BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN042G18

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      254   4e-79   Nicotiana tomentosiformis
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      253   1e-78   Nicotiana tomentosiformis
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      253   2e-78   Nicotiana sylvestris
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      249   5e-77   Nicotiana sylvestris
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           247   3e-76   Solanum lycopersicum
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      246   4e-76   Solanum tuberosum [potatoes]
emb|CDP21869.1|  unnamed protein product                                244   2e-75   Coffea canephora [robusta coffee]
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      244   3e-75   Solanum tuberosum [potatoes]
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           244   5e-75   Sesamum indicum [beniseed]
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           240   2e-73   Malus domestica [apple tree]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      239   3e-73   Nelumbo nucifera [Indian lotus]
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      238   5e-73   Nelumbo nucifera [Indian lotus]
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative              237   6e-73   
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      237   1e-72   Solanum lycopersicum
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           238   1e-72   Pyrus x bretschneideri [bai li]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                         238   2e-72   Jatropha curcas
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             236   4e-72   Prunus persica
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           235   1e-71   Vitis vinifera
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      234   2e-71   Cicer arietinum [garbanzo]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             234   5e-71   Citrus clementina [clementine]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      234   5e-71   Citrus sinensis [apfelsine]
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      233   5e-71   Populus euphratica
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      232   9e-71   Solanum tuberosum [potatoes]
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     233   1e-70   Populus trichocarpa [western balsam poplar]
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    233   1e-70   Tarenaya hassleriana [spider flower]
gb|AFK49564.1|  unknown                                                 232   1e-70   Medicago truncatula
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  232   1e-70   Medicago truncatula
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      231   3e-70   Populus euphratica
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      231   6e-70   Morus notabilis
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           230   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           229   1e-69   Fragaria vesca subsp. vesca
emb|CDX77481.1|  BnaA07g06190D                                          229   1e-69   
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           229   2e-69   Brassica rapa
emb|CDX85133.1|  BnaC07g07730D                                          229   2e-69   
emb|CAN83418.1|  hypothetical protein VITISV_041351                     229   2e-69   Vitis vinifera
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    228   8e-69   Arabis alpina [alpine rockcress]
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       228   1e-68   Gossypium hirsutum [American cotton]
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    227   2e-68   Theobroma cacao [chocolate]
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      227   2e-68   Cucumis sativus [cucumbers]
dbj|BAE71216.1|  putative NAD dependent epimerase                       226   2e-68   Trifolium pratense [peavine clover]
gb|KJB72008.1|  hypothetical protein B456_011G153500                    226   3e-68   Gossypium raimondii
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           226   3e-68   Cucumis melo [Oriental melon]
gb|AAN60250.1|  unknown                                                 226   6e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92990.1|  BnaA03g37120D                                          225   6e-68   
emb|CDY53207.1|  BnaC03g74010D                                          225   6e-68   Brassica napus [oilseed rape]
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           226   6e-68   Brassica rapa
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       226   6e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             226   7e-68   Capsella rubella
emb|CDY64583.1|  BnaCnng44170D                                          226   7e-68   Brassica napus [oilseed rape]
emb|CDY18087.1|  BnaA01g23480D                                          225   7e-68   Brassica napus [oilseed rape]
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             225   7e-68   Eutrema salsugineum [saltwater cress]
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           225   8e-68   Camelina sativa [gold-of-pleasure]
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             225   8e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      224   1e-67   Brassica rapa
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       223   3e-67   Gossypium hirsutum [American cotton]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      223   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      223   7e-67   Glycine max [soybeans]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   222   2e-66   Citrus sinensis [apfelsine]
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    219   1e-65   Glycine max [soybeans]
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           218   4e-65   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB28115.1|  hypothetical protein B456_005G028000                    217   5e-65   Gossypium raimondii
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           218   8e-65   Eucalyptus grandis [rose gum]
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             214   7e-64   Phaseolus vulgaris [French bean]
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       213   3e-63   Phaseolus vulgaris [French bean]
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           213   3e-63   Phaseolus vulgaris [French bean]
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      214   4e-63   Glycine max [soybeans]
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             212   9e-63   
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170          202   7e-59   Amborella trichopoda
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    199   2e-58   
gb|ABK25339.1|  unknown                                                 198   8e-58   Picea sitchensis
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      198   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU31498.1|  hypothetical protein MIMGU_mgv1a008581mg                195   4e-57   Erythranthe guttata [common monkey flower]
ref|XP_002511693.1|  UDP-glucuronate 5-epimerase, putative              188   5e-57   
gb|ABR16292.1|  unknown                                                 196   1e-56   Picea sitchensis
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           194   3e-56   Brassica rapa
emb|CDY67756.1|  BnaA03g56770D                                          194   4e-56   Brassica napus [oilseed rape]
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836             194   8e-56   
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268              194   8e-56   Selaginella moellendorffii
emb|CDX95646.1|  BnaC03g25270D                                          193   8e-56   
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g             191   4e-55   Populus trichocarpa [western balsam poplar]
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      192   4e-55   Phoenix dactylifera
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      191   4e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630          191   4e-55   Amborella trichopoda
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           191   8e-55   Populus euphratica
ref|XP_001761086.1|  predicted protein                                  191   9e-55   
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      190   1e-54   Nicotiana sylvestris
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      190   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           190   1e-54   Elaeis guineensis
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg             190   2e-54   Eutrema salsugineum [saltwater cress]
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      190   2e-54   Elaeis guineensis
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      189   3e-54   Solanum lycopersicum
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      190   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg             189   3e-54   Capsella rubella
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           189   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                    189   4e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      189   4e-54   
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                       189   4e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CDP09891.1|  unnamed protein product                                189   5e-54   Coffea canephora [robusta coffee]
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      189   5e-54   Populus euphratica
dbj|BAF00333.1|  putative nucleotide sugar epimerase                    184   6e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein     188   6e-54   Populus trichocarpa [western balsam poplar]
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      187   7e-54   Solanum lycopersicum
gb|AFK41785.1|  unknown                                                 180   7e-54   Medicago truncatula
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    189   7e-54   Phoenix dactylifera
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           188   1e-53   Brassica rapa
gb|EYU31982.1|  hypothetical protein MIMGU_mgv1a012102mg                183   1e-53   Erythranthe guttata [common monkey flower]
emb|CAN73017.1|  hypothetical protein VITISV_004389                     179   1e-53   Vitis vinifera
emb|CDO97699.1|  unnamed protein product                                188   1e-53   Coffea canephora [robusta coffee]
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      187   1e-53   Phoenix dactylifera
emb|CAN83831.1|  hypothetical protein VITISV_003974                     179   1e-53   Vitis vinifera
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      188   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           187   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN25558.1|  UDP-glucuronate 4-epimerase 3                           182   2e-53   Glycine soja [wild soybean]
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      187   2e-53   Solanum tuberosum [potatoes]
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      187   2e-53   Solanum lycopersicum
gb|KHN17533.1|  UDP-glucuronate 4-epimerase 1                           182   3e-53   Glycine soja [wild soybean]
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           186   3e-53   Elaeis guineensis
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      186   4e-53   Cicer arietinum [garbanzo]
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      186   5e-53   Glycine max [soybeans]
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      186   6e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           186   6e-53   Tarenaya hassleriana [spider flower]
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           186   7e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      186   7e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg             186   7e-53   Eutrema salsugineum [saltwater cress]
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      186   8e-53   
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      186   1e-52   Elaeis guineensis
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                           185   1e-52   Medicago truncatula
gb|AAM61323.1|  nucleotide sugar epimerase, putative                    184   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           185   1e-52   Phoenix dactylifera
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      184   1e-52   Solanum tuberosum [potatoes]
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg             185   1e-52   Citrus clementina [clementine]
emb|CDY63064.1|  BnaAnng18570D                                          184   2e-52   Brassica napus [oilseed rape]
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      184   2e-52   Nicotiana sylvestris
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                       184   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      184   2e-52   Nicotiana tomentosiformis
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      184   2e-52   Nicotiana tomentosiformis
emb|CAN73016.1|  hypothetical protein VITISV_004388                     184   2e-52   Vitis vinifera
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           184   2e-52   
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                    184   2e-52   
gb|KDP25603.1|  hypothetical protein JCGZ_20759                         184   3e-52   Jatropha curcas
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative              184   3e-52   Ricinus communis
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg             184   3e-52   Prunus persica
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           184   3e-52   Sesamum indicum [beniseed]
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g             184   3e-52   Populus trichocarpa [western balsam poplar]
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                           181   3e-52   Glycine soja [wild soybean]
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                       184   4e-52   Gossypium hirsutum [American cotton]
gb|KGN57287.1|  hypothetical protein Csa_3G176330                       179   4e-52   Cucumis sativus [cucumbers]
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           184   4e-52   Cucumis melo [Oriental melon]
gb|EMT26004.1|  UDP-glucuronate 4-epimerase 4                           176   4e-52   
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                    184   4e-52   Arabis alpina [alpine rockcress]
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684             184   5e-52   
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174              184   5e-52   
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           183   5e-52   Nicotiana tomentosiformis
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      183   5e-52   
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      183   5e-52   
