.3    5e-19   
ref|XP_007550012.1|  PREDICTED: pyruvate kinase PKM-like isoform X1   91.3    5e-19   
ref|XP_008321413.1|  PREDICTED: pyruvate kinase PKM-like              91.3    5e-19   
ref|XP_003879007.1|  pyruvate kinase                                  89.0    5e-19   
ref|XP_005839500.1|  hypothetical protein GUITHDRAFT_101689           91.3    5e-19   
ref|WP_044158543.1|  pyruvate kinase                                  91.3    5e-19   
ref|XP_005810339.1|  PREDICTED: pyruvate kinase PKLR-like             90.9    5e-19   
ref|WP_020724125.1|  pyruvate kinase                                  90.9    6e-19   
ref|WP_020311777.1|  pyruvate kinase                                  91.3    6e-19   
ref|WP_031897433.1|  pyruvate kinase                                  87.8    6e-19   
ref|XP_008290457.1|  PREDICTED: pyruvate kinase PKM-like              90.9    6e-19   
ref|WP_004510313.1|  pyruvate kinase                                  90.5    6e-19   
ref|WP_012012117.1|  pyruvate kinase                                  90.5    6e-19   
ref|XP_003792697.1|  PREDICTED: pyruvate kinase isozyme M1-like       87.8    7e-19   
ref|XP_005795892.1|  PREDICTED: pyruvate kinase PKM-like isoform X1   90.9    7e-19   
ref|WP_001232646.1|  hypothetical protein                             87.8    7e-19   
gb|EKD27563.1|  hypothetical protein ACD_79C00673G0001                90.9    7e-19   
emb|CAF97878.1|  unnamed protein product                              90.9    7e-19   
dbj|BAE33370.1|  unnamed protein product                              89.4    7e-19   
ref|WP_040047679.1|  pyruvate kinase                                  90.9    8e-19   
ref|WP_039234245.1|  pyruvate kinase                                  90.9    8e-19   
ref|WP_040037028.1|  pyruvate kinase                                  90.9    8e-19   
ref|WP_003387999.1|  pyruvate kinase                                  90.9    9e-19   
gb|AIT70023.1|  pyruvate kinase                                       90.5    9e-19   
gb|ETL27744.1|  pyruvate kinase, variant 2                            90.5    9e-19   
ref|WP_007391608.1|  pyruvate kinase                                  90.9    9e-19   
ref|XP_002289867.1|  pyruvate kinase                                  90.5    9e-19   
gb|AIT70028.1|  pyruvate kinase                                       90.1    9e-19   
ref|WP_041511958.1|  pyruvate kinase                                  88.6    1e-18   
ref|WP_031907662.1|  pyruvate kinase                                  88.2    1e-18   
ref|WP_033887772.1|  pyruvate kinase                                  87.8    1e-18   
gb|EPS57680.1|  pyruvate kinase                                       87.4    1e-18   
ref|WP_003355619.1|  pyruvate kinase                                  90.5    1e-18   
ref|XP_005704120.1|  pyruvate kinase                                  90.1    1e-18   
ref|XP_002529161.1|  pyruvate kinase, putative                        90.1    1e-18   
ref|XP_009517143.1|  pyruvate kinase                                  90.5    1e-18   
gb|ETL27742.1|  pyruvate kinase                                       90.5    1e-18   
ref|WP_026803098.1|  pyruvate kinase                                  89.7    1e-18   
gb|AFS19738.1|  pyruvate kinase                                       88.2    1e-18   
gb|AIT70047.1|  pyruvate kinase                                       90.1    1e-18   
ref|WP_026807278.1|  MULTISPECIES: pyruvate kinase                    89.7    1e-18   
ref|WP_035427896.1|  pyruvate kinase                                  89.7    1e-18   
ref|WP_035432415.1|  MULTISPECIES: pyruvate kinase                    89.7    1e-18   
ref|WP_012809125.1|  pyruvate kinase                                  89.7    1e-18   
ref|XP_010702429.1|  pyruvate kinase, putative                        89.7    1e-18   
ref|XP_003722400.1|  pyruvate kinase                                  89.7    1e-18   
ref|XP_011305626.1|  PREDICTED: pyruvate kinase-like isoform X2       89.7    1e-18   
gb|KHF28820.1|  Pyruvate kinase                                       87.0    1e-18   
ref|XP_008467042.1|  PREDICTED: pyruvate kinase, cytosolic isozym...  84.3    1e-18   
ref|WP_041097749.1|  pyruvate kinase                                  90.1    1e-18   
gb|AAX92739.1|  Pyruvate kinase, barrel domain                        87.4    1e-18   
gb|ACN11437.1|  Pyruvate kinase muscle isozyme                        89.7    2e-18   
ref|WP_033541904.1|  pyruvate kinase                                  90.1    2e-18   
emb|CAA40994.1|  pyruvate kinase                                      89.4    2e-18   
ref|XP_005472679.1|  PREDICTED: pyruvate kinase PKM isoform X2        89.7    2e-18   
ref|WP_044743527.1|  pyruvate kinase                                  89.7    2e-18   
ref|XP_003879008.1|  putative pyruvate kinase                         89.4    2e-18   
ref|XP_005472678.1|  PREDICTED: pyruvate kinase PKM isoform X1        89.7    2e-18   
ref|XP_001754215.1|  predicted protein                                89.4    2e-18   
ref|WP_015375589.1|  pyruvate kinase                                  89.7    2e-18   
ref|WP_033008553.1|  pyruvate kinase                                  89.7    2e-18   
ref|WP_033014443.1|  pyruvate kinase                                  89.7    2e-18   
ref|XP_006888458.1|  PREDICTED: pyruvate kinase PKM                   89.0    2e-18   
ref|XP_007467899.1|  PREDICTED: pyruvate kinase PKM isoform X5        89.4    2e-18   
ref|NP_001240812.1|  pyruvate kinase PKM isoform M1                   89.4    2e-18   
ref|WP_033844304.1|  pyruvate kinase                                  89.7    2e-18   
ref|WP_026465347.1|  pyruvate kinase                                  89.7    2e-18   
ref|XP_008429853.1|  PREDICTED: pyruvate kinase PKLR-like isoform X2  89.4    2e-18   
ref|XP_008429852.1|  PREDICTED: pyruvate kinase PKM-like isoform X1   89.4    2e-18   
ref|WP_016897610.1|  pyruvate kinase                                  89.7    2e-18   
ref|WP_034902737.1|  pyruvate kinase                                  89.0    2e-18   
ref|XP_006804895.1|  PREDICTED: pyruvate kinase PKM-like              89.4    2e-18   
ref|WP_003143452.1|  pyruvate kinase                                  89.4    2e-18   
ref|XP_006971533.1|  PREDICTED: pyruvate kinase PKM                   89.4    2e-18   
ref|WP_033019494.1|  pyruvate kinase                                  89.4    2e-18   
ref|WP_034639717.1|  pyruvate kinase                                  89.4    2e-18   
ref|XP_003056336.1|  predicted protein                                89.0    2e-18   
ref|XP_004666776.1|  PREDICTED: pyruvate kinase isozymes M1/M2 is...  89.4    2e-18   
ref|XP_004541267.1|  PREDICTED: pyruvate kinase muscle isozyme-li...  89.4    2e-18   
ref|XP_004359565.1|  pyruvate kinase                                  89.0    2e-18   
dbj|GAE30113.1|  pyruvate kinase                                      86.3    3e-18   
gb|AIT70037.1|  pyruvate kinase                                       89.0    3e-18   
ref|WP_025315592.1|  pyruvate kinase                                  89.0    3e-18   
ref|WP_034913841.1|  pyruvate kinase                                  89.0    3e-18   
ref|WP_002412067.1|  pyruvate kinase                                  84.0    3e-18   
gb|EPJ32991.1|  pyruvate kinase                                       88.2    3e-18   
ref|WP_031407710.1|  pyruvate kinase                                  89.4    3e-18   
ref|WP_013524304.1|  MULTISPECIES: pyruvate kinase                    89.4    3e-18   
ref|WP_014196527.1|  MULTISPECIES: pyruvate kinase                    89.4    3e-18   
ref|WP_013144513.1|  pyruvate kinase                                  89.4    3e-18   
gb|AJE63435.1|  pyruvate kinase                                       86.7    3e-18   
ref|WP_042379944.1|  pyruvate kinase                                  89.4    3e-18   
ref|WP_025949476.1|  pyruvate kinase                                  89.4    3e-18   
ref|WP_025039133.1|  pyruvate kinase                                  89.4    3e-18   
dbj|GAD11947.1|  pyruvate kinase                                      89.4    3e-18   
ref|XP_004541266.1|  PREDICTED: pyruvate kinase muscle isozyme-li...  89.0    3e-18   
ref|WP_011232213.1|  pyruvate kinase                                  89.4    3e-18   
ref|XP_004541265.1|  PREDICTED: pyruvate kinase muscle isozyme-li...  89.4    3e-18   
gb|EFA84845.1|  pyruvate kinase                                       89.7    3e-18   
ref|WP_044736375.1|  pyruvate kinase                                  89.4    3e-18   
ref|XP_005732109.1|  PREDICTED: pyruvate kinase PKM-like              89.0    3e-18   
ref|WP_044730594.1|  pyruvate kinase                                  89.4    3e-18   
ref|WP_040207671.1|  MULTISPECIES: pyruvate kinase                    89.4    3e-18   
gb|AAD04124.1|  pyruvate kinase                                       83.2    3e-18   
ref|WP_010024873.1|  pyruvate kinase                                  88.6    3e-18   
dbj|BAE33055.1|  unnamed protein product                              89.0    3e-18   
dbj|BAA07457.1|  pyruvate kinase M                                    89.0    3e-18   
ref|WP_031411126.1|  pyruvate kinase                                  89.0    3e-18   
dbj|BAE42199.1|  unnamed protein product                              89.0    3e-18   
ref|XP_004666775.1|  PREDICTED: pyruvate kinase isozymes M1/M2 is...  89.0    3e-18   
ref|XP_004069609.1|  PREDICTED: pyruvate kinase PKM-like              89.0    3e-18   
ref|WP_028976801.1|  pyruvate kinase                                  88.6    3e-18   
gb|ACN55076.1|  pyruvate kinase                                       88.6    3e-18   
ref|XP_007467895.1|  PREDICTED: pyruvate kinase PKM isoform X1        89.0    3e-18   
ref|WP_018671447.1|  pyruvate kinase                                  89.0    3e-18   
ref|WP_029097734.1|  pyruvate kinase                                  89.0    3e-18   
ref|WP_035300630.1|  pyruvate kinase                                  89.0    3e-18   
ref|XP_011240976.1|  PREDICTED: pyruvate kinase PKM isoform X3        89.0    3e-18   
ref|WP_035317869.1|  pyruvate kinase                                  89.0    3e-18   
ref|WP_003335242.1|  pyruvate kinase                                  89.0    3e-18   
ref|WP_026958274.1|  pyruvate kinase                                  88.6    3e-18   
ref|WP_011006632.1|  pyruvate kinase                                  88.6    3e-18   
ref|XP_003977671.1|  PREDICTED: pyruvate kinase isozymes M1/M2        89.0    3e-18   
ref|WP_034309124.1|  pyruvate kinase                                  89.0    3e-18   
ref|WP_026971463.1|  pyruvate kinase                                  88.6    4e-18   
ref|WP_023051512.1|  pyruvate kinase                                  88.6    4e-18   
emb|CEG34063.1|  pyruvate kinase                                      89.0    4e-18   
gb|EVC95283.1|  pyruvate kinase                                       88.6    4e-18   
emb|CBX25394.1|  hypothetical_protein                                 88.6    4e-18   
ref|XP_011305625.1|  PREDICTED: pyruvate kinase-like isoform X1       88.6    4e-18   
ref|XP_010276588.1|  PREDICTED: probable pyruvate kinase, cytosol...  88.6    4e-18   
dbj|GAK51188.1|  pyruvate kinase                                      89.0    4e-18   
ref|WP_015595226.1|  pyruvate kinase                                  89.0    4e-18   
ref|WP_014946788.1|  pyruvate kinase                                  88.2    4e-18   
ref|WP_006343341.1|  pyruvate kinase                                  88.2    4e-18   
gb|EGI60975.1|  Pyruvate kinase                                       88.6    4e-18   
ref|WP_041460297.1|  pyruvate kinase                                  88.2    4e-18   
ref|XP_004303046.1|  PREDICTED: pyruvate kinase, cytosolic isozym...  88.6    4e-18   
gb|AFS25322.1|  pyruvate kinase                                       88.2    4e-18   
ref|XP_002000708.1|  GI22374                                          88.6    5e-18   
ref|WP_016981592.1|  pyruvate kinase                                  88.2    5e-18   
ref|XP_005537904.1|  pyruvate kinase I                                88.2    5e-18   
ref|XP_011061836.1|  PREDICTED: pyruvate kinase-like isoform X1       88.6    5e-18   
ref|XP_005369573.1|  PREDICTED: pyruvate kinase PKM                   87.8    5e-18   



>gb|EPS59611.1| pyruvate kinase, cytosolic isozyme, partial [Genlisea aurea]
Length=498

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/75 (92%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +1

Query  79   AAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGM  258
            AA   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLR+ M
Sbjct  1    AAFAEMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRRAM  60

Query  259  ENTGILCAVMLDTKG  303
            ENTGILCAVMLDTKG
Sbjct  61   ENTGILCAVMLDTKG  75



>ref|XP_009757909.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nicotiana sylvestris]
Length=508

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +1

Query  52   MTMMSANDGA-AGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQ  228
            M + ++N+G     V RPKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH+YHQ
Sbjct  1    MAIENSNNGVNVCTVKRPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHDYHQ  60

Query  229  ETLNNLRQGMENTGILCAVMLDTKG  303
            ET++NLRQ MENTGILCAVMLDTKG
Sbjct  61   ETIDNLRQAMENTGILCAVMLDTKG  85



>ref|XP_006356872.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Solanum tuberosum]
Length=502

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  91   VMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTG  270
            V RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSH+YHQET++NLRQ MENTG
Sbjct  9    VKRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHDYHQETIDNLRQAMENTG  68

Query  271  ILCAVMLDTKG  303
            ILCAVMLDTKG
Sbjct  69   ILCAVMLDTKG  79



>ref|XP_011089747.1| PREDICTED: LOW QUALITY PROTEIN: pyruvate kinase, cytosolic isozyme 
[Sesamum indicum]
Length=502

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  91   VMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTG  270
            V RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLR+ ME+TG
Sbjct  13   VKRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRKAMESTG  72