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      183   5e-52   Populus euphratica
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                    183   5e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           183   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           183   6e-52   Prunus mume [ume]
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg             183   7e-52   Prunus persica
ref|XP_001769370.1|  predicted protein                                  183   7e-52   
gb|KJB09908.1|  hypothetical protein B456_001G174300                    183   8e-52   Gossypium raimondii
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg             182   9e-52   Capsella rubella
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                           182   9e-52   Medicago truncatula
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                    182   1e-51   
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           182   1e-51   Nicotiana tomentosiformis
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...    182   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                      182   1e-51   Morus notabilis
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      182   1e-51   Solanum tuberosum [potatoes]
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           182   1e-51   Eucalyptus grandis [rose gum]
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      182   1e-51   Glycine max [soybeans]
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      182   1e-51   Nicotiana sylvestris
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      182   1e-51   Glycine max [soybeans]
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g             182   2e-51   Phaseolus vulgaris [French bean]
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      182   2e-51   Oryza brachyantha
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      182   2e-51   Glycine max [soybeans]
gb|KDP28767.1|  hypothetical protein JCGZ_14538                         182   2e-51   Jatropha curcas
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      182   2e-51   Setaria italica
ref|XP_010540291.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      181   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           182   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           182   2e-51   Prunus mume [ume]
dbj|BAJ85817.1|  predicted protein                                      182   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS60141.1|  hypothetical protein M569_14661                         181   2e-51   Genlisea aurea
ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           182   3e-51   Prunus mume [ume]
ref|NP_001048359.1|  Os02g0791500                                       181   3e-51   
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein     181   3e-51   Populus trichocarpa [western balsam poplar]
emb|CDP21367.1|  unnamed protein product                                181   3e-51   Coffea canephora [robusta coffee]
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                    181   3e-51   Arabis alpina [alpine rockcress]
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg             181   3e-51   Citrus clementina [clementine]
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           181   3e-51   Nicotiana sylvestris
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g             181   3e-51   Phaseolus vulgaris [French bean]
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           181   4e-51   Brachypodium distachyon [annual false brome]
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      181   4e-51   Cicer arietinum [garbanzo]
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      181   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_001777338.1|  predicted protein                                  181   4e-51   
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                   181   4e-51   Citrus sinensis [apfelsine]
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           181   4e-51   Populus euphratica
gb|KDP38751.1|  hypothetical protein JCGZ_04104                         181   5e-51   Jatropha curcas
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           181   6e-51   Solanum lycopersicum
gb|KJB76605.1|  hypothetical protein B456_012G096800                    181   6e-51   Gossypium raimondii
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      180   7e-51   Prunus mume [ume]
ref|XP_001759693.1|  predicted protein                                  181   7e-51   
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg                180   7e-51   Erythranthe guttata [common monkey flower]
gb|KJB24820.1|  hypothetical protein B456_004G162700                    180   9e-51   Gossypium raimondii
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg             179   9e-51   Prunus persica
ref|XP_010662214.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           177   9e-51   Vitis vinifera
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      180   9e-51   Sesamum indicum [beniseed]
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      180   1e-50   Solanum tuberosum [potatoes]
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160          180   1e-50   Amborella trichopoda
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           180   1e-50   Solanum lycopersicum
ref|XP_004171294.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      179   1e-50   
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           179   1e-50   
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                           180   1e-50   Medicago truncatula
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           179   1e-50   Cucumis melo [Oriental melon]
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg                179   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      179   1e-50   Cucumis sativus [cucumbers]
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           179   1e-50   
gb|KJB41101.1|  hypothetical protein B456_007G090500                    179   1e-50   Gossypium raimondii
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                       179   2e-50   Gossypium hirsutum [American cotton]
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      179   2e-50   Vitis vinifera
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630          179   2e-50   Sorghum bicolor [broomcorn]
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           179   2e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg             179   2e-50   
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           179   2e-50   
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      179   2e-50   Vitis vinifera
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           179   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920          179   2e-50   Sorghum bicolor [broomcorn]
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      179   3e-50   Nelumbo nucifera [Indian lotus]
ref|XP_001751991.1|  predicted protein                                  179   3e-50   
ref|NP_001142515.1|  hypothetical protein                               179   3e-50   Zea mays [maize]
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      179   3e-50   Solanum tuberosum [potatoes]
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      178   3e-50   Vitis vinifera
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      179   3e-50   Cucumis melo [Oriental melon]
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110          179   3e-50   Amborella trichopoda
ref|XP_001754001.1|  predicted protein                                  179   3e-50   
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      178   4e-50   Solanum tuberosum [potatoes]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                      178   4e-50   Morus notabilis
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           178   4e-50   Sesamum indicum [beniseed]
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           178   4e-50   Eucalyptus grandis [rose gum]
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      178   4e-50   Sesamum indicum [beniseed]
ref|XP_001761984.1|  predicted protein                                  178   4e-50   
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                    178   4e-50   Zea mays [maize]
ref|NP_001105911.1|  LOC732831                                          178   5e-50   Zea mays [maize]
gb|EPS72617.1|  hypothetical protein M569_02133                         178   5e-50   Genlisea aurea
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      178   6e-50   Cicer arietinum [garbanzo]
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                    177   6e-50   Arabis alpina [alpine rockcress]
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           178   6e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           178   7e-50   
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      176   7e-50   Pyrus x bretschneideri [bai li]
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                        178   8e-50   Medicago truncatula
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           177   8e-50   Malus domestica [apple tree]
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           177   9e-50   Nicotiana tomentosiformis
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      176   9e-50   Pyrus x bretschneideri [bai li]
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                       177   9e-50   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20281.1|  AT4G30440                                              172   9e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      177   1e-49   
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           177   1e-49   Eucalyptus grandis [rose gum]
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           177   1e-49   Brassica rapa
ref|XP_008776445.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      169   1e-49   Phoenix dactylifera
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      177   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           177   1e-49   Pyrus x bretschneideri [bai li]
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           177   2e-49   Fragaria vesca subsp. vesca
emb|CDY70926.1|  BnaCnng70410D                                          177   2e-49   Brassica napus [oilseed rape]
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      177   2e-49   Zea mays [maize]
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      176   2e-49   
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      176   2e-49   Cucumis sativus [cucumbers]
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      176   2e-49   Solanum lycopersicum
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg                176   2e-49   Erythranthe guttata [common monkey flower]
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           176   2e-49   Fragaria vesca subsp. vesca
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           176   3e-49   Fragaria vesca subsp. vesca
emb|CAN60968.1|  hypothetical protein VITISV_008097                     176   3e-49   Vitis vinifera
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      176   3e-49   Vitis vinifera
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      176   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      176   4e-49   Setaria italica
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    175   5e-49   Malus domestica [apple tree]
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                    175   5e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g             174   6e-49   Populus trichocarpa [western balsam poplar]
gb|KJB23560.1|  hypothetical protein B456_004G105200                    173   6e-49   Gossypium raimondii
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      176   7e-49   Phoenix dactylifera
dbj|BAK06545.1|  predicted protein                                      175   8e-49   
gb|EMT09376.1|  UDP-glucuronate 4-epimerase 1                           172   8e-49   
dbj|BAJ88176.1|  predicted protein                                      176   8e-49   
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           175   9e-49   
gb|KGN65261.1|  hypothetical protein Csa_1G277970                       174   1e-48   
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           174   1e-48   
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      174   1e-48   
gb|EEC83913.1|  hypothetical protein OsI_29968                          169   1e-48   
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      174   2e-48   
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      174   2e-48   
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      174   2e-48   
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           174   2e-48   
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      174   2e-48   
ref|XP_001767292.1|  predicted protein                                  174   3e-48   
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                       173   3e-48   
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      173   3e-48   
emb|CDY39205.1|  BnaA03g50170D                                          173   3e-48   
emb|CDX72242.1|  BnaC07g42640D                                          173   4e-48   
gb|EMT23409.1|  UDP-glucuronate 4-epimerase 1                           174   4e-48   
dbj|BAJ86203.1|  predicted protein                                      174   4e-48   
emb|CDX97356.1|  BnaA02g21470D                                          173   4e-48   
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      173   4e-48   
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      174   5e-48   
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           172   6e-48   
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg             172   6e-48   
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      172   7e-48   
gb|KJB27035.1|  hypothetical protein B456_004G273500                    172   7e-48   
emb|CBI24539.3|  unnamed protein product                                169   1e-47   
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    172   1e-47   
emb|CDY04398.1|  BnaC02g28500D                                          172   1e-47   
ref|NP_001049561.1|  Os03g0249500                                       172   1e-47   
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                    171   2e-47   
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg             171   2e-47   
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           171   2e-47   
ref|XP_006651218.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      172   2e-47   
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      170   3e-47   
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)           171   4e-47   
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      171   4e-47   