Query  271  ILCAVMLDTKG  303
            ILCAVMLDTKG
Sbjct  73   ILCAVMLDTKG  83



>ref|XP_007157825.1| hypothetical protein PHAVU_002G101300g [Phaseolus vulgaris]
 gb|ESW29819.1| hypothetical protein PHAVU_002G101300g [Phaseolus vulgaris]
Length=501

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLR  MENTGIL
Sbjct  10   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRAAMENTGIL  69

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  70   CAVMLDTKG  78



>ref|XP_009339208.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Pyrus x bretschneideri]
Length=495

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  ME+TGIL
Sbjct  4    RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRAAMESTGIL  63

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  64   CAVMLDTKG  72



>ref|XP_008220908.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Prunus mume]
Length=495

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  ME+TGIL
Sbjct  4    RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRAAMESTGIL  63

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  64   CAVMLDTKG  72



>ref|XP_010536812.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Tarenaya 
hassleriana]
 ref|XP_010536813.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Tarenaya 
hassleriana]
Length=503

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  67   ANDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNL  246
            A  GA     RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSH YHQETL+NL
Sbjct  2    AEGGAVAMEQRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHAYHQETLDNL  61

Query  247  RQGMENTGILCAVMLDTKG  303
            RQ M NTGILCAVMLDTKG
Sbjct  62   RQAMSNTGILCAVMLDTKG  80



>ref|XP_008366126.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Malus domestica]
Length=495

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  ME+TGIL
Sbjct  4    RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRAAMESTGIL  63

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  64   CAVMLDTKG  72



>ref|XP_008358829.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Malus domestica]
Length=495

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  ME+TGIL
Sbjct  4    RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRAAMESTGIL  63

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  64   CAVMLDTKG  72



>ref|XP_006401343.1| hypothetical protein EUTSA_v10013331mg [Eutrema salsugineum]
 gb|ESQ42796.1| hypothetical protein EUTSA_v10013331mg [Eutrema salsugineum]
Length=500

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLRQ M NTGIL
Sbjct  9    RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRQAMLNTGIL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|XP_010443292.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Camelina 
sativa]
 ref|XP_010483112.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Camelina 
sativa]
Length=500

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLRQ M NTGIL
Sbjct  9    RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRQAMLNTGIL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|XP_010451061.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Camelina 
sativa]
Length=501

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLRQ M NTGIL
Sbjct  10   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRQAMLNTGIL  69

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  70   CAVMLDTKG  78



>ref|XP_010921331.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Elaeis guineensis]
Length=498

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M+NTGIL
Sbjct  7    RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRTAMDNTGIL  66

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  67   CAVMLDTKG  75



>ref|XP_009602713.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nicotiana tomentosiformis]
Length=508

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  91   VMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTG  270
            V RPKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH+YHQET++NLRQ ME+TG
Sbjct  15   VKRPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHDYHQETIDNLRQAMESTG  74

Query  271  ILCAVMLDTKG  303
            ILCAVMLDTKG
Sbjct  75   ILCAVMLDTKG  85



>sp|Q42954.1|KPYC_TOBAC RecName: Full=Pyruvate kinase, cytosolic isozyme; Short=PK [Nicotiana 
tabacum]
 emb|CAA82628.1| pyruvate kinase [Nicotiana tabacum]
Length=508

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +1

Query  91   VMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTG  270
            V RPKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH+YHQET++NLRQ ME+TG
Sbjct  15   VKRPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHDYHQETIDNLRQAMESTG  74

Query  271  ILCAVMLDTKG  303
            ILCAVMLDTKG
Sbjct  75   ILCAVMLDTKG  85



>ref|XP_006280237.1| hypothetical protein CARUB_v10026152mg, partial [Capsella rubella]
 gb|EOA13135.1| hypothetical protein CARUB_v10026152mg, partial [Capsella rubella]
Length=575

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/69 (96%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLRQ M NTGIL
Sbjct  84   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRQAMLNTGIL  143

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  144  CAVMLDTKG  152



>ref|XP_004294938.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Fragaria vesca 
subsp. vesca]
 ref|XP_011461639.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Fragaria vesca 
subsp. vesca]
 gb|AHM92905.1| cytosolic pyruvate kinase [Fragaria x ananassa]
Length=495

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  ME+TGIL
Sbjct  4    KPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRAAMESTGIL  63

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  64   CAVMLDTKG  72



>ref|XP_003529451.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Glycine max]
 gb|KHN42958.1| Pyruvate kinase, cytosolic isozyme [Glycine soja]
Length=501

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR  MENTGIL
Sbjct  10   KPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRAAMENTGIL  69

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  70   CAVMLDTKG  78



>ref|NP_001236431.1| pyruvate kinase [Glycine max]
 emb|CAI53675.1| pyruvate kinase [Glycine max]
Length=502

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR  MENTGIL
Sbjct  11   KPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRAAMENTGIL  70

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  71   CAVMLDTKG  79



>ref|XP_004505347.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Cicer arietinum]
Length=500

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 68/69 (99%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGS++YHQETL+NLR GMENTGIL
Sbjct  9    KPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSYDYHQETLDNLRTGMENTGIL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|XP_007207417.1| hypothetical protein PRUPE_ppa004703mg [Prunus persica]
 gb|EMJ08616.1| hypothetical protein PRUPE_ppa004703mg [Prunus persica]
Length=495

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLR  ME+TGIL
Sbjct  4    RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRAAMESTGIL  63

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  64   CAVMLDTKG  72



>gb|KFK27186.1| hypothetical protein AALP_AA8G347400 [Arabis alpina]
Length=498

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLL+AGMNVARFNFSHGSHEYHQETL+NLRQ M NTGIL
Sbjct  7    RPKTKIVCTLGPASRSVPMVEKLLKAGMNVARFNFSHGSHEYHQETLDNLRQAMLNTGIL  66

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  67   CAVMLDTKG  75



>gb|AFK41735.1| unknown [Medicago truncatula]
Length=500

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSH+YHQETL+NLR  MENTGIL
Sbjct  9    KPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHDYHQETLDNLRAAMENTGIL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|XP_003607827.1| Pyruvate kinase [Medicago truncatula]
 gb|AES90024.1| pyruvate kinase family protein [Medicago truncatula]
Length=473

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSH+YHQETL+NLR  MENTGIL
Sbjct  9    KPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHDYHQETLDNLRAAMENTGIL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|XP_006445557.1| hypothetical protein CICLE_v10014977mg [Citrus clementina]
 ref|XP_006488958.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Citrus sinensis]
 gb|ESR58797.1| hypothetical protein CICLE_v10014977mg [Citrus clementina]
 gb|KDO54517.1| hypothetical protein CISIN_1g010627mg [Citrus sinensis]
Length=505

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +1

Query  61   MSANDGAAGPV-MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL  237
            M AN G +  +  +PKTKIVCTLGPASRSVPM+EKLL+AGMNVARFNFSHGSHEYHQETL
Sbjct  1    MDANCGVSTAIEKKPKTKIVCTLGPASRSVPMIEKLLKAGMNVARFNFSHGSHEYHQETL  60

Query  238  NNLRQGMENTGILCAVMLDTKG  303
            NNLR  M NTGILCAVMLDTKG
Sbjct  61   NNLRTAMVNTGILCAVMLDTKG  82



>gb|ACJ85596.1| unknown [Medicago truncatula]
Length=500

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSH+YHQETL+NLR  MENTGIL
Sbjct  9    KPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHDYHQETLDNLRAAMENTGIL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|XP_002299092.2| pyruvate kinase family protein [Populus trichocarpa]
 gb|EEE83897.2| pyruvate kinase family protein [Populus trichocarpa]
Length=512

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/70 (91%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            MRPKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NL+  M NTGI
Sbjct  20   MRPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLKAAMVNTGI  79

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  80   LCAVMLDTKG  89



>ref|XP_003625586.1| Pyruvate kinase [Medicago truncatula]
 gb|AES81804.1| pyruvate kinase family protein [Medicago truncatula]
Length=500

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRS+PMVEKLLRAGMNVARFNFSHGSH+YHQETL+NLR  MENTGIL
Sbjct  9    KPKTKIVCTLGPASRSIPMVEKLLRAGMNVARFNFSHGSHDYHQETLDNLRAAMENTGIL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|XP_010276427.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
Length=499

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH YHQETL+NLR  MENTGIL
Sbjct  8    RPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHAYHQETLDNLRTAMENTGIL  67

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  68   CAVMLDTKG  76



>gb|ACJ85597.1| unknown [Medicago truncatula]
 gb|AFK46339.1| unknown [Medicago truncatula]
Length=500

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRS+PMVEKLLRAGMNVARFNFSHGSH+YHQETL+NLR  MENTGIL
Sbjct  9    KPKTKIVCTLGPASRSIPMVEKLLRAGMNVARFNFSHGSHDYHQETLDNLRAAMENTGIL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|XP_008792548.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Phoenix dactylifera]
Length=536

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPM+E+LLRAGMNVARFNFSHGSHEYHQETL+NLR  MENTGIL
Sbjct  45   RPKTKIVCTLGPASRSVPMLERLLRAGMNVARFNFSHGSHEYHQETLDNLRVAMENTGIL  104

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  105  CAVMLDTKG  113



>gb|EYU32822.1| hypothetical protein MIMGU_mgv1a004734mg [Erythranthe guttata]
Length=512

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 4/82 (5%)
 Frame = +1

Query  70   NDGAAGPVM----RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL  237
            N+G AG V+    RPKTKIVCTLGPASRSV M EKLLRAGM+VARFNFSHGSH+YHQETL
Sbjct  8    NNGDAGEVLVGDKRPKTKIVCTLGPASRSVAMAEKLLRAGMSVARFNFSHGSHDYHQETL  67

Query  238  NNLRQGMENTGILCAVMLDTKG  303
            +NLRQ M+NTGILCAVMLDTKG
Sbjct  68   DNLRQAMDNTGILCAVMLDTKG  89



>gb|KDP21048.1| hypothetical protein JCGZ_21519 [Jatropha curcas]
Length=505

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR GM NTGIL
Sbjct  14   KPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRAGMVNTGIL  73

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  74   CAVMLDTKG  82



>ref|XP_004149636.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Cucumis sativus]
 ref|XP_004166542.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Cucumis sativus]
 gb|KGN54016.1| hypothetical protein Csa_4G268000 [Cucumis sativus]
Length=500

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLL+AGMNVARFNFSHGSH YHQETL+NLR GMENTGIL
Sbjct  9    KPKTKIVCTLGPASRSVPMIEKLLKAGMNVARFNFSHGSHAYHQETLDNLRAGMENTGIL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|XP_008449903.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Cucumis melo]
Length=500

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLL+AGMNVARFNFSHGSH YHQETL+NLR GMENTGIL
Sbjct  9    KPKTKIVCTLGPASRSVPMIEKLLKAGMNVARFNFSHGSHAYHQETLDNLRAGMENTGIL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|NP_200446.1| pyruvate kinase [Arabidopsis thaliana]
 ref|XP_002866137.1| hypothetical protein ARALYDRAFT_495726 [Arabidopsis lyrata subsp. 
lyrata]
 dbj|BAB11262.1| pyruvate kinase [Arabidopsis thaliana]
 gb|AAK96742.1| pyruvate kinase [Arabidopsis thaliana]
 gb|AAL47384.1| pyruvate kinase [Arabidopsis thaliana]
 gb|AAM64651.1| pyruvate kinase [Arabidopsis thaliana]
 gb|EFH42396.1| hypothetical protein ARALYDRAFT_495726 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED96752.1| pyruvate kinase [Arabidopsis thaliana]
Length=498

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NL Q M NTGIL
Sbjct  7    RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLHQAMLNTGIL  66

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  67   CAVMLDTKG  75



>ref|XP_009376168.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Pyrus x bretschneideri]
Length=495

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M++TGIL
Sbjct  4    RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRAAMDSTGIL  63

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  64   CAVMLDTKG  72



>ref|XP_006829825.1| hypothetical protein AMTR_s00119p00089160 [Amborella trichopoda]
 gb|ERM97241.1| hypothetical protein AMTR_s00119p00089160 [Amborella trichopoda]
Length=516

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +1

Query  88   PVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENT  267
            P  RPKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH YHQETL+NLR  MENT
Sbjct  22   PSSRPKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGSHAYHQETLDNLRIAMENT  81

Query  268  GILCAVMLDTKG  303
            G+LCAVMLDTKG
Sbjct  82   GVLCAVMLDTKG  93



>ref|XP_010521454.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Tarenaya 
hassleriana]
 ref|XP_010521460.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Tarenaya 
hassleriana]
 ref|XP_010521469.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Tarenaya 
hassleriana]
Length=510

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLL+AGMNVARFNFSHGSHEYHQETLNNLR  M+NTGILC
Sbjct  20   PKTKIVCTLGPASRSVPMIEKLLKAGMNVARFNFSHGSHEYHQETLNNLRSAMQNTGILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_008781216.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Phoenix dactylifera]
Length=498

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH YHQETL+NLR  M+NTGIL
Sbjct  7    RPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHAYHQETLDNLRTAMDNTGIL  66

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  67   CAVMLDTKG  75



>emb|CDY11933.1| BnaC03g13590D [Brassica napus]
Length=434

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/69 (94%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV MVEKLLRAGMNVARFNFSHGSHEYHQETL+NLRQ M NTGIL
Sbjct  7    RPKTKIVCTLGPASRSVEMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRQAMLNTGIL  66

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  67   CAVMLDTKG  75



>ref|XP_002448775.1| hypothetical protein SORBIDRAFT_06g032940 [Sorghum bicolor]
 gb|EES13103.1| hypothetical protein SORBIDRAFT_06g032940 [Sorghum bicolor]
Length=513

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  73   DGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQ  252
            D  AG    PKTK+VCTLGPASR+VPM+EKLLRAGMNVARFNFSHG+HEYHQETL+NLRQ
Sbjct  14   DRGAGDARVPKTKLVCTLGPASRTVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLRQ  73

Query  253  GMENTGILCAVMLDTKG  303
             M NTGILCAVMLDTKG
Sbjct  74   AMHNTGILCAVMLDTKG  90



>ref|XP_010923031.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Elaeis guineensis]
Length=506

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPM+E+LLRAGMNVARFNFSHGSHEYHQETL NLR  MENTGIL
Sbjct  15   RPKTKIVCTLGPASRSVPMLERLLRAGMNVARFNFSHGSHEYHQETLGNLRVAMENTGIL  74

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  75   CAVMLDTKG  83



>ref|XP_004505349.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Cicer arietinum]
Length=501

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRS+PM+EKLL+AGMNVARFNFSHGSHEYHQETL+NLR  MENTGIL
Sbjct  10   KPKTKIVCTLGPASRSIPMIEKLLQAGMNVARFNFSHGSHEYHQETLDNLRAAMENTGIL  69

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  70   CAVMLDTKG  78



>gb|KHN20509.1| Pyruvate kinase, cytosolic isozyme [Glycine soja]
Length=503

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR  MENTGIL
Sbjct  11   KPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRAAMENTGIL  70

Query  277  CAVMLDTKG  303
            CAVMLDTK 
Sbjct  71   CAVMLDTKA  79



>ref|XP_010938149.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Elaeis guineensis]
Length=499

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 68/74 (92%), Gaps = 1/74 (1%)
 Frame = +1

Query  85   GPVMR-PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGME  261
            G V R PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSH YHQETL+NLR  ME
Sbjct  2    GEVRRSPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHAYHQETLDNLRAAME  61

Query  262  NTGILCAVMLDTKG  303
            NTGILCAVMLDTKG
Sbjct  62   NTGILCAVMLDTKG  75



>ref|XP_002523396.1| pyruvate kinase, putative [Ricinus communis]
 gb|EEF38975.1| pyruvate kinase, putative [Ricinus communis]
Length=509

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +1

Query  52   MTMMSANDGAAGPVM--RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYH  225
            M MM+   G     M  +PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYH
Sbjct  1    MNMMNTGGGTDSVFMEKKPKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGSHEYH  60

Query  226  QETLNNLRQGMENTGILCAVMLDTKG  303
            QETL+NLR  M NTGILCAVMLDTKG
Sbjct  61   QETLDNLRAAMVNTGILCAVMLDTKG  86



>gb|KHG16228.1| Pyruvate kinase, cytosolic isozyme [Gossypium arboreum]
Length=510

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M NTGILC
Sbjct  20   PKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRSAMHNTGILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|KJB31911.1| hypothetical protein B456_005G214000 [Gossypium raimondii]
 gb|KJB31912.1| hypothetical protein B456_005G214000 [Gossypium raimondii]
Length=510

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M NTGILC
Sbjct  20   PKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRSAMHNTGILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_008351255.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Malus domestica]
Length=495

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLL AGMNVARFNFSHGSHEYHQETL+NLR  ME+TGIL
Sbjct  4    RPKTKIVCTLGPASRSVPMVEKLLXAGMNVARFNFSHGSHEYHQETLDNLRAAMESTGIL  63

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  64   CAVMLDTKG  72



>gb|KHG28967.1| Pyruvate kinase, cytosolic isozyme [Gossypium arboreum]
Length=510

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M NTGILC
Sbjct  20   PKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRSAMHNTGILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_004960072.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Setaria italica]
Length=513

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 1/86 (1%)
 Frame = +1

Query  49   EMTMMSANDGAAGPVMR-PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYH  225
            +M  + A+    GP  R PKTK+VCTLGPASR+VPM+EKLLRAGMNVARFNFSHG+HEYH
Sbjct  5    DMAAILADLERGGPDARVPKTKLVCTLGPASRAVPMLEKLLRAGMNVARFNFSHGTHEYH  64

Query  226  QETLNNLRQGMENTGILCAVMLDTKG  303
            QETL+NLRQ M NTGILCAVMLDTKG
Sbjct  65   QETLDNLRQAMHNTGILCAVMLDTKG  90



>ref|XP_008793321.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Phoenix dactylifera]
Length=499

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH YHQETL+NLR  MENTGI 
Sbjct  7    RPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHAYHQETLDNLRAAMENTGIP  66

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  67   CAVMLDTKG  75



>ref|XP_010248420.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Nelumbo nucifera]
 ref|XP_010248426.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Nelumbo nucifera]
Length=514

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHG+HEYHQETLNNLR+ M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGTHEYHQETLNNLREAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_004228967.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Solanum lycopersicum]
Length=502

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +1

Query  91   VMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTG  270
            V RPKTKIVCTLGP SRSV MVEKLLRAGMNVARFNFSHGSH+YHQET++NLRQ MENTG
Sbjct  9    VKRPKTKIVCTLGPESRSVFMVEKLLRAGMNVARFNFSHGSHDYHQETIDNLRQAMENTG  68

Query  271  ILCAVMLDTKG  303
            ILCAVMLDTKG
Sbjct  69   ILCAVMLDTKG  79



>ref|XP_010032839.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Eucalyptus grandis]
 gb|KCW52330.1| hypothetical protein EUGRSUZ_J01749 [Eucalyptus grandis]
Length=513

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV M EKLLRAGMNVARFNFSHGSHEYHQETL+NLRQ ME+TGIL
Sbjct  22   RPKTKIVCTLGPASRSVAMTEKLLRAGMNVARFNFSHGSHEYHQETLDNLRQAMESTGIL  81

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  82   CAVMLDTKG  90



>ref|XP_010539372.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Tarenaya 
hassleriana]
Length=503

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 1/78 (1%)
 Frame = +1

Query  73   DGAAGPV-MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            DG   P+  RPKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH YHQETL+NL 
Sbjct  3    DGVVVPMEQRPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHAYHQETLDNLH  62

Query  250  QGMENTGILCAVMLDTKG  303
            Q M +TGILCAVMLDTKG
Sbjct  63   QAMSSTGILCAVMLDTKG  80



>ref|XP_009132308.1| PREDICTED: LOW QUALITY PROTEIN: probable pyruvate kinase, cytosolic 
isozyme [Brassica rapa]
Length=500

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/69 (93%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCT+GPASRSV MVEKLLRAGMNVARFNFSHGSHEYHQETL+NLRQ M NTGIL
Sbjct  7    RPKTKIVCTVGPASRSVEMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRQAMLNTGIL  66

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  67   CAVMLDTKG  75



>gb|AIZ68206.1| Pyruvate kinase, cytosolic isozyme isoform 1 [Ornithogalum saundersiae]
Length=514

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M NTGILC
Sbjct  24   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMHNTGILC  83

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  84   AVMLDTKG  91



>emb|CDX81194.1| BnaC09g06050D [Brassica napus]
Length=215

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  9    NDGRT-----PKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLR  63

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTG+L AVMLDTKG
Sbjct  64   AAMQNTGMLAAVMLDTKG  81



>ref|XP_011048153.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Populus euphratica]
Length=512

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            MRPKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH+YHQETL+NL   M NTGI
Sbjct  20   MRPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHDYHQETLDNLMAAMVNTGI  79

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  80   LCAVMLDTKG  89



>ref|NP_001149825.1| pyruvate kinase, cytosolic isozyme [Zea mays]
 gb|ACG36918.1| pyruvate kinase, cytosolic isozyme [Zea mays]
Length=513

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  73   DGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQ  252
            D  AG    PKTK+VCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+H+YHQETL++LRQ
Sbjct  14   DRGAGDARLPKTKLVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHQYHQETLDSLRQ  73

Query  253  GMENTGILCAVMLDTKG  303
             M NTGILCAVMLDTKG
Sbjct  74   AMHNTGILCAVMLDTKG  90



>gb|ACR35425.1| unknown [Zea mays]
 tpg|DAA35349.1| TPA: pyruvate kinase [Zea mays]
Length=513

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = +1

Query  73   DGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQ  252
            D  AG    PKTK+VCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+H+YHQETL++LRQ
Sbjct  14   DRGAGDARLPKTKLVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHQYHQETLDSLRQ  73

Query  253  GMENTGILCAVMLDTKG  303
             M NTGILCAVMLDTKG
Sbjct  74   AMHNTGILCAVMLDTKG  90



>ref|NP_001150269.1| pyruvate kinase, cytosolic isozyme [Zea mays]
 gb|ACG38453.1| pyruvate kinase, cytosolic isozyme [Zea mays]
Length=447

 Score =   139 bits (349),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 71/77 (92%), Gaps = 1/77 (1%)
 Frame = +1

Query  76   GAAGPVMR-PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQ  252
            GA+G   R PKTK+VCTLGPASR+VPM+EKLLRAGMNVARFNFSHG+HEYHQETL+NLRQ
Sbjct  16   GASGGDARVPKTKLVCTLGPASRTVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLRQ  75

Query  253  GMENTGILCAVMLDTKG  303
             M NTGILCAVMLDTKG
Sbjct  76   AMHNTGILCAVMLDTKG  92



>emb|CBI35347.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_006653027.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Oryza brachyantha]
Length=513

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTK+VCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETL+NLRQ M NTG+LC
Sbjct  23   PKTKLVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLRQAMHNTGVLC  82

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  83   AVMLDTKG  90



>ref|NP_001054265.1| Os04g0677500 [Oryza sativa Japonica Group]
 emb|CAE05765.2| OSJNBa0064G10.16 [Oryza sativa Japonica Group]
 emb|CAJ86233.1| H0402C08.9 [Oryza sativa Indica Group]
 dbj|BAF16179.1| Os04g0677500 [Oryza sativa Japonica Group]
 gb|EAY96053.1| hypothetical protein OsI_17926 [Oryza sativa Indica Group]
 gb|EAZ32416.1| hypothetical protein OsJ_16627 [Oryza sativa Japonica Group]
 gb|ACA50506.1| pyruvate kinase [Oryza sativa Japonica Group]
 dbj|BAG91102.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=511

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTK+VCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETL+NLRQ M NTG+LC
Sbjct  21   PKTKLVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLRQAMHNTGVLC  80

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  81   AVMLDTKG  88



>ref|XP_010438767.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Camelina 
sativa]
Length=497

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGM+VARFNFSHGS+EYHQETL+NLRQ M NTG+L
Sbjct  6    RPKTKIVCTLGPASRSVPMVEKLLRAGMSVARFNFSHGSYEYHQETLDNLRQAMLNTGML  65

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  66   CAVMLDTKG  74



>ref|XP_010433512.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Camelina 
sativa]
Length=496

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLLRAGM+VARFNFSHGS+EYHQETL+NLRQ M NTG+L
Sbjct  6    RPKTKIVCTLGPASRSVPMVEKLLRAGMSVARFNFSHGSYEYHQETLDNLRQAMLNTGML  65

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  66   CAVMLDTKG  74



>ref|XP_010105293.1| Pyruvate kinase, cytosolic isozyme [Morus notabilis]
 gb|EXC04258.1| Pyruvate kinase, cytosolic isozyme [Morus notabilis]
Length=506

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLL+AGMNVARFNFSHGSH+YHQETL+NL Q M+NTGIL
Sbjct  15   KPKTKIVCTLGPASRSVPMIEKLLKAGMNVARFNFSHGSHDYHQETLDNLGQAMDNTGIL  74

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  75   CAVMLDTKG  83



>emb|CDY46578.1| BnaCnng14000D [Brassica napus]
 emb|CDY32790.1| BnaA10g10590D [Brassica napus]
Length=421

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSV MVEKLL+AGMNVARFNFSHGSHEYHQETL+NLRQ M NTGIL
Sbjct  7    KPKTKIVCTLGPASRSVEMVEKLLKAGMNVARFNFSHGSHEYHQETLDNLRQAMLNTGIL  66

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  67   CAVMLDTKG  75



>ref|XP_003580822.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Brachypodium distachyon]
Length=514

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +1

Query  79   AAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGM  258
            AA     P+TK+VCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETL+NLRQ M
Sbjct  17   AAADARVPRTKLVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLRQAM  76

Query  259  ENTGILCAVMLDTKG  303
             NTG+LCAVMLDTKG
Sbjct  77   HNTGVLCAVMLDTKG  91



>gb|AES90025.2| pyruvate kinase family protein [Medicago truncatula]
Length=497

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPMVEKLL+AGMNVARFNFSHGS+EYHQETL+NLR  M+NTGIL
Sbjct  6    KPKTKIVCTLGPASRSVPMVEKLLQAGMNVARFNFSHGSYEYHQETLDNLRTAMQNTGIL  65

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  66   CAVMLDTKG  74



>ref|XP_003607828.1| Pyruvate kinase [Medicago truncatula]
Length=496

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPMVEKLL+AGMNVARFNFSHGS+EYHQETL+NLR  M+NTGIL
Sbjct  5    KPKTKIVCTLGPASRSVPMVEKLLQAGMNVARFNFSHGSYEYHQETLDNLRTAMQNTGIL  64

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  65   CAVMLDTKG  73



>ref|XP_002270400.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Vitis vinifera]
 ref|XP_010655961.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Vitis vinifera]
Length=510

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_008800432.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Phoenix dactylifera]
Length=510

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETLNNLR  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGSHEYHQETLNNLRTAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_010257721.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
Length=499

 Score =   138 bits (348),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            R KTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH YHQETL+NLR  MENTGIL
Sbjct  8    RRKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHAYHQETLDNLRAAMENTGIL  67

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  68   CAVMLDTKG  76



>ref|XP_004308255.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Fragaria 
vesca subsp. vesca]
Length=504

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            MRPKTKIVCTLGP+SRSV M EKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M NTGI
Sbjct  13   MRPKTKIVCTLGPSSRSVEMAEKLLRAGMNVARFNFSHGSHEYHQETLDNLRSAMNNTGI  72

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  73   LCAVMLDTKG  82



>ref|XP_008661999.1| PREDICTED: pyruvate kinase, cytosolic isozyme isoform X1 [Zea 
mays]
 gb|AFW59893.1| pyruvate kinase [Zea mays]
Length=609

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%), Gaps = 1/79 (1%)
 Frame = +1

Query  70   NDGAAGPVMR-PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNL  246
            + GA+G   R PKTK+VCTLGPASR+VPM+EKLLRAGMNVARFNFSHG+HEYHQETL+NL
Sbjct  108  DRGASGGDARVPKTKLVCTLGPASRTVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNL  167

Query  247  RQGMENTGILCAVMLDTKG  303
            RQ M NTGILCAVMLDTKG
Sbjct  168  RQAMHNTGILCAVMLDTKG  186



>ref|XP_010549615.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Tarenaya hassleriana]
Length=512

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  79   AAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGM  258
            A   VM PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHGSH YHQ+TL+NLR  M
Sbjct  11   ADAVVMMPKTKIVCTLGPASRSVQMIEKLLRAGMNVARFNFSHGSHSYHQQTLDNLRTAM  70

Query  259  ENTGILCAVMLDTKG  303
            ENTGI+CAVMLDTKG
Sbjct  71   ENTGIICAVMLDTKG  85



>ref|XP_009120154.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Brassica 
rapa]
Length=498

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSV MVEKLL+AGMNVARFNFSHGSHEYHQETL+NLRQ M NTGIL
Sbjct  7    KPKTKIVCTLGPASRSVEMVEKLLKAGMNVARFNFSHGSHEYHQETLDNLRQAMLNTGIL  66

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  67   CAVMLDTKG  75



>ref|XP_009402438.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=501

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            MRPKTKIVCTLGPASRSV M+E+LL+AGMNVARFNFSHGSH YHQETL+NLR  MENTGI
Sbjct  9    MRPKTKIVCTLGPASRSVEMLERLLKAGMNVARFNFSHGSHAYHQETLDNLRAAMENTGI  68