ref|NP_001062295.1|  Os08g0526100                                       171   4e-47   
ref|XP_006660306.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      166   4e-47   
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg             170   6e-47   
ref|NP_001147328.1|  protein capI                                       171   6e-47   
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      170   6e-47   
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      170   6e-47   
gb|KJB25649.1|  hypothetical protein B456_004G202200                    170   7e-47   
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      170   7e-47   
gb|EEC83914.1|  hypothetical protein OsI_29969                          172   9e-47   
ref|NP_001057015.1|  Os06g0187200                                       166   9e-47   
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           169   1e-46   
gb|EAZ43405.1|  hypothetical protein OsJ_28010                          171   2e-46   
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130          169   3e-46   
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      168   3e-46   
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                      168   3e-46   
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                    168   3e-46   
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520          169   4e-46   
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg                168   4e-46   
gb|EAZ36080.1|  hypothetical protein OsJ_20391                          167   6e-46   
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...    167   7e-46   
gb|EAY99954.1|  hypothetical protein OsI_21957                          167   7e-46   
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      168   7e-46   
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      166   9e-46   
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      167   1e-45   
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                    166   2e-45   
ref|XP_001781238.1|  predicted protein                                  166   2e-45   
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           166   3e-45   
gb|KJB43946.1|  hypothetical protein B456_007G225300                    166   3e-45   
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           166   3e-45   
gb|EMS53276.1|  UDP-glucuronate 4-epimerase 1                           167   3e-45   
gb|EMS47781.1|  UDP-glucuronate 4-epimerase 6                           164   4e-45   
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein      165   6e-45   
emb|CBI22155.3|  unnamed protein product                                159   8e-45   
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                   164   9e-45   
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg             164   9e-45   
dbj|BAJ99315.1|  predicted protein                                      165   1e-44   
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           164   1e-44   
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      164   2e-44   
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           163   3e-44   
emb|CBI18845.3|  unnamed protein product                                158   4e-44   
gb|KDP22397.1|  hypothetical protein JCGZ_26228                         162   4e-44   
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      163   5e-44   
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           162   7e-44   
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g             161   9e-44   
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      161   9e-44   
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    160   1e-43   
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...    162   1e-43   
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    160   1e-43   
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    160   1e-43   
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    160   2e-43   
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    160   2e-43   
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      160   2e-43   
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    160   2e-43   
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      160   3e-43   
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg             160   3e-43   
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                           162   3e-43   
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      160   6e-43   
ref|XP_009114689.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      156   7e-43   
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      160   7e-43   
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      159   1e-42   
gb|EEC84839.1|  hypothetical protein OsI_31939                          159   2e-42   
ref|NP_001063595.1|  Os09g0504000                                       159   2e-42   
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative              158   2e-42   
ref|XP_010092236.1|  UDP-glucuronate 4-epimerase 3                      153   2e-42   
gb|EPS64795.1|  hypothetical protein M569_09984                         156   2e-42   
ref|XP_006386474.1|  hypothetical protein POPTR_0002s11750g             151   3e-42   
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g             157   3e-42   
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg             157   4e-42   
gb|AAK93670.1|  putative nucleotide sugar epimerase                     157   4e-42   
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                       157   4e-42   
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      157   4e-42   
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                    157   4e-42   
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                        157   4e-42   
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      157   5e-42   
emb|CDX94504.1|  BnaC09g23320D                                          157   5e-42   
emb|CDX86716.1|  BnaA09g21060D                                          157   6e-42   
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030          157   7e-42   
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    156   8e-42   
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      156   9e-42   
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    156   9e-42   
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      156   1e-41   
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      156   2e-41   
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                    155   2e-41   
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                         156   2e-41   
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    155   2e-41   
gb|EMT33438.1|  UDP-glucuronate 4-epimerase 6                           150   5e-41   
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           152   4e-40   
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183              143   3e-37   
ref|XP_001416501.1|  predicted protein                                  142   4e-37   
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938              140   5e-36   
ref|XP_002504144.1|  predicted protein                                  140   8e-36   
ref|XP_001422311.1|  predicted protein                                  138   2e-35   
emb|CEG01274.1|  Nucleotide sugar epimerase                             137   9e-35   
ref|XP_003075335.1|  putative nucleotide sugar epimerase (ISS)          137   9e-35   
ref|XP_007512695.1|  predicted protein                                  135   6e-34   
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      134   1e-33   
gb|KJB27036.1|  hypothetical protein B456_004G273500                    130   2e-32   
ref|XP_010113442.1|  UDP-glucuronate 4-epimerase 3                      127   5e-32   
ref|XP_003060215.1|  protein arginine methyltransferase                 124   2e-30   
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      119   2e-28   
gb|KDD76295.1|  hypothetical protein H632_c279p0                        113   8e-28   
ref|XP_001698020.1|  NAD-dependent epimerase/dehydratase                113   2e-26   
gb|AEW08736.1|  hypothetical protein CL1437Contig1_03                   105   8e-26   
gb|AEW07796.1|  hypothetical protein 0_11781_01                         107   9e-26   
gb|AFG68267.1|  hypothetical protein 0_11781_01                         107   2e-25   
gb|AEW08737.1|  hypothetical protein CL1437Contig1_03                   103   3e-25   
ref|XP_002945754.1|  NAD-dependent epimerase/dehydratase                110   4e-25   
gb|AFG68265.1|  hypothetical protein 0_11781_01                         106   4e-25   
dbj|BAD43886.1|  putative nucleotide sugar epimerase                    101   3e-24   
ref|WP_029408437.1|  hypothetical protein                               105   2e-23   
ref|WP_017366130.1|  NAD dependent epimerase/dehydratase                105   2e-23   
ref|WP_027083114.1|  capsular biosynthesis protein CpsI                 104   2e-23   
ref|WP_010961674.1|  capsular polysaccharide biosynthesis protein I     104   3e-23   
gb|ACF83801.1|  unknown                                               99.0    5e-23   
ref|XP_728710.1|  NAD dependent epimerase/dehydratase                   104   7e-23   
ref|WP_014415759.1|  UDP-glucuronate 5'-epimerase                       103   8e-23   
ref|WP_019572150.1|  hypothetical protein                               100   1e-22   
ref|WP_018867984.1|  hypothetical protein                               100   1e-22   
ref|WP_006509051.1|  nucleoside-diphosphate-sugar epimerase             102   1e-22   
ref|WP_026609545.1|  capsular biosynthesis protein CpsI                 102   1e-22   
gb|ERT06558.1|  polysaccharide biosynthesis family protein              102   1e-22   
ref|WP_040484163.1|  capsular biosynthesis protein CpsI                 102   1e-22   
ref|WP_044606580.1|  capsular biosynthesis protein CpsI                 102   1e-22   
ref|WP_041227251.1|  capsular biosynthesis protein CpsI                 102   1e-22   
ref|WP_015118268.1|  nucleoside-diphosphate-sugar epimerase             102   2e-22   
ref|WP_029733863.1|  hypothetical protein                               101   3e-22   
ref|WP_029012676.1|  hypothetical protein                               101   3e-22   
ref|WP_012110833.1|  NAD-dependent epimerase/dehydratase                101   4e-22   
ref|WP_009631239.1|  nucleoside-diphosphate-sugar epimerase             101   4e-22   
ref|WP_037224794.1|  capsular biosynthesis protein CpsI                 100   4e-22   
ref|WP_012489003.1|  NAD dependent epimerase/dehydratase family s...    100   4e-22   
ref|WP_022948290.1|  NAD dependent epimerase/dehydratase                100   5e-22   
ref|WP_024299561.1|  capsular biosynthesis protein CpsI                 100   5e-22   
ref|WP_018604345.1|  NAD dependent epimerase/dehydratase                100   6e-22   
ref|WP_027071813.1|  capsular biosynthesis protein CpsI                 100   6e-22   
ref|WP_019592959.1|  hypothetical protein                             97.4    6e-22   
ref|WP_015222004.1|  NAD-dependent epimerase/dehydratase                100   6e-22   
ref|WP_013250660.1|  UDP-glucuronate 5'-epimerase                       100   6e-22   
ref|WP_012522788.1|  NAD-dependent epimerase/dehydratase                100   7e-22   
ref|WP_020400341.1|  hypothetical protein                               100   7e-22   
ref|WP_020879618.1|  NAD-dependent epimerase/dehydratase                100   7e-22   
ref|WP_006619621.1|  NAD-dependent epimerase                            100   8e-22   
ref|WP_019571808.1|  hypothetical protein                             97.4    9e-22   
ref|WP_007639465.1|  NAD dependent epimerase/dehydratase family s...    100   9e-22   
ref|WP_015752915.1|  NAD-dependent epimerase/dehydratase                100   1e-21   
ref|WP_011713745.1|  NAD-dependent epimerase/dehydratase                100   1e-21   
ref|WP_011745567.1|  NAD-dependent epimerase/dehydratase                100   1e-21   
ref|WP_015188623.1|  UDP-glucuronate 5'-epimerase                       100   1e-21   
ref|WP_028313401.1|  capsular biosynthesis protein CpsI                 100   1e-21   
ref|WP_022953707.1|  NAD-dependent epimerase                            100   1e-21   
ref|WP_020008823.1|  hypothetical protein                             97.4    1e-21   
ref|WP_006668268.1|  NAD-dependent epimerase                            100   1e-21   
ref|WP_013848441.1|  UDP-glucuronate 4-epimerase                      99.8    1e-21   
ref|WP_039643797.1|  capsular biosynthesis protein CpsI               99.8    1e-21   
ref|WP_004513290.1|  NAD-dependent epimerase/dehydratase              99.8    1e-21   
emb|CAJ74935.1|  strongly similar to UDP-glucuronate 5'-epimerase     99.8    1e-21   
ref|WP_008048763.1|  NAD-dependent epimerase                          99.8    1e-21   
ref|WP_029681351.1|  capsular biosynthesis protein CpsI               96.7    1e-21   
gb|EPS73152.1|  hypothetical protein M569_01604                         100   1e-21   
ref|WP_020008853.1|  NAD dependent epimerase/dehydratase              99.0    1e-21   
ref|WP_027403384.1|  capsular biosynthesis protein CpsI               99.8    1e-21   
ref|WP_013111978.1|  NAD-dependent epimerase/dehydratase              99.8    1e-21   
ref|WP_011391323.1|  UDP-glucuronate 5'-epimerase                     99.4    2e-21   
ref|WP_020083694.1|  hypothetical protein                             99.4    2e-21   
ref|WP_044840054.1|  capsular biosynthesis protein CpsI               99.4    2e-21   
ref|WP_012954589.1|  NAD-dependent epimerase                          99.4    2e-21   
ref|WP_028382493.1|  capsular biosynthesis protein CpsI               99.4    2e-21   
ref|WP_010942881.1|  UDP-galacturonate 4-epimerase                    99.4    2e-21   
ref|WP_028579847.1|  capsular biosynthesis protein CpsI               99.4    2e-21   
ref|WP_002708148.1|  NAD-dependent epimerase                          99.0    2e-21   
ref|WP_020160621.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  99.0    2e-21   
ref|WP_019571974.1|  hypothetical protein                             96.3    2e-21   
ref|WP_011737215.1|  NAD-dependent epimerase/dehydratase              99.0    2e-21   
gb|ACN16058.1|  CapD1                                                 99.0    2e-21   
ref|WP_017714779.1|  hypothetical protein                             99.0    2e-21   
ref|WP_019025240.1|  MULTISPECIES: hypothetical protein               96.3    2e-21   
ref|WP_041274008.1|  capsular biosynthesis protein CpsI               99.0    2e-21   
ref|WP_019023983.1|  MULTISPECIES: hypothetical protein               96.3    2e-21   
ref|WP_019563259.1|  hypothetical protein                             96.3    3e-21   
ref|WP_018864896.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  98.6    3e-21   
ref|WP_018950679.1|  NAD dependent epimerase/dehydratase              98.2    3e-21   
ref|WP_019612090.1|  hypothetical protein                             96.3    3e-21   
ref|WP_012610830.1|  NAD-dependent epimerase/dehydratase              98.6    3e-21   