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  69   LCAVMLDTKG  78



>ref|XP_009420246.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Musa acuminata 
subsp. malaccensis]
Length=499

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV M+E+LLRAGMNVARFNFSHGSH YHQETL+NLR  MENTGIL
Sbjct  8    RPKTKIVCTLGPASRSVEMIERLLRAGMNVARFNFSHGSHAYHQETLDNLRTAMENTGIL  67

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  68   CAVMLDTKG  76



>ref|XP_006286182.1| hypothetical protein CARUB_v10007746mg [Capsella rubella]
 gb|EOA19080.1| hypothetical protein CARUB_v10007746mg [Capsella rubella]
Length=497

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 67/69 (97%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPMVEKLLRAGM+VARFNFSHGS+EYHQETL+NLRQ M NTG+L
Sbjct  6    KPKTKIVCTLGPASRSVPMVEKLLRAGMSVARFNFSHGSYEYHQETLDNLRQAMLNTGML  65

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  66   CAVMLDTKG  74



>gb|KHG14965.1| Pyruvate kinase, cytosolic isozyme [Gossypium arboreum]
Length=510

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/67 (93%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +1

Query  103  KTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILCA  282
            KTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETLNNLR  M++TGILCA
Sbjct  21   KTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLNNLRAAMQSTGILCA  80

Query  283  VMLDTKG  303
            VMLDTKG
Sbjct  81   VMLDTKG  87



>emb|CDY60038.1| BnaA09g52300D [Brassica napus]
Length=221

 Score =   133 bits (334),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSVPM+EKLL+AGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVPMIEKLLKAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTG+L AVMLDTKG
Sbjct  70   AAMQNTGMLAAVMLDTKG  87



>gb|AIS24261.1| cytosolic pyruvate kinase 1 [Gossypium hirsutum]
Length=506

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH YHQETL+NLR  M NTGIL
Sbjct  16   KPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHAYHQETLDNLRAAMLNTGIL  75

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  76   CAVMLDTKG  84



>ref|XP_010427376.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X1 
[Camelina sativa]
Length=495

 Score =   137 bits (345),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  52   MTMMSANDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQE  231
            M M+ A     G ++R KTKIVCTLGPASRSV M+EKLL+AGM VARFNFSHGSH YHQE
Sbjct  1    MEMLLAGQATKGALLRSKTKIVCTLGPASRSVEMIEKLLKAGMTVARFNFSHGSHSYHQE  60

Query  232  TLNNLRQGMENTGILCAVMLDTKG  303
            TL+NLR  M NTGILCAVMLDTKG
Sbjct  61   TLDNLRTAMANTGILCAVMLDTKG  84



>gb|KDP40458.1| hypothetical protein JCGZ_24457 [Jatropha curcas]
Length=510

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_007043166.1| Pyruvate kinase family protein isoform 1 [Theobroma cacao]
 ref|XP_007043167.1| Pyruvate kinase family protein isoform 1 [Theobroma cacao]
 ref|XP_007043168.1| Pyruvate kinase family protein isoform 1 [Theobroma cacao]
 gb|EOX98997.1| Pyruvate kinase family protein isoform 1 [Theobroma cacao]
 gb|EOX98998.1| Pyruvate kinase family protein isoform 1 [Theobroma cacao]
 gb|EOX98999.1| Pyruvate kinase family protein isoform 1 [Theobroma cacao]
Length=510

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 67/78 (86%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHGSHEYHQETLNNLR
Sbjct  15   NDGRV-----PKTKIVCTLGPASRSVLMIEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M NTGILCAVMLDTKG
Sbjct  70   AAMHNTGILCAVMLDTKG  87



>dbj|BAJ85672.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87970.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   137 bits (345),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  79   AAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGM  258
            AA     P+TK+VCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETL+ LRQ M
Sbjct  17   AAADARTPRTKLVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDALRQAM  76

Query  259  ENTGILCAVMLDTKG  303
             NTGILCAVMLDTKG
Sbjct  77   HNTGILCAVMLDTKG  91



>ref|XP_010940385.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Elaeis guineensis]
 ref|XP_010940386.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Elaeis guineensis]
 ref|XP_010940387.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Elaeis guineensis]
 ref|XP_010940389.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Elaeis guineensis]
Length=510

 Score =   137 bits (345),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRV-----PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NT ILCAVMLDTKG
Sbjct  70   IAMQNTQILCAVMLDTKG  87



>ref|XP_010935595.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Elaeis guineensis]
 ref|XP_010935596.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Elaeis guineensis]
 ref|XP_010935597.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Elaeis guineensis]
Length=510

 Score =   137 bits (344),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRV-----PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NT ILCAVMLDTKG
Sbjct  70   IAMQNTQILCAVMLDTKG  87



>ref|XP_010918024.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Elaeis guineensis]
Length=514

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/68 (93%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETLNNLR  M NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGSHEYHQETLNNLRTAMLNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|ABR18162.1| unknown [Picea sitchensis]
Length=510

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M NT I+C
Sbjct  20   PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRTAMYNTQIMC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>emb|CDY21551.1| BnaC09g47410D [Brassica napus]
Length=510

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+VPM+EKLLRAGMNVARFNFSHGSHEYHQ+TLNNLR  M+NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVPMIEKLLRAGMNVARFNFSHGSHEYHQDTLNNLRTAMQNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|ABR16411.1| unknown [Picea sitchensis]
Length=510

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M NT I+C
Sbjct  20   PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLRTAMYNTQIMC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_009122472.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Brassica rapa]
 ref|XP_009122473.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Brassica rapa]
 ref|XP_009122474.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Brassica rapa]
Length=510

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+VPM+EKLLRAGMNVARFNFSHGSHEYHQ+TLNNLR  M+NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVPMIEKLLRAGMNVARFNFSHGSHEYHQDTLNNLRTAMQNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>emb|CDX69938.1| BnaA10g22870D [Brassica napus]
Length=510

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+VPM+EKLLRAGMNVARFNFSHGSHEYHQ+TLNNLR  M+NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVPMIEKLLRAGMNVARFNFSHGSHEYHQDTLNNLRTAMQNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_006394248.1| hypothetical protein EUTSA_v10004034mg [Eutrema salsugineum]
 ref|XP_006394249.1| hypothetical protein EUTSA_v10004034mg [Eutrema salsugineum]
 gb|ESQ31534.1| hypothetical protein EUTSA_v10004034mg [Eutrema salsugineum]
 gb|ESQ31535.1| hypothetical protein EUTSA_v10004034mg [Eutrema salsugineum]
Length=510

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASR+VPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRTVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTGIL AVMLDTKG
Sbjct  70   TAMQNTGILAAVMLDTKG  87



>emb|CDY41529.1| BnaA06g22820D [Brassica napus]
 emb|CDX84432.1| BnaC03g50680D [Brassica napus]
Length=493

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSVPM+EKLL+AGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVPMIEKLLKAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTGIL AVMLDTKG
Sbjct  70   AAMQNTGILAAVMLDTKG  87



>ref|NP_194369.1| probable pyruvate kinase [Arabidopsis thaliana]
 sp|O65595.1|KPYC_ARATH RecName: Full=Probable pyruvate kinase, cytosolic isozyme; Short=PK 
[Arabidopsis thaliana]
 emb|CAA18231.1| pyruvate kinase like protein [Arabidopsis thaliana]
 emb|CAB79494.1| pyruvate kinase like protein [Arabidopsis thaliana]
 gb|AEE85192.1| probable pyruvate kinase [Arabidopsis thaliana]
Length=497

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLL AGM+VARFNFSHGS+EYHQETL+NLRQ M NTG+L
Sbjct  6    RPKTKIVCTLGPASRSVPMVEKLLMAGMSVARFNFSHGSYEYHQETLDNLRQAMLNTGML  65

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  66   CAVMLDTKG  74



>ref|XP_009150421.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Brassica 
rapa]
Length=510

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSVPM+EKLL+AGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVPMIEKLLKAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTGIL AVMLDTKG
Sbjct  70   AAMQNTGILAAVMLDTKG  87



>ref|XP_008778170.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Phoenix dactylifera]
 ref|XP_008778175.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Phoenix dactylifera]
 ref|XP_008778182.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Phoenix dactylifera]
Length=510

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASR+VPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRV-----PKTKIVCTLGPASRTVPMLEKLLRAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NT ILCAVMLDTKG
Sbjct  70   IAMQNTQILCAVMLDTKG  87



>ref|XP_010274948.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X2 
[Nelumbo nucifera]
Length=483

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M NT ILC
Sbjct  22   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMHNTQILC  81

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  82   AVMLDTKG  89



>ref|XP_010274945.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010274946.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010274947.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X1 
[Nelumbo nucifera]
Length=512

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M NT ILC
Sbjct  22   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMHNTQILC  81

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  82   AVMLDTKG  89



>ref|XP_009612061.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nicotiana tomentosiformis]
 ref|XP_009612062.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nicotiana tomentosiformis]
Length=510

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNL+  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLKIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_003567112.1| PREDICTED: pyruvate kinase, cytosolic isozyme isoform X1 [Brachypodium 
distachyon]
Length=514

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 73/89 (82%), Gaps = 1/89 (1%)
 Frame = +1

Query  40   SEGEMTMMSAND-GAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSH  216
            S GE++   A + GAA    RPKTKIVCTLGPASRSV M+EKLLRAGM VARFNFSHGSH
Sbjct  3    SNGELSQPEAGEYGAAVMRRRPKTKIVCTLGPASRSVEMIEKLLRAGMCVARFNFSHGSH  62

Query  217  EYHQETLNNLRQGMENTGILCAVMLDTKG  303
            EYHQETL+NL   ME TGILCAVMLDTKG
Sbjct  63   EYHQETLDNLHAAMERTGILCAVMLDTKG  91



>gb|AFK43671.1| unknown [Lotus japonicus]
Length=510

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 66/78 (85%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M EKLLRAGMNVARFNFSHG+HEYHQETLNNLR
Sbjct  15   NDGRV-----PKTKIVCTLGPASRSVEMTEKLLRAGMNVARFNFSHGTHEYHQETLNNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M NTGILCAVMLDTKG
Sbjct  70   TAMHNTGILCAVMLDTKG  87



>ref|XP_010448281.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Camelina 
sativa]
Length=497

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSVPMVEKLL+AGM+VARFNFSHGS+EYHQE L+NLRQ M NTG+L
Sbjct  6    RPKTKIVCTLGPASRSVPMVEKLLKAGMSVARFNFSHGSYEYHQENLDNLRQAMLNTGML  65

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  66   CAVMLDTKG  74



>ref|XP_010507467.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Camelina 
sativa]
Length=245

 Score =   131 bits (330),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            +R KTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSH YHQETL+NLR  ++NTGI
Sbjct  14   LRSKTKIVCTLGPASRSVEMIEKLLKAGMNVARFNFSHGSHSYHQETLDNLRTAVDNTGI  73

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  74   LCAVMLDTKG  83



>ref|XP_007014033.1| Pyruvate kinase family protein isoform 1 [Theobroma cacao]
 gb|EOY31652.1| Pyruvate kinase family protein isoform 1 [Theobroma cacao]
Length=506

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  52   MTMMSANDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQE  231
            M M + + G A    + KTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH YHQE
Sbjct  1    MEMNNHHQGTAEMEKKSKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHAYHQE  60

Query  232  TLNNLRQGMENTGILCAVMLDTKG  303
            TL+NLR  M NTGILCAVMLDTKG
Sbjct  61   TLDNLRAAMLNTGILCAVMLDTKG  84



>emb|CDY39852.1| BnaC02g42660D [Brassica napus]
Length=493

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M++TGIL 
Sbjct  20   PKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRAAMQSTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_009385981.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=510

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQET++NLR
Sbjct  15   NDGRV-----PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETIDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NT ILCAVMLDTKG
Sbjct  70   IAMQNTQILCAVMLDTKG  87



>gb|KJB20555.1| hypothetical protein B456_003G154200 [Gossypium raimondii]
Length=506

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH YHQETL+NLR  M +TGIL
Sbjct  16   KPKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHAYHQETLDNLRAAMLSTGIL  75

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  76   CAVMLDTKG  84



>ref|XP_010546281.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Tarenaya hassleriana]
 ref|XP_010546282.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Tarenaya hassleriana]
Length=510

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSH+YHQETL+NLR
Sbjct  15   NDGRV-----PKTKIVCTLGPASRSVEMIEKLLKAGMNVARFNFSHGSHDYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTGILCAVMLDTKG
Sbjct  70   TAMQNTGILCAVMLDTKG  87



>ref|XP_007014034.1| Pyruvate kinase family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY31653.1| Pyruvate kinase family protein isoform 2, partial [Theobroma 
cacao]
Length=334

 Score =   133 bits (334),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  52   MTMMSANDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQE  231
            M M + + G A    + KTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSH YHQE
Sbjct  1    MEMNNHHQGTAEMEKKSKTKIVCTLGPASRSVPMIEKLLRAGMNVARFNFSHGSHAYHQE  60

Query  232  TLNNLRQGMENTGILCAVMLDTK  300
            TL+NLR  M NTGILCAVMLDTK
Sbjct  61   TLDNLRAAMLNTGILCAVMLDTK  83



>ref|XP_002285763.2| PREDICTED: pyruvate kinase, cytosolic isozyme [Vitis vinifera]
Length=506

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPA RSVPM+EKLLRAGMNVARFNFSHGSHEYH ETL+NLR  M++TGIL
Sbjct  15   RPKTKIVCTLGPACRSVPMLEKLLRAGMNVARFNFSHGSHEYHLETLSNLRAAMDSTGIL  74

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  75   CAVMLDTKG  83



>ref|XP_010103561.1| Pyruvate kinase, cytosolic isozyme [Morus notabilis]
 gb|EXB96338.1| Pyruvate kinase, cytosolic isozyme [Morus notabilis]
Length=517

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 66/78 (85%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV MVEKLLRAGMNVARFNFSHG+HEYHQETLNNLR
Sbjct  15   NDGRV-----PKTKIVCTLGPASRSVEMVEKLLRAGMNVARFNFSHGTHEYHQETLNNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M NT ILCAVMLDTKG
Sbjct  70   TAMHNTQILCAVMLDTKG  87



>ref|XP_004147096.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Cucumis sativus]
 gb|KGN51576.1| hypothetical protein Csa_5G580610 [Cucumis sativus]
Length=510

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVTMIEKLLRAGMNVARFNFSHGTHEYHQETLNNLRTAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_008445909.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Cucumis melo]
Length=510

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVTMIEKLLRAGMNVARFNFSHGTHEYHQETLNNLRTAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_009418646.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Musa acuminata 
subsp. malaccensis]
Length=510

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETL+NLR  M NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLRVAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|KDO43103.1| hypothetical protein CISIN_1g0123352mg, partial [Citrus sinensis]
Length=310

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M EKLLRAGMNVARFNFSHGSH YHQETL+NLR  M NTGILC
Sbjct  9    PKTKIVCTLGPASRSVEMAEKLLRAGMNVARFNFSHGSHAYHQETLDNLRTAMNNTGILC  68

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  69   AVMLDTKG  76



>ref|XP_008802624.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Phoenix dactylifera]
Length=510

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRV-----PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M++T ILCAVMLDTKG
Sbjct  70   IAMQSTRILCAVMLDTKG  87



>gb|AAZ86534.1| pyruvate kinase [Capsicum annuum]
Length=511

 Score =   134 bits (338),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGP+SRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNL+
Sbjct  15   NDGRV-----PKTKIVCTLGPSSRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLK  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NT ILCAVMLDTKG
Sbjct  70   IAMQNTQILCAVMLDTKG  87



>ref|XP_002266160.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Vitis vinifera]
 emb|CAQ58605.1| pyruvate kinase [Vitis vinifera]
Length=510

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+H+YHQETL+NLR  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHDYHQETLDNLRIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>emb|CAQ58629.1| pyruvate kinase [Vitis vinifera]
Length=510

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+H+YHQETL+NLR  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHDYHQETLDNLRIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|KFK28069.1| pyruvate kinase [Arabis alpina]
Length=510

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 67/78 (86%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV MVEKLLRAGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVDMVEKLLRAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTGIL AVMLDTKG
Sbjct  70   TAMQNTGILAAVMLDTKG  87



>ref|XP_009411188.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=554

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/82 (79%), Positives = 72/82 (88%), Gaps = 1/82 (1%)
 Frame = +1

Query  58   MMSANDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETL  237
            ++S + G+AG   RPKTKIVCTLGPASRSV M+E+LLRAGMNVARFNFSHGSHEYHQETL
Sbjct  51   LISPSCGSAG-WRRPKTKIVCTLGPASRSVEMIERLLRAGMNVARFNFSHGSHEYHQETL  109

Query  238  NNLRQGMENTGILCAVMLDTKG  303
            +NLR  ME TGI CAVMLDTKG
Sbjct  110  HNLRAAMEITGIPCAVMLDTKG  131



>ref|XP_010274940.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
 ref|XP_010274941.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
 ref|XP_010274942.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
 ref|XP_010274943.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
 ref|XP_010274944.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
Length=510

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVHMIEKLLRAGMNVARFNFSHGTHEYHQETLNNLRTAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_009785561.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nicotiana sylvestris]
Length=510

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVP++EKLLRAGMNVARFNFSHG+HEYHQETLNNL+  M NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPVIEKLLRAGMNVARFNFSHGTHEYHQETLNNLKIAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_009112104.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Brassica 
rapa]
Length=510

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSVPM+EKLL+AGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVPMIEKLLKAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTG+L AVMLDTKG
Sbjct  70   AAMQNTGMLAAVMLDTKG  87



>dbj|BAJ93484.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   134 bits (338),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +1

Query  40   SEGEMTMMSAND-GAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSH  216
            S GE++   A + G A    RPKTKIVCTLGPASRSV M+EKLLRAGM VARFNFSHGSH
Sbjct  3    SNGELSQPQAGEYGTAVMRRRPKTKIVCTLGPASRSVDMIEKLLRAGMCVARFNFSHGSH  62

Query  217  EYHQETLNNLRQGMENTGILCAVMLDTKG  303
            EYHQETL+NL   ME TGILCAVMLDTKG
Sbjct  63   EYHQETLDNLHAAMERTGILCAVMLDTKG  91



>ref|XP_009383729.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383736.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGP+SRSVPM+EKLLRAGMNVARFNFSHG+HEYHQET++NLR
Sbjct  15   NDGRV-----PKTKIVCTLGPSSRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETIDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NT ILCAVMLDTKG
Sbjct  70   IAMQNTQILCAVMLDTKG  87



>ref|NP_001042731.1| Os01g0276700 [Oryza sativa Japonica Group]
 dbj|BAD81116.1| putative pyruvate kinase, cytosolic isozyme [Oryza sativa Japonica 
Group]
 dbj|BAF04645.1| Os01g0276700 [Oryza sativa Japonica Group]
 dbj|BAG95929.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54322.1| hypothetical protein OsJ_01290 [Oryza sativa Japonica Group]
Length=510

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 72/84 (86%), Gaps = 3/84 (4%)
 Frame = +1

Query  58   MMSANDGAAGPVMR--PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQE  231
            M    +GAAG VMR  PKTKIVCTLGPASRSV M+ +LLRAGM VARFNFSHGSHEYHQE
Sbjct  4    MEEQQEGAAG-VMRRRPKTKIVCTLGPASRSVEMIGRLLRAGMCVARFNFSHGSHEYHQE  62

Query  232  TLNNLRQGMENTGILCAVMLDTKG  303
            TL+NLR  ME+TGILCAVMLDTKG
Sbjct  63   TLDNLRAAMESTGILCAVMLDTKG  86



>ref|XP_008340410.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Malus domestica]
 ref|XP_008340411.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Malus domestica]
Length=510

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SRSVPMVEKLLRAGMNVARFNFSHG+H+YHQETL+NLR  M NT ILC
Sbjct  20   PKTKIVCTLGPSSRSVPMVEKLLRAGMNVARFNFSHGTHDYHQETLDNLRTAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_009351777.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Pyrus x bretschneideri]
 ref|XP_009351778.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Pyrus x bretschneideri]
Length=510

 Score =   134 bits (337),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SRSVPMVEKLLRAGMNVARFNFSHG+H+YHQETL+NLR  M NT ILC
Sbjct  20   PKTKIVCTLGPSSRSVPMVEKLLRAGMNVARFNFSHGTHDYHQETLDNLRTAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|KJB23443.1| hypothetical protein B456_004G098000 [Gossypium raimondii]
Length=501

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLL AGMNVARFNFSHGSH YHQETL+NLR  M NTG+L
Sbjct  11   KPKTKIVCTLGPASRSVPMIEKLLMAGMNVARFNFSHGSHAYHQETLDNLRSAMVNTGVL  70

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  71   CAVMLDTKG  79



>ref|XP_009392838.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=510

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETL NLR  M NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLENLRIAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_010248392.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
 ref|XP_010248400.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
 ref|XP_010248408.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
 ref|XP_010248414.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nelumbo nucifera]
Length=510

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGM+VARFNFSHG+HEYHQETLNNL+  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMSVARFNFSHGTHEYHQETLNNLKIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_006448503.1| hypothetical protein CICLE_v10014963mg [Citrus clementina]
 ref|XP_006448504.1| hypothetical protein CICLE_v10014963mg [Citrus clementina]
 gb|ESR61743.1| hypothetical protein CICLE_v10014963mg [Citrus clementina]
 gb|ESR61744.1| hypothetical protein CICLE_v10014963mg [Citrus clementina]
Length=510

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEY QETLNNLR  M NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYQQETLNNLRAAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|KHG23023.1| Pyruvate kinase, cytosolic isozyme [Gossypium arboreum]
Length=501

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGPASRSVPM+EKLL AGMNVARFNFSHGSH YHQETL+NLR  M NTG+L
Sbjct  11   KPKTKIVCTLGPASRSVPMIEKLLMAGMNVARFNFSHGSHAYHQETLDNLRSAMFNTGVL  70

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  71   CAVMLDTKG  79



>ref|NP_001275820.1| pyruvate kinase [Citrus sinensis]
 gb|AAY86035.1| pyruvate kinase [Citrus sinensis]
Length=510

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEY QETLNNLR  M NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYQQETLNNLRAAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_004236881.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Solanum lycopersicum]
 ref|XP_010319352.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Solanum lycopersicum]
Length=510

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SR+VPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNL+  M+NT ILC
Sbjct  20   PKTKIVCTLGPSSRTVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLKIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_006468679.1| PREDICTED: pyruvate kinase, cytosolic isozyme isoform X2 [Citrus 
sinensis]
 gb|KDO77047.1| hypothetical protein CISIN_1g010443mg [Citrus sinensis]
 gb|KDO77048.1| hypothetical protein CISIN_1g010443mg [Citrus sinensis]
 gb|KDO77049.1| hypothetical protein CISIN_1g010443mg [Citrus sinensis]
Length=510

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEY QETLNNLR  M NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYQQETLNNLRAAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_006287542.1| hypothetical protein CARUB_v10000751mg [Capsella rubella]
 gb|EOA20440.1| hypothetical protein CARUB_v10000751mg [Capsella rubella]
Length=510

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M+NTGIL 
Sbjct  20   PKTKIVCTLGPASRSVSMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRTAMQNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_011046575.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Populus euphratica]
 ref|XP_011046576.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Populus euphratica]
 ref|XP_011046578.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Populus euphratica]
Length=512

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT IL 
Sbjct  22   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMQNTNILS  81

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  82   AVMLDTKG  89



>ref|XP_006647265.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Oryza brachyantha]
Length=509

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV M+ +LLRAGM VARFNFSHGSHEYHQETL+NLR  MENTGIL
Sbjct  18   RPKTKIVCTLGPASRSVEMIGRLLRAGMCVARFNFSHGSHEYHQETLDNLRAAMENTGIL  77

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  78   CAVMLDTKG  86



>ref|XP_009351354.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Pyrus x bretschneideri]
Length=512

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT IL 
Sbjct  22   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMQNTNILS  81

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  82   AVMLDTKG  89



>gb|EMT31952.1| Pyruvate kinase, cytosolic isozyme [Aegilops tauschii]
Length=514

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  79   AAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGM  258
            AA     P+TK+VCTLGPASRSVPM+EKLLRAGM+VARFNFSHG+HEYH+ETL+ LRQ M
Sbjct  17   AAADARTPRTKLVCTLGPASRSVPMLEKLLRAGMHVARFNFSHGTHEYHKETLDALRQAM  76

Query  259  ENTGILCAVMLDTKG  303
             NTGILCAVMLDTKG
Sbjct  77   HNTGILCAVMLDTKG  91



>ref|XP_006399365.1| hypothetical protein EUTSA_v10013288mg [Eutrema salsugineum]
 gb|ESQ40818.1| hypothetical protein EUTSA_v10013288mg [Eutrema salsugineum]
Length=510

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+V M+EKLLRAGMNVARFNFSHGSHEYHQ+TLNNLR  M+NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVAMIEKLLRAGMNVARFNFSHGSHEYHQDTLNNLRTAMQNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_010031356.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Eucalyptus grandis]
 ref|XP_010031357.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Eucalyptus grandis]
 ref|XP_010031359.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Eucalyptus grandis]
 ref|XP_010031360.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Eucalyptus grandis]
 gb|KCW50621.1| hypothetical protein EUGRSUZ_J00327 [Eucalyptus grandis]
 gb|KCW50622.1| hypothetical protein EUGRSUZ_J00327 [Eucalyptus grandis]
 gb|KCW50623.1| hypothetical protein EUGRSUZ_J00327 [Eucalyptus grandis]
 gb|KCW50624.1| hypothetical protein EUGRSUZ_J00327 [Eucalyptus grandis]
 gb|KCW50625.1| hypothetical protein EUGRSUZ_J00327 [Eucalyptus grandis]
Length=510

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+VPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M N  ILC
Sbjct  20   PKTKIVCTLGPASRTVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMHNAQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_010427378.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X1 
[Camelina sativa]
Length=494

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            +R KTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSH YHQETL+NLR  M NTGI
Sbjct  14   LRSKTKIVCTLGPASRSVEMIEKLLKAGMNVARFNFSHGSHSYHQETLDNLRTAMANTGI  73

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  74   LCAVMLDTKG  83



>ref|XP_009775114.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Nicotiana sylvestris]
Length=510

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLL AGMNVARFNFSHG+HEYHQETLNNL+  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLHAGMNVARFNFSHGTHEYHQETLNNLKIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_002304847.2| pyruvate kinase family protein [Populus trichocarpa]
 gb|EEE79826.2| pyruvate kinase family protein [Populus trichocarpa]
Length=510

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 69/81 (85%), Gaps = 2/81 (2%)
 Frame = +1

Query  67   ANDGAAGPVM--RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLN  240
            A   AA  VM  RP TKIVCTLGPASRSVP++EKLL+AGMNVARFNFSHGSH+YHQETL+
Sbjct  7    AEASAAAGVMEKRPNTKIVCTLGPASRSVPVIEKLLKAGMNVARFNFSHGSHDYHQETLD  66

Query  241  NLRQGMENTGILCAVMLDTKG  303
            NL   M NTGILCAVMLDTKG
Sbjct  67   NLMAAMVNTGILCAVMLDTKG  87



>ref|XP_009131089.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Brassica 
rapa]
 ref|XP_009131090.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Brassica 
rapa]
Length=510

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+VPM+EKLLRAGMNVARFNFSHGSHEYHQ TL+NLR  M+NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVPMIEKLLRAGMNVARFNFSHGSHEYHQGTLDNLRTAMQNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|KJB80843.1| hypothetical protein B456_013G117600 [Gossypium raimondii]
Length=500

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = +1

Query  91   VMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTG  270
            ++RPKTKIVCTLGPASRSV M+E+LL+AGMNVARFNFSHGSH YHQ+TL+NLR  M NTG
Sbjct  11   IVRPKTKIVCTLGPASRSVEMIERLLKAGMNVARFNFSHGSHAYHQQTLDNLRTAMLNTG  70

Query  271  ILCAVMLDTKG  303
            ILCAVMLDTKG
Sbjct  71   ILCAVMLDTKG  81



>emb|CDX78344.1| BnaA03g02560D [Brassica napus]
Length=493

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+VPM+EKLLRAGMNVARFNFSHGSHEYHQ TL+NLR  M+NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVPMIEKLLRAGMNVARFNFSHGSHEYHQGTLDNLRTAMQNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>emb|CDX81114.1| BnaC03g03680D [Brassica napus]
Length=493

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+VPM+EKLLRAGMNVARFNFSHGSHEYHQ TL+NLR  M+NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVPMIEKLLRAGMNVARFNFSHGSHEYHQGTLDNLRTAMQNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_006848640.1| hypothetical protein AMTR_s00171p00048400 [Amborella trichopoda]
 gb|ERN10221.1| hypothetical protein AMTR_s00171p00048400 [Amborella trichopoda]
Length=510

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHG+HEYHQETL+NLR  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVQMIEKLLRAGMNVARFNFSHGTHEYHQETLDNLRIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|NP_001236056.1| pyruvate kinase [Glycine max]
 gb|AAM94349.1| pyruvate kinase [Glycine max]
Length=510