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   254 bits (649),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/153 (90%), Positives = 144/153 (94%), Gaps = 3/153 (2%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +DM+QGK INVYVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  301  KDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRVY  360

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSVRKLVSILENLLS+KAKKNVVKMPRNGDVPFTHANVSLA +DFGYKPTTDL
Sbjct  361  NLGNTSPVSVRKLVSILENLLSVKAKKNVVKMPRNGDVPFTHANVSLALRDFGYKPTTDL  420

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPTHQSDD  461
            S GLRKFVKWYVSYYGIQSRVK E     +SDD
Sbjct  421  SIGLRKFVKWYVSYYGIQSRVKKE---NDRSDD  450



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +DM QGKPINVYVTQ+DKEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  300  KDMTQGKPINVYVTQDDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRVY  359

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV+KLV+ILE+LL++KAKKNV+KMPRNGDVPFTHANVSLAY+DFGYKPTTDL
Sbjct  360  NLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPRNGDVPFTHANVSLAYRDFGYKPTTDL  419

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL-HPTHQSDD  461
            SSGLRKFVKWY+SYYGIQS+V  EL  P   S+D
Sbjct  420  SSGLRKFVKWYLSYYGIQSKVNKELDSPNDHSED  453



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 147/154 (95%), Gaps = 1/154 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +DM QGKPINVYVTQ++KEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  300  KDMTQGKPINVYVTQDNKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRVY  359

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV+KLV+ILE+LL++KAKKNV+KMPRNGDVPFTHANVSLAY+DFGYKPTTDL
Sbjct  360  NLGNTSPVSVKKLVTILESLLNVKAKKNVIKMPRNGDVPFTHANVSLAYRDFGYKPTTDL  419

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELH-PTHQSDD  461
            SSGLRKFVKWY+SYYGIQS+V  EL+ P   S+D
Sbjct  420  SSGLRKFVKWYLSYYGIQSKVNKELNSPNDHSED  453



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   249 bits (635),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/153 (88%), Positives = 141/153 (92%), Gaps = 3/153 (2%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +DM+QGK INVYVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  301  KDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRVY  360

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSVRKLV ILENLL+IKAKKNVVKMPRNGDVPFTHANVSLA +DFGYKPTTDL
Sbjct  361  NLGNTSPVSVRKLVVILENLLNIKAKKNVVKMPRNGDVPFTHANVSLALRDFGYKPTTDL  420

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPTHQSDD  461
            S GLRKFVKWYVSYYGIQ RVK E      SDD
Sbjct  421  SIGLRKFVKWYVSYYGIQPRVKKE---NDHSDD  450



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +DM+QGK INVYVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  304  KDMIQGKSINVYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  363

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV+KLV+ILENLL++KAKK  +KMPRNGDVPFTHANVSLA +DFGYKPTTDL
Sbjct  364  NLGNTSPVSVKKLVAILENLLNLKAKKFFIKMPRNGDVPFTHANVSLALRDFGYKPTTDL  423

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            SSGLRKFVKWYVSYYGIQSRVK E
Sbjct  424  SSGLRKFVKWYVSYYGIQSRVKKE  447



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score =   246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +DM+QGK INVYVTQ+D+EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  300  KDMIQGKSINVYVTQDDREVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  359

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV+KLV+ILENLL++KAKKNV+KMPRNGDVPFTHANVSLA +DFGYKPTTDL
Sbjct  360  NLGNTSPVSVKKLVAILENLLNLKAKKNVIKMPRNGDVPFTHANVSLALRDFGYKPTTDL  419

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
            SSGLRKFVKWYVSYYGIQ RVK
Sbjct  420  SSGLRKFVKWYVSYYGIQPRVK  441



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK IN+YVTQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+ PAQLRVY
Sbjct  299  KDILQGKGINLYVTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRAPAQLRVY  358

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV KLVSILE LL++KAKK+V+KMPRNGDVP+THANVSLAYKDFGY+PTTDL
Sbjct  359  NLGNTSPVSVGKLVSILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYQPTTDL  418

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPTHQ  452
            S+GLRKFVKWY+SYYGIQS+VK E+  T++
Sbjct  419  STGLRKFVKWYLSYYGIQSKVKKEIDATNE  448



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +DM+QGKPINVYVTQ+DKEVARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPAQLRVY
Sbjct  304  KDMVQGKPINVYVTQDDKEVARDFTYIDDIVKGCIGSLDTAEKSTGSGGKKKGPAQLRVY  363

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV KLV+ILENLL++KAKKNV+KMPRNGDVPFTHAN++LA KDFGYKPTTDL
Sbjct  364  NLGNTSPVSVNKLVTILENLLNVKAKKNVIKMPRNGDVPFTHANITLAKKDFGYKPTTDL  423

Query  363  SSGLRKFVKWYVSYYGIQSR  422
            SSGLRKFVKWYVSYYGIQS+
Sbjct  424  SSGLRKFVKWYVSYYGIQSK  443



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 142/155 (92%), Gaps = 2/155 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK INVYVTQEDKEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+ PAQLRVY
Sbjct  305  KDILQGKGINVYVTQEDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRAPAQLRVY  364

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNT+PV+V KLV ILE+LL++KAKK+V+KMPRNGDVPFTHANVSLAY+DFGYKPTTDL
Sbjct  365  NLGNTAPVTVGKLVGILESLLNVKAKKHVIKMPRNGDVPFTHANVSLAYRDFGYKPTTDL  424