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M EKLLRAGMNVARFNFSHG+H+YHQETLNNL+  M NTGILC
Sbjct  20   PKTKIVCTLGPASRSVEMTEKLLRAGMNVARFNFSHGTHDYHQETLNNLKTAMHNTGILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_006378878.1| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 ref|XP_006378879.1| pyruvate kinase family protein [Populus trichocarpa]
 ref|XP_002315362.2| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 ref|XP_006378880.1| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 ref|XP_006378881.1| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 ref|XP_006378882.1| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 ref|XP_006378884.1| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 gb|ERP56675.1| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 gb|ERP56676.1| pyruvate kinase family protein [Populus trichocarpa]
 gb|EEF01533.2| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 gb|ERP56677.1| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 gb|ERP56678.1| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 gb|ERP56679.1| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
 gb|ERP56681.1| hypothetical protein POPTR_0010s26150g [Populus trichocarpa]
Length=526

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT IL 
Sbjct  22   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMQNTNILS  81

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  82   AVMLDTKG  89



>ref|XP_008226194.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Prunus mume]
Length=502

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGP+SRSV M+EKLLRAGMNVARFNFSHG+H YHQETL+NLR  M NTGIL
Sbjct  12   RPKTKIVCTLGPSSRSVEMLEKLLRAGMNVARFNFSHGTHAYHQETLDNLRIAMNNTGIL  71

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  72   CAVMLDTKG  80



>ref|XP_007212555.1| hypothetical protein PRUPE_ppa015432mg [Prunus persica]
 gb|EMJ13754.1| hypothetical protein PRUPE_ppa015432mg [Prunus persica]
Length=502

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGP+SRSV M+EKLLRAGMNVARFNFSHG+H YHQETL+NLR  M NTGIL
Sbjct  12   RPKTKIVCTLGPSSRSVEMLEKLLRAGMNVARFNFSHGTHAYHQETLDNLRIAMNNTGIL  71

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  72   CAVMLDTKG  80



>gb|KFK37840.1| hypothetical protein AALP_AA3G036000 [Arabis alpina]
Length=497

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            ++ KTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSH+YHQETL+NLR  M+NTGI
Sbjct  14   LKSKTKIVCTLGPASRSVEMIEKLLKAGMNVARFNFSHGSHDYHQETLDNLRIAMKNTGI  73

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  74   LCAVMLDTKG  83



>ref|XP_006603614.1| PREDICTED: pyruvate kinase isoform X1 [Glycine max]
 gb|KHN19708.1| Pyruvate kinase, cytosolic isozyme [Glycine soja]
Length=510

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M EKLLRAGMNVARFNFSHG+H+YHQETLNNL+  M NTGILC
Sbjct  20   PKTKIVCTLGPASRSVEMTEKLLRAGMNVARFNFSHGTHDYHQETLNNLKTAMHNTGILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|NP_001237968.1| pyruvate kinase, cytosolic isozyme [Glycine max]
 sp|Q42806.1|KPYC_SOYBN RecName: Full=Pyruvate kinase, cytosolic isozyme; Short=PK [Glycine 
max]
 gb|AAA17000.1| pyruvate kinase [Glycine max]
 gb|KHN27491.1| Pyruvate kinase, cytosolic isozyme [Glycine soja]
Length=511

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M EKLLRAGMNVARFNFSHG+H+YHQETLNNL+  M NTGILC
Sbjct  21   PKTKIVCTLGPASRSVEMTEKLLRAGMNVARFNFSHGTHDYHQETLNNLKTAMHNTGILC  80

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  81   AVMLDTKG  88



>gb|AAM94348.1| pyruvate kinase [Glycine max]
Length=511

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M EKLLRAGMNVARFNFSHG+H+YHQETLNNL+  M NTGILC
Sbjct  21   PKTKIVCTLGPASRSVEMTEKLLRAGMNVARFNFSHGTHDYHQETLNNLKTAMHNTGILC  80

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  81   AVMLDTKG  88



>ref|XP_006644058.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Oryza brachyantha]
Length=509

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 72/86 (84%), Gaps = 2/86 (2%)
 Frame = +1

Query  52   MTMMSANDGAAGPVMR--PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYH  225
            MT++     AA  VMR  PK+KIVCTLGPASRSV M+ +LLRAGM VARFNFSHGSHEYH
Sbjct  1    MTVVEEQQEAAVGVMRRRPKSKIVCTLGPASRSVEMIGRLLRAGMCVARFNFSHGSHEYH  60

Query  226  QETLNNLRQGMENTGILCAVMLDTKG  303
            QETL+NLR  ME+TGILCAVMLDTKG
Sbjct  61   QETLDNLRAAMEDTGILCAVMLDTKG  86



>ref|XP_010504451.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Camelina 
sativa]
Length=502

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            +R KTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSH YHQETL+NLR  ++NTGI
Sbjct  14   LRSKTKIVCTLGPASRSVEMIEKLLKAGMNVARFNFSHGSHSYHQETLDNLRTAVDNTGI  73

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  74   LCAVMLDTKG  83



>ref|XP_004162031.1| PREDICTED: LOW QUALITY PROTEIN: pyruvate kinase, cytosolic isozyme-like 
[Cucumis sativus]
Length=510

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            P TKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT ILC
Sbjct  20   PXTKIVCTLGPASRSVTMIEKLLRAGMNVARFNFSHGTHEYHQETLNNLRTAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_006280327.1| hypothetical protein CARUB_v10026251mg [Capsella rubella]
 ref|XP_006280328.1| hypothetical protein CARUB_v10026251mg [Capsella rubella]
 gb|EOA13225.1| hypothetical protein CARUB_v10026251mg [Capsella rubella]
 gb|EOA13226.1| hypothetical protein CARUB_v10026251mg [Capsella rubella]
Length=510

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVTMIEKLLKAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTGIL AVMLDTKG
Sbjct  70   TAMQNTGILAAVMLDTKG  87



>ref|XP_006479069.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Citrus sinensis]
Length=513

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M EKLLRAGMNVARFNFSHGSH YHQETL+NLR  M NTGILC
Sbjct  23   PKTKIVCTLGPASRSVEMAEKLLRAGMNVARFNFSHGSHAYHQETLDNLRTAMNNTGILC  82

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  83   AVMLDTKG  90



>ref|XP_010680471.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            R KTKIVCTLGPASRSV ++EKLLRAGMNVARFNFSHGSH YHQETL+NLRQ M NTGIL
Sbjct  7    RRKTKIVCTLGPASRSVVLLEKLLRAGMNVARFNFSHGSHAYHQETLDNLRQAMHNTGIL  66

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  67   CAVMLDTKG  75



>gb|ADZ96382.2| pyruvate kinase [Eriobotrya japonica]
Length=510

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SRSVPMVE+LLRAGMNVARFNFSHG+H+YHQETL+NLR  M NT ILC
Sbjct  20   PKTKIVCTLGPSSRSVPMVEELLRAGMNVARFNFSHGTHDYHQETLDNLRTAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|NP_201173.1| pyruvate kinase [Arabidopsis thaliana]
 dbj|BAB10461.1| pyruvate kinase [Arabidopsis thaliana]
 gb|AED97785.1| pyruvate kinase [Arabidopsis thaliana]
Length=510

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVTMIEKLLKAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTGIL AVMLDTKG
Sbjct  70   TAMQNTGILAAVMLDTKG  87



>gb|KFK36990.1| hypothetical protein AALP_AA4G198100 [Arabis alpina]
Length=497

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 69/78 (88%), Gaps = 4/78 (5%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            N+GA    ++ KTKIVCTLGPASRSV M+EKLL AGMNVARFNFSHGSH+YHQETL+NLR
Sbjct  10   NNGA----LKSKTKIVCTLGPASRSVEMIEKLLNAGMNVARFNFSHGSHDYHQETLDNLR  65

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTGILCAVMLDTKG
Sbjct  66   IAMKNTGILCAVMLDTKG  83



>ref|XP_002878046.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54305.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 68/79 (86%), Gaps = 4/79 (5%)
 Frame = +1

Query  67   ANDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNL  246
            A +GA    +R KTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSH YHQETL+NL
Sbjct  9    ATNGA----LRSKTKIVCTLGPASRSVVMIEKLLKAGMNVARFNFSHGSHSYHQETLDNL  64

Query  247  RQGMENTGILCAVMLDTKG  303
            R  M NTGILCAVMLDTKG
Sbjct  65   RTAMANTGILCAVMLDTKG  83



>dbj|BAF01483.1| pyruvate kinase [Arabidopsis thaliana]
Length=510

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSHEYHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVTMIEKLLKAGMNVARFNFSHGSHEYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTGIL AVMLDTKG
Sbjct  70   TAMQNTGILAAVMLDTKG  87



>ref|XP_002869613.1| hypothetical protein ARALYDRAFT_329043 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45872.1| hypothetical protein ARALYDRAFT_329043 [Arabidopsis lyrata subsp. 
lyrata]
Length=497

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV MVEKLL AGM+VARFNFSHGS+EYHQETL+NLRQ M NTG+L
Sbjct  6    RPKTKIVCTLGPASRSVSMVEKLLMAGMSVARFNFSHGSYEYHQETLDNLRQAMLNTGML  65

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  66   CAVMLDTKG  74



>ref|XP_010427343.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X1 
[Camelina sativa]
Length=493

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            +R KTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSH YHQETL+NLR  M NTGI
Sbjct  14   LRSKTKIVCTLGPASRSVEMIEKLLKAGMNVARFNFSHGSHSYHQETLDNLRTAMANTGI  73

Query  274  LCAVMLDTKG  303
            +CAVMLDTKG
Sbjct  74   ICAVMLDTKG  83



>ref|XP_011025111.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Populus euphratica]
Length=510

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RP TKIVCTLGPASRSVP++EKLL+AGMNVARFNFSHGSH+YHQETL+NL   M NTGIL
Sbjct  19   RPNTKIVCTLGPASRSVPVIEKLLKAGMNVARFNFSHGSHDYHQETLDNLMAAMVNTGIL  78

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  79   CAVMLDTKG  87



>emb|CDY27175.1| BnaA09g36270D [Brassica napus]
Length=452

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/67 (90%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +1

Query  103  KTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILCA  282
            KTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHGSHEYHQET +NLR  M+NTGILCA
Sbjct  15   KTKIVCTLGPASRSVEMIEKLLRAGMNVARFNFSHGSHEYHQETRDNLRTAMQNTGILCA  74

Query  283  VMLDTKG  303
            VMLDTKG
Sbjct  75   VMLDTKG  81



>gb|EPS70224.1| pyruvate kinase, partial [Genlisea aurea]
Length=512

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+VPM+EKLLRAGMNVARFNFSHG H YHQETLNNLR  M NT ILC
Sbjct  22   PKTKIVCTLGPASRTVPMLEKLLRAGMNVARFNFSHGDHAYHQETLNNLRIAMHNTHILC  81

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  82   AVMLDTKG  89



>ref|NP_001275085.1| pyruvate kinase, cytosolic isozyme [Solanum tuberosum]
 sp|P22200.1|KPYC_SOLTU RecName: Full=Pyruvate kinase, cytosolic isozyme; Short=PK [Solanum 
tuberosum]
 emb|CAA37727.1| pyruvate kinase [Solanum tuberosum]
Length=510

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SR+VPM+EKLLRAGMNVARFNFSHG+HEYHQETL+NL+  M+NT ILC
Sbjct  20   PKTKIVCTLGPSSRTVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLKIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|AAA13372.2| cytosolic pyruvate kinase [Solanum tuberosum]
Length=510

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SR+VPM+EKLLRAGMNVARFNFSHG+HEYHQETL+NL+  M+NT ILC
Sbjct  20   PKTKIVCTLGPSSRTVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLKIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_007150867.1| hypothetical protein PHAVU_004G000800g [Phaseolus vulgaris]
 gb|ESW22861.1| hypothetical protein PHAVU_004G000800g [Phaseolus vulgaris]
Length=510

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M EKLLRAGMNVARFNFSHG+H+YHQETLNNL+  M NTGILC
Sbjct  20   PKTKIVCTLGPASRSVEMTEKLLRAGMNVARFNFSHGTHDYHQETLNNLKIAMHNTGILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|EEC70399.1| hypothetical protein OsI_01382 [Oryza sativa Indica Group]
Length=518

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 71/83 (86%), Gaps = 3/83 (4%)
 Frame = +1

Query  58   MMSANDGAAGPVMR--PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQE  231
            M    +GAAG VMR  PKTKIVCTLGPASRSV M+ +LLRAGM VARFNFSHGSHEYHQE
Sbjct  4    MEEQQEGAAG-VMRRRPKTKIVCTLGPASRSVEMIGRLLRAGMCVARFNFSHGSHEYHQE  62

Query  232  TLNNLRQGMENTGILCAVMLDTK  300
            TL+NLR  ME+TGILCAVMLDTK
Sbjct  63   TLDNLRAAMESTGILCAVMLDTK  85



>ref|XP_008383188.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Malus domestica]
Length=502

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGP+SRSV M+EKLLRAGMNVARFNFSHG+H YHQETL+NLR  M NTGIL
Sbjct  12   KPKTKIVCTLGPSSRSVEMLEKLLRAGMNVARFNFSHGTHAYHQETLDNLRTAMNNTGIL  71

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  72   CAVMLDTKG  80



>ref|XP_010423047.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Camelina sativa]
 ref|XP_010423048.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Camelina sativa]
 ref|XP_010423049.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Camelina sativa]
 ref|XP_010452870.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Camelina sativa]
Length=510

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+V M+EKLLRAGMNVARFNFSHGSHEYHQETL+NLR  M NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVSMIEKLLRAGMNVARFNFSHGSHEYHQETLDNLRTAMHNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_002513157.1| pyruvate kinase, putative [Ricinus communis]
 gb|EEF49660.1| pyruvate kinase, putative [Ricinus communis]
Length=508

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M NT IL 
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMHNTQILS  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_002864862.1| hypothetical protein ARALYDRAFT_919664 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41121.1| hypothetical protein ARALYDRAFT_919664 [Arabidopsis lyrata subsp. 
lyrata]
Length=510

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 66/78 (85%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSHEYHQETL NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVTMIEKLLKAGMNVARFNFSHGSHEYHQETLENLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M+NTGIL AVMLDTKG
Sbjct  70   TAMQNTGILAAVMLDTKG  87



>ref|XP_010491502.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Camelina 
sativa]
 ref|XP_010491503.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Camelina 
sativa]
Length=510

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+V M+EKLLRAGMNVARFNFSHGSHEYHQ+TL+NLR  M+NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVSMIEKLLRAGMNVARFNFSHGSHEYHQDTLDNLRTAMQNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>emb|CDP16888.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   132 bits (331),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLL AGMNVARFNFSHG+HEYHQETL+NLR  M NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLHAGMNVARFNFSHGTHEYHQETLDNLRIAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|NP_189225.1| pyruvate kinase [Arabidopsis thaliana]
 dbj|BAB01059.1| pyruvate kinase [Arabidopsis thaliana]
 gb|AEE77095.1| pyruvate kinase [Arabidopsis thaliana]
Length=497

 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 68/78 (87%), Gaps = 4/78 (5%)
 Frame = +1

Query  67   ANDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNL  246
            A +GA    +R KTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSH YHQETL+NL
Sbjct  9    ATNGA----LRSKTKIVCTLGPASRSVEMIEKLLKAGMNVARFNFSHGSHSYHQETLDNL  64

Query  247  RQGMENTGILCAVMLDTK  300
            R  M+NTGILCAVMLDTK
Sbjct  65   RTAMDNTGILCAVMLDTK  82



>ref|XP_004489183.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Cicer arietinum]
Length=510

 Score =   131 bits (330),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHG+H+YHQETLNNL+  M+ TGILC
Sbjct  20   PKTKIVCTLGPASRSVEMIEKLLKAGMNVARFNFSHGTHDYHQETLNNLKSAMQATGILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_002876321.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52580.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   131 bits (330),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            ++ KTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSH YHQETL+NLR  M NTGI
Sbjct  14   LKSKTKIVCTLGPASRSVVMIEKLLKAGMNVARFNFSHGSHSYHQETLDNLRTAMANTGI  73

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  74   LCAVMLDTKG  83



>ref|XP_011033100.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Populus euphratica]
 ref|XP_011033101.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Populus euphratica]
Length=512

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            P+TKIVCTLGP+SRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT IL 
Sbjct  22   PRTKIVCTLGPSSRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMQNTNILA  81

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  82   AVMLDTKG  89



>ref|XP_002310914.1| pyruvate kinase family protein [Populus trichocarpa]
 gb|ABK95150.1| unknown [Populus trichocarpa]
 gb|EEE88281.1| pyruvate kinase family protein [Populus trichocarpa]
Length=512

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            P+TKIVCTLGP+SRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNLR  M+NT IL 
Sbjct  22   PRTKIVCTLGPSSRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLRIAMQNTNILA  81

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  82   AVMLDTKG  89



>emb|CDM82952.1| unnamed protein product [Triticum aestivum]
Length=513

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +1

Query  40   SEGEMTMMSAND-GAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSH  216
            S GE++   A + G A    RPKTKIVCTLGPASRSV M+EKLLRAGM VARFNFSHGSH
Sbjct  3    SNGELSQPQAGEYGLAVMRRRPKTKIVCTLGPASRSVDMIEKLLRAGMCVARFNFSHGSH  62

Query  217  EYHQETLNNLRQGMENTGILCAVMLDTKG  303
            +YHQETL+NL   M+ TGILCAVMLDTKG
Sbjct  63   DYHQETLDNLHAAMDRTGILCAVMLDTKG  91



>gb|KHG01431.1| Pyruvate kinase, cytosolic isozyme [Gossypium arboreum]
Length=488

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +1

Query  70   NDGAAGPVM---RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLN  240
            ND A G  +   +PKTKIVCTLGP+ RSVPM+EKLL+AG++VARFNFSHGSH+YHQETL+
Sbjct  3    NDVAIGSAVMESKPKTKIVCTLGPSCRSVPMIEKLLKAGLSVARFNFSHGSHDYHQETLD  62

Query  241  NLRQGMENTGILCAVMLDTKG  303
            NLR  M NTGI CAVMLDTKG
Sbjct  63   NLRAAMINTGIFCAVMLDTKG  83



>gb|KDP20274.1| hypothetical protein JCGZ_06860 [Jatropha curcas]
Length=509

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGP SRSV M+E+LLRAGMNVARFNFSHGSH YHQET++NLR  M NTGIL
Sbjct  18   RPKTKIVCTLGPQSRSVDMLERLLRAGMNVARFNFSHGSHAYHQETIDNLRSAMNNTGIL  77

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  78   CAVMLDTKG  86



>ref|XP_002525455.1| pyruvate kinase, putative [Ricinus communis]
 gb|EEF36945.1| pyruvate kinase, putative [Ricinus communis]
Length=508

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGP SRSV M+E+LLRAGMNVARFNFSHG+H YHQETL+NLR  M NTGIL
Sbjct  17   RPKTKIVCTLGPQSRSVTMLERLLRAGMNVARFNFSHGTHAYHQETLDNLRTAMNNTGIL  76

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  77   CAVMLDTKG  85



>ref|XP_009413101.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413102.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=510

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 66/78 (85%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETL+NL 
Sbjct  15   NDGRV-----PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLG  69

Query  250  QGMENTGILCAVMLDTKG  303
              M NT ILCAVMLDTKG
Sbjct  70   VAMHNTQILCAVMLDTKG  87



>ref|XP_002457647.1| hypothetical protein SORBIDRAFT_03g011130 [Sorghum bicolor]
 gb|EES02767.1| hypothetical protein SORBIDRAFT_03g011130 [Sorghum bicolor]
Length=509

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/69 (87%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV M+ +LLRAGM VARFNFSHGSHEYHQETL+NLR  ME TGIL
Sbjct  19   RPKTKIVCTLGPASRSVEMISRLLRAGMCVARFNFSHGSHEYHQETLDNLRAAMELTGIL  78

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  79   CAVMLDTKG  87



>ref|XP_010444284.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X2 
[Camelina sativa]
Length=494

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 66/78 (85%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHGSH+YHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVTMIEKLLRAGMNVARFNFSHGSHDYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M NTGIL AVMLDTKG
Sbjct  70   TAMLNTGILAAVMLDTKG  87



>ref|XP_010427374.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X1 
[Camelina sativa]
Length=502

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            +R KTKIVCTLGPASRSV M+EKLL+AGM VARFNFSHGSH YHQETL+NLR  M NTGI
Sbjct  14   LRSKTKIVCTLGPASRSVEMIEKLLKAGMTVARFNFSHGSHAYHQETLDNLRTAMANTGI  73

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  74   LCAVMLDTKG  83



>gb|KFK34626.1| hypothetical protein AALP_AA5G170500 [Arabis alpina]
Length=494

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 69/78 (88%), Gaps = 4/78 (5%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            N+GA    ++ KTKIVCTLGPASRSV M+EKLL AGMNVARFNFSHGSH+YHQETL+NLR
Sbjct  10   NNGA----LKSKTKIVCTLGPASRSVEMIEKLLNAGMNVARFNFSHGSHDYHQETLDNLR  65

Query  250  QGMENTGILCAVMLDTKG  303
              ++NTGILCAVMLDTKG
Sbjct  66   LAIKNTGILCAVMLDTKG  83



>ref|NP_196474.1| pyruvate kinase [Arabidopsis thaliana]
 dbj|BAB10006.1| pyruvate kinase [Arabidopsis thaliana]
 gb|AAP04149.1| putative pyruvate kinase [Arabidopsis thaliana]
 gb|AAP40363.1| putative pyruvate kinase [Arabidopsis thaliana]
 dbj|BAF01459.1| pyruvate kinase [Arabidopsis thaliana]
 gb|AED91324.1| pyruvate kinase [Arabidopsis thaliana]
Length=510

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+V M+EKLL+AGMNVARFNFSHGSHEYHQETL+NLR  M NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVSMIEKLLKAGMNVARFNFSHGSHEYHQETLDNLRSAMHNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_010444283.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X1 
[Camelina sativa]
Length=510

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 66/78 (85%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHGSH+YHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVTMIEKLLRAGMNVARFNFSHGSHDYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M NTGIL AVMLDTKG
Sbjct  70   TAMLNTGILAAVMLDTKG  87



>ref|XP_002871348.1| hypothetical protein ARALYDRAFT_487699 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47607.1| hypothetical protein ARALYDRAFT_487699 [Arabidopsis lyrata subsp. 
lyrata]
Length=510

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASR+V M+EKLL+AGMNVARFNFSHGSHEYHQETL+NLR  M NTGIL 
Sbjct  20   PKTKIVCTLGPASRTVSMIEKLLKAGMNVARFNFSHGSHEYHQETLDNLRTAMHNTGILA  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_010485774.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Camelina 
sativa]
Length=510

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 67/78 (86%), Gaps = 4/78 (5%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            N+GA    ++ KTKIVCTLGPASRSV MVEKLLRAGMNVARFNFSHGSH YHQETL+NLR
Sbjct  10   NNGA----LKSKTKIVCTLGPASRSVEMVEKLLRAGMNVARFNFSHGSHSYHQETLDNLR  65

Query  250  QGMENTGILCAVMLDTKG  303
              MENT I CAVMLDTKG
Sbjct  66   TAMENTCIPCAVMLDTKG  83



>ref|XP_008227713.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Prunus mume]
Length=510

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SRSV M+EKLLRAGMNVARFNFSHG+H+YHQETLNNLR  M NT ILC
Sbjct  20   PKTKIVCTLGPSSRSVVMLEKLLRAGMNVARFNFSHGTHDYHQETLNNLRTAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|AGI60277.1| pyruvate kinase [Dendrobium catenatum]
Length=510

 Score =   130 bits (327),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSVPM+EKLLRAGMNVARFNFSHGSHEYHQETL NL+  M+NT ILC
Sbjct  20   PKTKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGSHEYHQETLENLKIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>ref|XP_006299321.1| hypothetical protein CARUB_v10015478mg [Capsella rubella]
 gb|EOA32219.1| hypothetical protein CARUB_v10015478mg [Capsella rubella]
Length=510

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 66/78 (85%), Gaps = 4/78 (5%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            N GA    +R KTKIVCTLGPASRSV MVEKLL AGMNVARFNFSHGSH YHQETL+NLR
Sbjct  10   NKGA----LRSKTKIVCTLGPASRSVEMVEKLLNAGMNVARFNFSHGSHSYHQETLDNLR  65

Query  250  QGMENTGILCAVMLDTKG  303
              MEN+GI CAVMLDTKG
Sbjct  66   TAMENSGIPCAVMLDTKG  83



>gb|EMT02217.1| Pyruvate kinase, cytosolic isozyme [Aegilops tauschii]
Length=537

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = +1

Query  40   SEGEMTMMSAND-GAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSH  216
            S GE++   A + G A    RPKTKIVCTLGPASRSV M+EKLLRAGM VARFNFSHGSH
Sbjct  3    SNGELSQPQAGEYGLAVMRRRPKTKIVCTLGPASRSVDMIEKLLRAGMCVARFNFSHGSH  62

Query  217  EYHQETLNNLRQGMENTGILCAVMLDTK  300
            +YHQETL+NL   ME TGILCAVMLDTK
Sbjct  63   DYHQETLDNLHAAMERTGILCAVMLDTK  90



>gb|AFJ25032.1| pyruvate kinase [Lonicera japonica]
Length=510

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SRSVPM+EKLLRAGMNVARFNFSHG+HEYHQETLNNL+    NT ILC
Sbjct  20   PKTKIVCTLGPSSRSVPMLEKLLRAGMNVARFNFSHGTHEYHQETLNNLKIAQLNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDTKG
Sbjct  80   AVMLDTKG  87



>gb|AAF44707.1| cytosolic pyruvate kinase [Lilium longiflorum]
Length=510

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTK+VCTLGP+SRSVPM+EKLLRAGMN ARFNFSHG+HEYHQETL+NLR  M+NT ILC
Sbjct  20   PKTKLVCTLGPSSRSVPMLEKLLRAGMNTARFNFSHGTHEYHQETLDNLRIAMQNTQILC  79

Query  280  AVMLDTKG  303
            AV+LDTKG
Sbjct  80   AVVLDTKG  87



>ref|XP_010463877.1| PREDICTED: probable pyruvate kinase, cytosolic isozyme [Camelina 
sativa]
Length=510

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            ++ KTKIVCTLGPASRSV MVEKLLRAGMNVARFNFSHGSH YHQETL+NLR  MENT I
Sbjct  14   LKSKTKIVCTLGPASRSVEMVEKLLRAGMNVARFNFSHGSHSYHQETLDNLRTAMENTCI  73

Query  274  LCAVMLDTKG  303
             CAVMLDTKG
Sbjct  74   PCAVMLDTKG  83



>ref|XP_002992085.1| hypothetical protein SELMODRAFT_134716 [Selaginella moellendorffii]
 gb|EFJ06845.1| hypothetical protein SELMODRAFT_134716 [Selaginella moellendorffii]
Length=510

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  85   GPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMEN  264
            GP + PKTKI+CTLGP SR VPM+EKLLR GMNVARFNFSHGS+EYHQETL NL+  M N
Sbjct  15   GPRLHPKTKIICTLGPRSRDVPMLEKLLRTGMNVARFNFSHGSYEYHQETLENLKSAMSN  74

Query  265  TGILCAVMLDTKG  303
            T I+CAVMLDTKG
Sbjct  75   TQIMCAVMLDTKG  87



>ref|XP_007213928.1| hypothetical protein PRUPE_ppa004434mg [Prunus persica]
 gb|EMJ15127.1| hypothetical protein PRUPE_ppa004434mg [Prunus persica]
Length=510

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SRSV M+EKLLRAGMNVARFNFSHG+H+YHQETLNNLR  M NT ILC
Sbjct  20   PKTKIVCTLGPSSRSVVMLEKLLRAGMNVARFNFSHGTHDYHQETLNNLRTAMHNTQILC  79

Query  280  AVMLDTKG  303
            A+MLDTKG
Sbjct  80   AIMLDTKG  87



>gb|KEH24719.1| pyruvate kinase family protein [Medicago truncatula]
Length=510

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 67/78 (86%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHG+H+YHQETL+NL+
Sbjct  15   NDGRV-----PKTKIVCTLGPASRSVEMIEKLLKAGMNVARFNFSHGTHQYHQETLDNLK  69

Query  250  QGMENTGILCAVMLDTKG  303
              M +TGILCAVMLDTKG
Sbjct  70   SAMHSTGILCAVMLDTKG  87



>ref|XP_002982445.1| hypothetical protein SELMODRAFT_116243 [Selaginella moellendorffii]
 gb|EFJ16690.1| hypothetical protein SELMODRAFT_116243 [Selaginella moellendorffii]
Length=510

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  85   GPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMEN  264
            GP + PKTKI+CTLGP SR VPM+EKLLR GMNVARFNFSHGS+EYHQETL NL+  M N
Sbjct  15   GPRLHPKTKIICTLGPRSRDVPMLEKLLRTGMNVARFNFSHGSYEYHQETLENLKAAMSN  74

Query  265  TGILCAVMLDTKG  303
            T I+CAVMLDTKG
Sbjct  75   TQIMCAVMLDTKG  87



>ref|XP_008389051.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Malus domestica]
 ref|XP_008389052.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Malus domestica]
Length=510