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPT--HQSDD  461
            ++GLRKFVKWYVSYYGI+SR K   H +    SDD
Sbjct  425  AAGLRKFVKWYVSYYGIESRAKKGFHSSTNEHSDD  459



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPINV+ T +DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  307  KDILQGKPINVFKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  366

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILE LLS KAKK+V+KMPRNGDVP+THANV+LAYKDFGYKPTTDL
Sbjct  367  NLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAYKDFGYKPTTDL  426

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL  437
            +SGLRKFVKWYVSYYGI+SRVK E+
Sbjct  427  ASGLRKFVKWYVSYYGIESRVKKEM  451



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI +Y TQ+D+EVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  298  KDILQGKPITIYQTQDDREVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  357

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV KLVSILE LL++ AKKN++KMPRNGDVPFTHANVSLAY+DFGYKPTTDL
Sbjct  358  NLGNTSPVSVGKLVSILEGLLNVNAKKNILKMPRNGDVPFTHANVSLAYRDFGYKPTTDL  417

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYVSYYGIQSR   E
Sbjct  418  ATGLRKFVKWYVSYYGIQSRANKE  441



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI +Y TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  299  KDILQGKPITIYRTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  358

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV KLVSILE  LS+KAKKNVVKMPRNGDVPFTHANVSLAY+DFGYKPTTDL
Sbjct  359  NLGNTSPVSVGKLVSILEGHLSMKAKKNVVKMPRNGDVPFTHANVSLAYRDFGYKPTTDL  418

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            S+GLRKFVKWYV YYGI S+   E
Sbjct  419  STGLRKFVKWYVGYYGIHSKANKE  442



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score =   237 bits (604),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I++Y TQ+ K+VARDFTYIDDVVKGCVGALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  248  KDILQGKQIDIYQTQDQKQVARDFTYIDDVVKGCVGALDTAEKSTGSGGKKKGPAQLRVY  307

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILENLL+ KAKK+V+KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  308  NLGNTSPVPVGKLVSILENLLNTKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  367

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            SSGLRKFVKWYV YYGIQ++VKT+
Sbjct  368  SSGLRKFVKWYVGYYGIQTKVKTQ  391



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 139/142 (98%), Gaps = 2/142 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +DM+QGKPI VYV+  DKEVARDFTYIDDVVKGC+GA+DTAEKSTGSGGKK+GPAQLRVY
Sbjct  294  KDMIQGKPIKVYVS--DKEVARDFTYIDDVVKGCLGAIDTAEKSTGSGGKKRGPAQLRVY  351

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV+KLV+ILENLL+IKAKKN+++MPRNGDVPFTHANVSLAY+DFGYKPTT+L
Sbjct  352  NLGNTSPVSVKKLVAILENLLNIKAKKNLIRMPRNGDVPFTHANVSLAYRDFGYKPTTNL  411

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
            SSGLRKFVKWY+SYYGIQ+R+K
Sbjct  412  SSGLRKFVKWYLSYYGIQARIK  433



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI+VY T +DKEVARDFTYIDDVVKGC+GALDTA+KSTGSGGKKKGPAQLR+Y
Sbjct  307  KDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAQKSTGSGGKKKGPAQLRIY  366

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILE LLS KAKK+V+KMPRNGDVP+THANV+LAYKDFGYKPTTDL
Sbjct  367  NLGNTSPVPVGKLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAYKDFGYKPTTDL  426

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL  437
            +SGLRKFVKWYVSYYGI+SRVK E+
Sbjct  427  ASGLRKFVKWYVSYYGIESRVKKEM  451



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GKPI+VY TQ++K+VARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  304  KDILHGKPIDVYQTQDEKQVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRVY  363

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLV+ILE+LL+ KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  364  NLGNTSPVPVGKLVAILESLLNTKAKKHIIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  423

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            SSGLRKFVKWYVSYYGIQ+RVK E
Sbjct  424  SSGLRKFVKWYVSYYGIQTRVKKE  447



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI+VY T +DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  303  KDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  362

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILE LL  KAKK+V+KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  363  NLGNTSPVPVGKLVSILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  422

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL  437
            +SGLRKFVKWYVSYYGI +RVK E+
Sbjct  423  ASGLRKFVKWYVSYYGIDTRVKREM  447



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI +Y TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  296  KDILQGKPITIYQTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LV ILE LL++KAKK+V+KMPRNGDVP+THANVSLAY+DFGYKP+TDL
Sbjct  356  NLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPSTDL  415

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLR+FVKWYVSYYGIQ+RVK E
Sbjct  416  ATGLRRFVKWYVSYYGIQTRVKKE  439



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK ++VY TQ+ KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  296  KDILHGKTVDVYQTQDGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRIY  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILENLLS KAKK+++KMPRNGDVP+THANV+LAYKDFGYKPTTDL
Sbjct  356  NLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTLAYKDFGYKPTTDL  415

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELH  440
            ++GLRKFVKWYV YYGIQSR+K E H
Sbjct  416  ATGLRKFVKWYVRYYGIQSRLKKENH  441



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY TQ+D+EVARDFTYIDDVVKGCVGALDTA KSTGS GKK+GPAQLRVY
Sbjct  316  KDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGALDTAGKSTGSRGKKRGPAQLRVY  375

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILENLL+ KAKK+V++MPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  376  NLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYKPTTDL  435

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYVSYYGIQ RVK E
Sbjct  436  AAGLRKFVKWYVSYYGIQPRVKKE  459



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY TQ+D+EVARDFTYIDDVVKGCVGALDTA KSTGSGGKK+GPAQLRVY
Sbjct  316  KDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGALDTAGKSTGSGGKKRGPAQLRVY  375

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILENLL+ KAKK+V++MPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  376  NLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYKPTTDL  435

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYVSYYGIQ RVK E
Sbjct  436  AAGLRKFVKWYVSYYGIQPRVKKE  459



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI+VY TQ+DK+VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  301  KDILQGKPIDVYQTQDDKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRVY  360

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LLS KAKK+V+KMPRNGDVP+THANV+LA+KDFGYKPTTDL
Sbjct  361  NLGNTSPVPVGNLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAFKDFGYKPTTDL  420

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
            ++GLRKFVKWYV+YYGIQ+RVK
Sbjct  421  ATGLRKFVKWYVNYYGIQTRVK  442



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 138/142 (97%), Gaps = 2/142 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +DM+QGKPI VYV+  DKEVARDFTYIDDVVKGC+GA+DTAEKSTGSGGKK+GPAQLRVY
Sbjct  295  KDMIQGKPIKVYVS--DKEVARDFTYIDDVVKGCLGAIDTAEKSTGSGGKKRGPAQLRVY  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV+KLV+ILENLL+IKAKKN+++MP+NGDVPFTHANVSLAY+DFGY+PTT+L
Sbjct  353  NLGNTSPVSVKKLVAILENLLNIKAKKNLIRMPQNGDVPFTHANVSLAYRDFGYRPTTNL  412

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
            SSGLRKFVKWY+SYYG+Q+R K
Sbjct  413  SSGLRKFVKWYLSYYGMQARTK  434



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI+VY TQ+DK+VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  302  KDILQGKPIDVYQTQDDKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRVY  361

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LLS KAKK+V+KMPRNGDVP+THANV+LA+KDFGYKP+TDL
Sbjct  362  NLGNTSPVPVANLVSILEGLLSTKAKKHVIKMPRNGDVPYTHANVTLAFKDFGYKPSTDL  421

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
            ++GLRKFVKWYV+YYGIQ+RVK
Sbjct  422  ATGLRKFVKWYVNYYGIQTRVK  443



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY TQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  309  KDILQGKSIDVYKTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  368

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LV ILE LL  KAKK+V+KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  369  NLGNTSPVPVGRLVGILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  428

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL  437
            ++GLRKFVKWYV YYGIQ RVK E+
Sbjct  429  AAGLRKFVKWYVGYYGIQPRVKREI  453



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I+VY TQE KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  296  KDILHGKTIDVYQTQEGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRIY  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILENLLS KAKK+++KMPRNGDVP+THANV++AYKDF YKPTTDL
Sbjct  356  NLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTMAYKDFAYKPTTDL  415

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYV YYGIQSR+K E
Sbjct  416  ATGLRKFVKWYVRYYGIQSRLKKE  439



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I+VY TQE KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  296  KDILHGKTIDVYQTQEGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRIY  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILENLLS KAKK+++KMPRNGDVP+THANV++AYKDF YKPTTDL
Sbjct  356  NLGNTSPVPVGKLVSILENLLSTKAKKHIIKMPRNGDVPYTHANVTMAYKDFAYKPTTDL  415

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYV YYGIQSR+K E
Sbjct  416  ATGLRKFVKWYVRYYGIQSRLKKE  439



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI+VY TQ+ K+VARDFTYIDDVVKGC+GALDTAEKSTGS GKKKGPAQLRVY
Sbjct  301  KDILQGKPIDVYQTQDKKQVARDFTYIDDVVKGCLGALDTAEKSTGSSGKKKGPAQLRVY  360

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILE LLS KA+K+V+KMPRNGDVP+THANV+LAY+DFGYKPTTDL
Sbjct  361  NLGNTSPVPVGKLVSILEGLLSTKARKHVIKMPRNGDVPYTHANVTLAYRDFGYKPTTDL  420

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
            ++GLRKFVKWYV YYGIQ+RVK
Sbjct  421  ATGLRKFVKWYVDYYGIQTRVK  442



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  302  KDILQGKTIDVYKTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  361

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLV ILE+LL+ KAKK+V++MPRNGDVP+THANVSLA +DFGYKPTTDL
Sbjct  362  NLGNTSPVPVGKLVGILESLLTTKAKKHVIRMPRNGDVPYTHANVSLANRDFGYKPTTDL  421

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            S+GLRKFV+WYVSYYGIQ+RVK E
Sbjct  422  STGLRKFVRWYVSYYGIQTRVKKE  445



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I++Y TQ+DKEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  306  KDILQGKSIDIYQTQDDKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRVY  365

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLV ILE LL  KAKK+V+KMPRNGDVP+THANVSLAY+DFGYKP TDL
Sbjct  366  NLGNTSPVPVGKLVGILEGLLGTKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPATDL  425

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL  437
            ++GLRKFVKWYV YYGI  RVK E+
Sbjct  426  AAGLRKFVKWYVGYYGIHPRVKREI  450



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY T +DKEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  305  KDILQGKTIDVYKTVDDKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  364

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL+ KAKK+V+KMPRNGDVP+THANVSLA  DFGYKPTTDL
Sbjct  365  NLGNTSPVPVGRLVSILEALLNSKAKKHVIKMPRNGDVPYTHANVSLALHDFGYKPTTDL  424

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            +SGLRKFVKWYVSYYGI+SRVKTE
Sbjct  425  ASGLRKFVKWYVSYYGIESRVKTE  448



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  302  KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  361

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  362  NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  421

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYVSYYGIQ RVK E
Sbjct  422  AAGLRKFVKWYVSYYGIQPRVKKE  445



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  303  KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  362

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  363  NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  422

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYVSYYGIQ RVK E
Sbjct  423  AAGLRKFVKWYVSYYGIQPRVKKE  446



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  305  KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  364

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  365  NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  424

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYVSYYGIQ RVK E
Sbjct  425  AAGLRKFVKWYVSYYGIQPRVKKE  448



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI +Y TQ+DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  296  KDILQGKPITIYQTQDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LV ILE LL++KAKK+V+KMPRNGDVP+THANVSLAY+DFGYKP+TDL
Sbjct  356  NLGNTSPVPVGRLVGILEGLLNVKAKKHVIKMPRNGDVPYTHANVSLAYRDFGYKPSTDL  415

Query  363  SSGLRKFVKWYVSYYGIQSRV  425
            ++GLR+FVKWYVSYYGIQ+R+
Sbjct  416  ATGLRRFVKWYVSYYGIQTRL  436



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y T ++KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  307  KDILHGKSIDIYRTADNKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  366

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KA+K+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  367  NLGNTSPVPVGRLVSILEGLLGTKARKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  426

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  455
            ++GLRKFVKWYVSYYG+Q RVK E     +S
Sbjct  427  AAGLRKFVKWYVSYYGVQPRVKKETSHAEES  457



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I++Y T + KEVARDFTYIDDVVKGC+GALDTAEKSTGSG KKKG AQLRVY
Sbjct  303  KDILQGKSIDIYKTHDQKEVARDFTYIDDVVKGCLGALDTAEKSTGSGEKKKGAAQLRVY  362

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LLS KAKK+V+ MPRNGDVPFTHANV+LA+KDFGYKPTTDL
Sbjct  363  NLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPRNGDVPFTHANVTLAFKDFGYKPTTDL  422

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  455
            S+GLRKFVKWY+SYYGIQS+ + E   T +S
Sbjct  423  STGLRKFVKWYISYYGIQSKTRKESQATGES  453



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I++Y TQ+ KEVARDFTYIDDVVKGC+GALDTA KSTGSGGKKKGPAQLRVY
Sbjct  302  KDILQGKSIDIYQTQDQKEVARDFTYIDDVVKGCLGALDTAGKSTGSGGKKKGPAQLRVY  361

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL+ KAKK+V+ MPRNGDVPFTHANV+LAYKDFGYKPTTDL
Sbjct  362  NLGNTSPVPVGRLVSILEGLLNTKAKKHVITMPRNGDVPFTHANVTLAYKDFGYKPTTDL  421

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  455
            ++GLRKFVKWYVSY+GIQ RVK E     +S
Sbjct  422  ATGLRKFVKWYVSYFGIQRRVKKETQHADES  452



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I++Y T + KEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  307  KDILQGKQIDIYKTHDAKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  366

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVS+LENLL+ KAKK+++ MPRNGDVPFTHANVSLA KDFGYKPTTDL
Sbjct  367  NLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPRNGDVPFTHANVSLALKDFGYKPTTDL  426

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
             +GLRKFVKWYV YYGIQSRV+ E
Sbjct  427  PTGLRKFVKWYVGYYGIQSRVRKE  450



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I+VY TQ+ KEVARDFTYIDD+VKGCVGALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  296  KDILHGKTIDVYQTQDGKEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKKGPAQLRIY  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLV+ILENLL+ KAKK+V+KMPRNGDVP+THANV+LAY+DFGYKP TDL
Sbjct  356  NLGNTSPVPVGKLVTILENLLTTKAKKHVIKMPRNGDVPYTHANVTLAYRDFGYKPVTDL  415

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            S+GLRKFVKWYV YYGIQ R+K E
Sbjct  416  STGLRKFVKWYVRYYGIQPRLKKE  439



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I++Y T + KEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKG AQLRVY
Sbjct  303  KDILQGKSIDIYKTHDQKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGAAQLRVY  362

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LLS KAKK+V+ MPRNGDVPFTHANV+LA+KDFGYKPTTDL
Sbjct  363  NLGNTSPVPVGRLVSILEGLLSTKAKKHVITMPRNGDVPFTHANVTLAFKDFGYKPTTDL  422

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPTHQS  455
            S+GLRKFVKWY+SYYGIQS+   E   T +S
Sbjct  423  STGLRKFVKWYISYYGIQSKTGKESQATGES  453



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I++Y T + KEVARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  307  KDILQGKQIDIYKTHDAKEVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  366

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVS+LENLL+ KAKK+++ MPRNGDVPFTHANVSLA KDFGYKPTTDL
Sbjct  367  NLGNTSPVPVGKLVSVLENLLNTKAKKHIITMPRNGDVPFTHANVSLALKDFGYKPTTDL  426

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
             +GLRKFVKWYV YYGIQSRVK
Sbjct  427  PTGLRKFVKWYVGYYGIQSRVK  448



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  309  KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  368

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  369  NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  428

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  458
            ++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  429  AAGLRKFVKWYVGYYGIQPRVKKET--SHAED  458



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  9    MLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNL  188
            +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVYNL
Sbjct  307  ILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVYNL  366

Query  189  GNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSS  368
            GNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL++
Sbjct  367  GNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDLAT  426

Query  369  GLRKFVKWYVSYYGIQSRVKTE  434
            GLRKFVKWYV YYGIQ RVK E
Sbjct  427  GLRKFVKWYVGYYGIQPRVKKE  448



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  9    MLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNL  188
            +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSG KK+GPAQLRVYNL
Sbjct  306  ILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGRKKRGPAQLRVYNL  365

Query  189  GNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSS  368
            GNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL++
Sbjct  366  GNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDLAT  425

Query  369  GLRKFVKWYVSYYGIQSRVKTE  434
            GLRKFVKWYV YYGIQ RVK E
Sbjct  426  GLRKFVKWYVGYYGIQPRVKKE  447



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  9    MLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNL  188
            +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVYNL
Sbjct  311  ILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVYNL  370

Query  189  GNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSS  368
            GNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL++
Sbjct  371  GNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDLAA  430

Query  369  GLRKFVKWYVSYYGIQSRVKTE  434
            GLRKFVKWYV YYGIQ RVK E
Sbjct  431  GLRKFVKWYVGYYGIQPRVKRE  452



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  309  KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  368

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  369  NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  428

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  458
            ++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  429  AAGLRKFVKWYVGYYGIQPRVKKET--SHAED  458



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  311  KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  370

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  371  NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  430

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYV YYGIQ RVK E
Sbjct  431  AAGLRKFVKWYVGYYGIQPRVKKE  454



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  9    MLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNL  188
            +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVYNL
Sbjct  311  ILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVYNL  370

Query  189  GNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSS  368
            GNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL++
Sbjct  371  GNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDLAA  430