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SRSVPMVEKLLRAGMNVARFNFSHG+H+YHQ TL+NLR  M NT ILC
Sbjct  20   PKTKIVCTLGPSSRSVPMVEKLLRAGMNVARFNFSHGTHDYHQXTLDNLRTAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDT G
Sbjct  80   AVMLDTXG  87



>ref|XP_008350807.1| PREDICTED: LOW QUALITY PROTEIN: pyruvate kinase, cytosolic isozyme-like 
[Malus domestica]
Length=510

 Score =   129 bits (325),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SRSVPMVEKLLRAGMNVARFNFSHG+H+YHQ TL+NLR  M NT ILC
Sbjct  20   PKTKIVCTLGPSSRSVPMVEKLLRAGMNVARFNFSHGTHDYHQXTLDNLRTAMHNTQILC  79

Query  280  AVMLDTKG  303
            AVMLDT G
Sbjct  80   AVMLDTXG  87



>ref|XP_002882328.1| hypothetical protein ARALYDRAFT_340564 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58587.1| hypothetical protein ARALYDRAFT_340564 [Arabidopsis lyrata subsp. 
lyrata]
Length=510

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 67/78 (86%), Gaps = 4/78 (5%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            N+GA    ++ KTKIVCTLGPASRSV MVEKLL+AGMNVARFNFSHGSH YHQETL+NLR
Sbjct  10   NNGA----LKSKTKIVCTLGPASRSVEMVEKLLKAGMNVARFNFSHGSHSYHQETLDNLR  65

Query  250  QGMENTGILCAVMLDTKG  303
              MENT I CAVMLDTKG
Sbjct  66   TAMENTCIPCAVMLDTKG  83



>ref|XP_010516169.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like isoform X1 
[Camelina sativa]
Length=502

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            +R KTKIVCTLGPASRSV M+EKLL+AGM VARFNFSHGSH YHQETL+NL+  M NTGI
Sbjct  14   LRSKTKIVCTLGPASRSVEMIEKLLKAGMTVARFNFSHGSHSYHQETLDNLQTAMANTGI  73

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  74   LCAVMLDTKG  83



>ref|XP_004297699.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Fragaria vesca 
subsp. vesca]
Length=510

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGP+SRSV M+EKLLRAGMNVARFNFSHG+H+YHQETLNNLR  M NT ILC
Sbjct  20   PKTKIVCTLGPSSRSVEMLEKLLRAGMNVARFNFSHGTHDYHQETLNNLRTAMHNTQILC  79

Query  280  AVMLDTKG  303
            A+MLDTKG
Sbjct  80   ALMLDTKG  87



>ref|XP_007030173.1| Pyruvate kinase family protein [Theobroma cacao]
 gb|EOY10675.1| Pyruvate kinase family protein [Theobroma cacao]
Length=500

 Score =   129 bits (324),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            +RPKTKIVCTLGPASRSV M+EKLL+AGMNVARFNFSHGSH YHQETL+NLR  M NT I
Sbjct  13   VRPKTKIVCTLGPASRSVEMIEKLLKAGMNVARFNFSHGSHAYHQETLDNLRTAMNNTCI  72

Query  274  LCAVMLDTKG  303
             CAVMLDTKG
Sbjct  73   PCAVMLDTKG  82



>gb|EMS59451.1| Pyruvate kinase, cytosolic isozyme [Triticum urartu]
Length=554

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV M+EKLLRAGM VARFNFSHGSH+YHQETL+NL   ME TGIL
Sbjct  4    RPKTKIVCTLGPASRSVDMIEKLLRAGMCVARFNFSHGSHDYHQETLDNLHAAMERTGIL  63

Query  277  CAVMLDTKG  303
            CAVMLDTK 
Sbjct  64   CAVMLDTKA  72



>ref|XP_010484121.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Camelina 
sativa]
Length=510

 Score =   129 bits (324),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 65/78 (83%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHGSH+YHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVTMIEKLLRAGMNVARFNFSHGSHDYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M NTGIL A MLDTKG
Sbjct  70   TAMLNTGILAAAMLDTKG  87



>ref|XP_010460879.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Camelina 
sativa]
Length=510

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/78 (79%), Positives = 66/78 (85%), Gaps = 5/78 (6%)
 Frame = +1

Query  70   NDGAAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLR  249
            NDG       PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFS+GSH+YHQETL+NLR
Sbjct  15   NDGRT-----PKTKIVCTLGPASRSVTMIEKLLRAGMNVARFNFSYGSHDYHQETLDNLR  69

Query  250  QGMENTGILCAVMLDTKG  303
              M NTGIL AVMLDTKG
Sbjct  70   TAMLNTGILAAVMLDTKG  87



>ref|XP_006651336.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Oryza brachyantha]
Length=513

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 67/80 (84%), Gaps = 4/80 (5%)
 Frame = +1

Query  76   GAAGPV----MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNN  243
            G AGP      RPKTKIVCTLGPASRSV M  +LLRAGM VARFNFSHGSHEYHQETL+N
Sbjct  10   GGAGPEETWRRRPKTKIVCTLGPASRSVEMCARLLRAGMCVARFNFSHGSHEYHQETLDN  69

Query  244  LRQGMENTGILCAVMLDTKG  303
            LR+ ME TG++CAVMLDTKG
Sbjct  70   LRRAMELTGLICAVMLDTKG  89



>ref|NP_187055.1| pyruvate kinase [Arabidopsis thaliana]
 gb|AAF05863.1|AC011698_14 putative pyruvate kinase [Arabidopsis thaliana]
 gb|ABE65916.1| pyruvate kinase [Arabidopsis thaliana]
 gb|AEE74031.1| pyruvate kinase [Arabidopsis thaliana]
Length=510

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            ++ KTKIVCTLGPASRSV MVEKLL+AGMNVARFNFSHGSH YHQETL+NLR  MENT I
Sbjct  14   LKSKTKIVCTLGPASRSVEMVEKLLKAGMNVARFNFSHGSHSYHQETLDNLRTAMENTCI  73

Query  274  LCAVMLDTKG  303
             CAVMLDTKG
Sbjct  74   PCAVMLDTKG  83



>gb|KIZ06088.1| pyruvate kinase [Monoraphidium neglectum]
Length=508

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  79   AAGPVMRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGM  258
            A  P    KTK+VCTLGPASRSV ++E+LLRAGMNVARFNFSHGSHEYHQETLN LR+ M
Sbjct  11   AGTPSTISKTKVVCTLGPASRSVEVIEELLRAGMNVARFNFSHGSHEYHQETLNALRKAM  70

Query  259  ENTGILCAVMLDTKG  303
            ENT I+CAVMLDTKG
Sbjct  71   ENTKIMCAVMLDTKG  85



>gb|KJB83398.1| hypothetical protein B456_013G245400 [Gossypium raimondii]
Length=494

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            +PKTKIVCTLGP+ RSV M+EKLL+AG+NVARFNFSHGSH+YHQETL+NLR  M NTGI 
Sbjct  4    KPKTKIVCTLGPSCRSVSMIEKLLKAGLNVARFNFSHGSHDYHQETLDNLRAAMINTGIF  63

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  64   CAVMLDTKG  72



>gb|ACN34281.1| unknown [Zea mays]
 tpg|DAA54174.1| TPA: pyruvate kinase [Zea mays]
Length=509

 Score =   128 bits (322),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV M+ +LLRAGM VARFNFSHGSHEYHQETL+NL   ME TGIL
Sbjct  18   RPKTKIVCTLGPASRSVEMISRLLRAGMCVARFNFSHGSHEYHQETLDNLHAAMELTGIL  77

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  78   CAVMLDTKG  86



>ref|NP_001105266.1| PK protein [Zea mays]
 gb|AAT41588.1| putative pyruvate kinase [Zea mays]
Length=509

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV M+ +LLRAGM VARFNFSHGSHEYHQETL+NL   ME TGIL
Sbjct  18   RPKTKIVCTLGPASRSVEMISRLLRAGMCVARFNFSHGSHEYHQETLDNLHAAMELTGIL  77

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  78   CAVMLDTKG  86



>gb|ACG32257.1| pyruvate kinase, cytosolic isozyme [Zea mays]
Length=509

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV M+ +LLRAGM VARFNFSHGSHEYHQETL+NL   ME TGIL
Sbjct  18   RPKTKIVCTLGPASRSVEMISRLLRAGMCVARFNFSHGSHEYHQETLDNLHAAMELTGIL  77

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  78   CAVMLDTKG  86



>ref|XP_010669400.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010669401.1| PREDICTED: pyruvate kinase, cytosolic isozyme [Beta vulgaris 
subsp. vulgaris]
Length=510

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  100  PKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILC  279
            PKTKIVCTLGPASRSV M+EKLLRAGMNVARFNFSHG+HEYHQETL+NL+  M NT ILC
Sbjct  20   PKTKIVCTLGPASRSVVMLEKLLRAGMNVARFNFSHGTHEYHQETLDNLKIAMHNTQILC  79

Query  280  AVMLDTKG  303
            A+MLDTKG
Sbjct  80   ALMLDTKG  87



>ref|XP_009134750.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Brassica 
rapa]
Length=492

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/67 (87%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  103  KTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILCA  282
            KTKIVCTLGP SRSV M+EKLL+AGMNVARFNFSHGSHEYHQ TL+NLR  M+NTGILCA
Sbjct  15   KTKIVCTLGPVSRSVDMIEKLLKAGMNVARFNFSHGSHEYHQGTLDNLRIAMKNTGILCA  74

Query  283  VMLDTKG  303
            VMLDTKG
Sbjct  75   VMLDTKG  81



>ref|XP_002282379.2| PREDICTED: pyruvate kinase, cytosolic isozyme [Vitis vinifera]
Length=500

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV ++EKLLRAGMNVARFNFSHGSH YHQ+TL+NLR  M NT  L
Sbjct  9    RPKTKIVCTLGPASRSVEVIEKLLRAGMNVARFNFSHGSHAYHQQTLDNLRTAMANTETL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|XP_007512297.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66385.1| predicted protein [Bathycoccus prasinos]
Length=524

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 3/99 (3%)
 Frame = +1

Query  16   FQLSVADRSEGEMTMMSANDGAAGPV---MRPKTKIVCTLGPASRSVPMVEKLLRAGMNV  186
              L+  D+  G+  ++       G V    RPK+KIVCTLGP SR+VP++EK+L+AGM++
Sbjct  10   ISLTTDDQPHGKKHILDNGISFKGEVTSSYRPKSKIVCTLGPVSRTVPILEKMLKAGMSI  69

Query  187  ARFNFSHGSHEYHQETLNNLRQGMENTGILCAVMLDTKG  303
            ARFNFSHGSHEYHQETL+NLRQ  ENTGI+CA++ DTKG
Sbjct  70   ARFNFSHGSHEYHQETLDNLRQASENTGIMCAILQDTKG  108



>emb|CAN70030.1| hypothetical protein VITISV_031893 [Vitis vinifera]
Length=500

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV ++EKLLRAGMNVARFNFSHGSH YHQ+TL+NLR  M NT  L
Sbjct  9    RPKTKIVCTLGPASRSVEVIEKLLRAGMNVARFNFSHGSHAYHQQTLDNLRTAMANTETL  68

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  69   CAVMLDTKG  77



>ref|NP_191124.1| pyruvate kinase [Arabidopsis thaliana]
 emb|CAB81590.1| pyruvate kinase-like protein [Arabidopsis thaliana]
 gb|AEE79416.1| pyruvate kinase [Arabidopsis thaliana]
Length=510

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            +R KTKI+CTLGP SRSV M+EKLL+AGMNVARFNFSHGSH YHQETL+NLR  M+NTGI
Sbjct  14   LRSKTKIICTLGPVSRSVEMIEKLLKAGMNVARFNFSHGSHSYHQETLDNLRTAMDNTGI  73

Query  274  LCAVMLDTKG  303
            L AVMLDTKG
Sbjct  74   LSAVMLDTKG  83



>dbj|BAK04454.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 66/79 (84%), Gaps = 4/79 (5%)
 Frame = +1

Query  79   AAGPV----MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNL  246
            AAGP      RPKTKIVCTLGPASRSV M  +LLRAGM VARFNFSHGSHEYHQETL+NL
Sbjct  7    AAGPEEIWRRRPKTKIVCTLGPASRSVEMCARLLRAGMCVARFNFSHGSHEYHQETLDNL  66

Query  247  RQGMENTGILCAVMLDTKG  303
             + M+ TGILCAVMLDTKG
Sbjct  67   HKAMDITGILCAVMLDTKG  85



>ref|XP_007151826.1| hypothetical protein PHAVU_004G078400g [Phaseolus vulgaris]
 gb|ESW23820.1| hypothetical protein PHAVU_004G078400g [Phaseolus vulgaris]
Length=572

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  94   MRPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGI  273
            ++ KTKIVCTLGP+SRSV M+EKLL+AGMNVARFNFSHGSH YHQETL+NLR  M NTGI
Sbjct  80   VKAKTKIVCTLGPSSRSVEMLEKLLKAGMNVARFNFSHGSHYYHQETLDNLRNAMNNTGI  139

Query  274  LCAVMLDTKG  303
            LCAVMLDTKG
Sbjct  140  LCAVMLDTKG  149



>ref|XP_004971545.1| PREDICTED: uncharacterized protein LOC101758684 [Setaria italica]
Length=1102

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +1

Query  97   RPKTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGIL  276
            RPKTKIVCTLGPASRSV M+ +LLR GM VARFNFSHGSHEYHQETL+NLR  ME TGIL
Sbjct  21   RPKTKIVCTLGPASRSVEMISRLLRVGMCVARFNFSHGSHEYHQETLDNLRAAMERTGIL  80

Query  277  CAVMLDTKG  303
            CAVMLDTKG
Sbjct  81   CAVMLDTKG  89



>ref|XP_009102101.1| PREDICTED: pyruvate kinase, cytosolic isozyme-like [Brassica 
rapa]
Length=492

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/67 (85%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +1

Query  103  KTKIVCTLGPASRSVPMVEKLLRAGMNVARFNFSHGSHEYHQETLNNLRQGMENTGILCA  282
            KTKIVCTLGP SRSV M+EKLL+AGMNVARFNFSHG+HEYHQ TL+NLR  M+NTGILCA
Sbjct  15   KTKIVCTLGPVSRSVEMIEKLLKAGMNVARFNFSHGTHEYHQGTLDNLRIAMKNTGILCA  74

Query  283  VMLDTKG  303
            VMLDTKG
Sbjct  75   VMLDTKG  81



Lambda      K        H        a         alpha
   0.317    0.129    0.367    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562775562090