Query  369  GLRKFVKWYVSYYGIQSRVKTE  434
            GLRKFVKWYV YYGIQ RVK E
Sbjct  431  GLRKFVKWYVGYYGIQPRVKRE  452



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  9    MLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNL  188
            +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVYNL
Sbjct  311  ILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVYNL  370

Query  189  GNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSS  368
            GNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL++
Sbjct  371  GNTSPVPVGRLVSILEGLLGSKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDLAA  430

Query  369  GLRKFVKWYVSYYGIQSRVKTE  434
            GLRKFVKWYV YYGIQ RVK E
Sbjct  431  GLRKFVKWYVGYYGIQPRVKRE  452



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPA LRVY
Sbjct  310  KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAMLRVY  369

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAY+DFGYKPTTDL
Sbjct  370  NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYRDFGYKPTTDL  429

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYV YYGIQ RVK E
Sbjct  430  AAGLRKFVKWYVGYYGIQPRVKRE  453



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  311  KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  370

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  371  NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  430

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELHPTHQSD  458
            ++GLRKFVKWYV YYGIQ RVK E   +H  D
Sbjct  431  AAGLRKFVKWYVGYYGIQPRVKKET--SHAED  460



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  310  KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  369

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  370  NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  429

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYV YYGIQ RVK E
Sbjct  430  AAGLRKFVKWYVGYYGIQPRVKKE  453



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  9    MLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNL  188
            +L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVYNL
Sbjct  307  ILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVYNL  366

Query  189  GNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSS  368
            GNTSPV V +LVSILE LL  KAKK+++KMPRNGDVPFTHANVSLAY+DFGYKPTTDL++
Sbjct  367  GNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPFTHANVSLAYRDFGYKPTTDLAT  426

Query  369  GLRKFVKWYVSYYGIQSRVKTE  434
            GLRKFVKWYV YYGIQ R K E
Sbjct  427  GLRKFVKWYVGYYGIQPRGKKE  448



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI++Y TQ+ K VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  302  KDILQGKPIDIYRTQDQKAVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRVY  361

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL+ KAKK+VV +PRNGDVP+THANV+LAYKDFGYKPTTDL
Sbjct  362  NLGNTSPVPVGRLVSILEGLLNTKAKKHVVTLPRNGDVPYTHANVTLAYKDFGYKPTTDL  421

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            SSGLRKFVKWYV+Y+GI+S+   E
Sbjct  422  SSGLRKFVKWYVNYFGIESKHSKE  445



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I++Y TQ+++EVARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRVY
Sbjct  311  KDILHGKSIDIYRTQDNQEVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGQAQLRVY  370

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL  KAKK+++KMPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  371  NLGNTSPVPVGRLVSILEGLLGTKAKKHLIKMPRNGDVPYTHANVSLAYKDFGYKPTTDL  430

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
            ++GLRKFVKWYV YYGIQ RVK
Sbjct  431  AAGLRKFVKWYVGYYGIQPRVK  452



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY TQE K+VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPAQLRVY
Sbjct  313  KDILQGKTIDVYQTQEGKQVARDFTYIDDIVKGCLGALDTAQKSTGSGGKKKGPAQLRVY  372

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LLS KAKK+V+KMP NGDVPFTHANVSLAY+DF Y PTTDL
Sbjct  373  NLGNTSPVPVGTLVSILEGLLSTKAKKHVIKMPSNGDVPFTHANVSLAYRDFSYNPTTDL  432

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELH  440
            ++GLRKFVKWY+ YYG+Q R+K E H
Sbjct  433  ATGLRKFVKWYLGYYGLQQRLKKEYH  458



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 127/144 (88%), Gaps = 7/144 (5%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY TQ+D+EVARDFTYIDDVVKGCVGA  +        GKK+GPAQLRVY
Sbjct  316  KDILQGKTIDVYKTQDDREVARDFTYIDDVVKGCVGATGSG-------GKKRGPAQLRVY  368

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILENLL+ KAKK+V++MPRNGDVP+THANVSLAYKDFGYKPTTDL
Sbjct  369  NLGNTSPVPVGRLVSILENLLNTKAKKHVIRMPRNGDVPYTHANVSLAYKDFGYKPTTDL  428

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYVSYYGIQ RVK E
Sbjct  429  AAGLRKFVKWYVSYYGIQPRVKKE  452



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            + +LQGKPI+VY TQ+++EVARDFTYIDDVVKGC+GALDTAEKSTG GGKK G AQLRVY
Sbjct  268  KSILQGKPIDVYQTQDEREVARDFTYIDDVVKGCLGALDTAEKSTGGGGKKHGAAQLRVY  327

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNGDVPFTHANVSLA++DFGYKPTTDL
Sbjct  328  NLGNTSPVPVGKLVSVLETLLRVKAKKHVIKMPRNGDVPFTHANVSLAWRDFGYKPTTDL  387

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFV+WYV YYG++  V+ E
Sbjct  388  ATGLRKFVQWYVGYYGVRLGVEKE  411



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI++Y T + +EV RDFTYIDD+VKGCVGALDTAEKSTGSGGKK+GPAQLRVY
Sbjct  299  KDILQGKPISIYKTHDGEEVQRDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGPAQLRVY  358

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL++KAKK+++ MPRNGDVP+THANV+LA KDF YKPTTDL
Sbjct  359  NLGNTSPVPVARLVSILEGLLNVKAKKHLITMPRNGDVPYTHANVTLARKDFAYKPTTDL  418

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYV YYG+Q  VK E
Sbjct  419  ATGLRKFVKWYVGYYGVQPSVKKE  442



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  18   GKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNLGNT  197
            GKPI++Y TQ+ K VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLRVYNLGNT
Sbjct  263  GKPIDIYRTQDQKAVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRVYNLGNT  322

Query  198  SPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSSGLR  377
            SPV V +LVSILE LL+ KAKK+VV +PRNGDVP+THANV+LAYKDFGYKPTTDLSSGLR
Sbjct  323  SPVPVGRLVSILEGLLNTKAKKHVVTLPRNGDVPYTHANVTLAYKDFGYKPTTDLSSGLR  382

Query  378  KFVKWYVSYYGIQSRVKTE  434
            KFVKWYV+Y+GI+S+   E
Sbjct  383  KFVKWYVNYFGIESKHSKE  401



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI+VY T +  EVARDFTYIDDVV+GC+GALDTA+KSTGSGG+KK PAQLRVY
Sbjct  299  KDILQGKPIDVYRTHDQHEVARDFTYIDDVVRGCLGALDTAQKSTGSGGRKKAPAQLRVY  358

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LV ILE+LL  KAK++V+ MPRNGDVPFTHANV+LA +DFGYKPTTDL
Sbjct  359  NLGNTSPVPVGRLVGILESLLGTKAKRHVITMPRNGDVPFTHANVTLAGRDFGYKPTTDL  418

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
            ++GLRKFVKWYVSYYG++ R K +
Sbjct  419  ATGLRKFVKWYVSYYGVEPRSKKD  442



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY TQ+ K+VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  289  KDILQGKTIDVYQTQDGKQVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILENLL+ KAK++V+KMP NGDVP+THANVS A++DF YKPTTDL
Sbjct  349  NLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNGDVPYTHANVSQAFRDFSYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
             SGLRKFVKWYV YYG Q R K E
Sbjct  409  PSGLRKFVKWYVGYYGPQLRPKKE  432



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY TQ+ K+VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+GPAQ R+Y
Sbjct  289  KDILQGKTIDVYQTQDGKQVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGPAQFRIY  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILENLL+ KAK++V+KMP NGDVP+THANVS A++DF YKPTTDL
Sbjct  349  NLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNGDVPYTHANVSQAFRDFSYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
             SGLRKFVKWYV YYG Q R K E
Sbjct  409  PSGLRKFVKWYVGYYGPQLRPKKE  432



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY TQ+ K+VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+GPAQLR+Y
Sbjct  289  KDILQGKTIDVYQTQDGKQVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGPAQLRIY  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILENLL+ KAK++V+KMP NGDVP+THANVS A++DF YKPTTDL
Sbjct  349  NLGNTSPVPVGNLVSILENLLNTKAKRHVIKMPSNGDVPYTHANVSQAFRDFFYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL  437
             SGLRKFVKWYV YYG Q R K E 
Sbjct  409  PSGLRKFVKWYVGYYGPQLRPKKEF  433



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkg-PAQLRV  179
            + +LQ KPI+VY T +++EVARDFTYIDDVVKGC+GALDTAEKSTG    KK  PAQLRV
Sbjct  343  KSILQRKPIDVYQTHDEREVARDFTYIDDVVKGCLGALDTAEKSTGGVVGKKRGPAQLRV  402

Query  180  YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  359
            YNLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNGDVPFTHANVSLA++D GYKPTTD
Sbjct  403  YNLGNTSPVPVGKLVSVLETLLGVKAKKHVIKMPRNGDVPFTHANVSLAWRDLGYKPTTD  462

Query  360  LSSGLRKFVKWYVSYYGIQSRVKTELH  440
            L++GLRKFV+WYV YYG++  V+ E H
Sbjct  463  LAAGLRKFVQWYVGYYGVRLGVEKEKH  489



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI+VY TQ+ K+VARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  301  KDILQGKPIDVYQTQDKKQVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRVY  360

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILE LL  KA+K+V+KMPRNGDVP+THANV+LAY+DFGYKPTTDL
Sbjct  361  NLGNTSPVPVGKLVSILEGLLRTKARKHVIKMPRNGDVPYTHANVTLAYRDFGYKPTTDL  420

Query  363  SSGLRKFVKWYVSYY  407
            ++GLRKFVKWY+  +
Sbjct  421  ATGLRKFVKWYIKLW  435



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I ++   + ++VARDFTYIDD+V+GC+GALDTA++STGSGG+K+GPAQLRVY
Sbjct  292  KDILQGKAITIFERADGQDVARDFTYIDDIVRGCIGALDTAQRSTGSGGRKRGPAQLRVY  351

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V+ LV ILE LL + AKKNVV+MP NGDVPFTHANVS + +DFGY+PTTDL
Sbjct  352  NLGNTSPVTVKGLVGILEGLLGLTAKKNVVRMPGNGDVPFTHANVSSSVRDFGYRPTTDL  411

Query  363  SSGLRKFVKWYVSYYGIQ  416
            ++GLRKFVKWYV+YYGI+
Sbjct  412  ATGLRKFVKWYVNYYGIK  429



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            + +LQGKPI+VY TQ+++EVARDFTYIDDVVKGC+GALDTAEKSTG GGKK G AQLRVY
Sbjct  268  KSILQGKPIDVYQTQDEREVARDFTYIDDVVKGCLGALDTAEKSTGGGGKKHGAAQLRVY  327

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVS+LE LL +KAKK+V+KMPRNGDVPFTHANVSLA++DFGYKPTTDL
Sbjct  328  NLGNTSPVPVGKLVSVLETLLRVKAKKHVIKMPRNGDVPFTHANVSLAWRDFGYKPTTDL  387

Query  363  SSGLRKFVK  389
            ++GLRKFV+
Sbjct  388  ATGLRKFVQ  396



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score =   198 bits (504),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I ++      +VARDFTYIDD+VKGCVGALDTAEKSTGSG KKKGPAQLR+Y
Sbjct  287  KDILQGKTIPIFQGPNQVDVARDFTYIDDIVKGCVGALDTAEKSTGSGEKKKGPAQLRIY  346

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV +LV ILE LL +KAKKNV++MP NGDVPFTHANV+LA  + GYKPTTDL
Sbjct  347  NLGNTSPVSVPELVRILEELLKVKAKKNVLRMPSNGDVPFTHANVTLASMELGYKPTTDL  406

Query  363  SSGLRKFVKWYVSYYGIQSRV  425
            ++GL+KFVKWY+SYYG+  R+
Sbjct  407  ATGLKKFVKWYLSYYGVPGRI  427



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  6    DMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYN  185
            D++ GKPI ++  Q+   V RDFTYIDDVVKGC+GALDTA+ STGSG KK+GPAQLRVYN
Sbjct  306  DIISGKPITLFRMQDGAAVQRDFTYIDDVVKGCLGALDTAKPSTGSGSKKRGPAQLRVYN  365

Query  186  LGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLS  365
            LGNTSPV V K+V ILE LL  KAKKNVV +P+NGDVP+THANVSLA KDFGY+PTTDL+
Sbjct  366  LGNTSPVPVAKMVGILEELLGKKAKKNVVTLPQNGDVPYTHANVSLAEKDFGYRPTTDLA  425

Query  366  SGLRKFVKWYVSYYGIQS  419
            +GL+KFVKWYV YYG+++
Sbjct  426  TGLKKFVKWYVEYYGVKT  443



>gb|EYU31498.1| hypothetical protein MIMGU_mgv1a008581mg [Erythranthe guttata]
Length=369

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgP-AQLRV  179
            +D+L GK INVYVTQ++KEVARDFTYIDD+VKGCVGAL+   +      ++  P A   +
Sbjct  214  KDILHGKGINVYVTQDEKEVARDFTYIDDIVKGCVGALEHGGEEHRKRREEARPGAAPGL  273

Query  180  YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  359
               G   P     LV ILE LL  KAKK VVKMPRNGDVP+THANVSLAYKDFGYKPTTD
Sbjct  274  QPWGTPPPSPSESLVGILETLLGTKAKKRVVKMPRNGDVPYTHANVSLAYKDFGYKPTTD  333

Query  360  LSSGLRKFVKWYVSYYGIQSRVKTELHP  443
            L++GLRKFVKWYVSYYGI+SRVK E  P
Sbjct  334  LATGLRKFVKWYVSYYGIESRVKKENEP  361



>ref|XP_002511693.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF50362.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=152

 Score =   188 bits (477),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  8    RDILKGKSISIFEAANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRVF  67

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+SLA  + GYKPTTDL
Sbjct  68   NLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISLAQMELGYKPTTDL  127

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFV+WY+SYY +  +
Sbjct  128  QTGLKKFVRWYLSYYHVGGK  147



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I+VY      +VARDFTYIDD+ KGCV ALDTA+KSTGSGGKKKGPAQLR+Y
Sbjct  294  KDILQGKSIDVYQGLNKVDVARDFTYIDDIAKGCVAALDTAKKSTGSGGKKKGPAQLRIY  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV  LV+ILE LL +KAKKN++ MP NGDVPFTHANVSLA+ + GY+PTTDL
Sbjct  354  NLGNTSPVSVPDLVNILERLLKVKAKKNIISMPSNGDVPFTHANVSLAHTELGYQPTTDL  413

Query  363  SSGLRKFVKWYVSYYGIQSRV  425
             +GL+KFVKWY+SYYG+  R+
Sbjct  414  QTGLKKFVKWYLSYYGVPGRI  434



>ref|XP_009133725.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Brassica rapa]
Length=435

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I+++ +     VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+GPAQLRV+
Sbjct  292  KDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPAQLRVF  351

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  352  NLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTTDL  411

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  412  QTGLKKFVRWYLSYY  426



>emb|CDY67756.1| BnaA03g56770D [Brassica napus]
Length=435

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I+++ +     VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+GPAQLRV+
Sbjct  292  KDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPAQLRVF  351

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  352  NLGNTSPVPVSDLVSILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTTDL  411

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  412  QTGLKKFVRWYLSYY  426



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPIN+Y   +  ++ARDFTYIDD+VKGC+GALDTA  STG+GGKK+GPAQLRVY
Sbjct  293  KDILQGKPINIYQGPDQTDLARDFTYIDDIVKGCLGALDTALLSTGTGGKKRGPAQLRVY  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V +LVSILE  L +KAKKN VKMPRNGDVPFTHANV+LA  +  Y P+TDL
Sbjct  353  NLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPRNGDVPFTHANVTLARNELRYNPSTDL  412

Query  363  SSGLRKFVKWYVSYYGIQS  419
             +GL+KFVKWY SYYG+ S
Sbjct  413  YTGLKKFVKWYESYYGLTS  431



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPIN+Y   +  ++ARDFTYIDD+VKGC+GALDTA  STG+GGKK+GPAQLRVY
Sbjct  298  KDILQGKPINIYQGPDQTDLARDFTYIDDIVKGCLGALDTALLSTGTGGKKRGPAQLRVY  357

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V +LVSILE  L +KAKKN VKMPRNGDVPFTHANV+LA  +  Y P+TDL
Sbjct  358  NLGNTSPVTVPELVSILEKHLKVKAKKNFVKMPRNGDVPFTHANVTLARNELRYNPSTDL  417

Query  363  SSGLRKFVKWYVSYYGIQS  419
             +GL+KFVKWY SYYG+ S
Sbjct  418  YTGLKKFVKWYESYYGLTS  436



>emb|CDX95646.1| BnaC03g25270D [Brassica napus]
Length=435

 Score =   193 bits (491),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I+++ +     VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+GPAQLRV+
Sbjct  292  KDILKGKSISIFESANHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGPAQLRVF  351

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE  L +KAK+NV+KMPRNGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  352  NLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPRNGDVPFTHANISLAQRELGYKPTTDL  411

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  412  QTGLKKFVRWYLSYY  426



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPAQLRV+
Sbjct  293  KDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+NV+K+PRNGDVP+THAN+S A K+FGYKPTTDL
Sbjct  353  NLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPRNGDVPYTHANISYAQKEFGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  413  QTGLKKFVRWYLSYYG  428



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkg-PAQLRV  179
            + +L G  I ++ T++  +V RDFTYIDDVVKGC+GALDTA+KSTGS G KK  PAQLRV
Sbjct  299  KSILSGDAITLFKTRDGADVQRDFTYIDDVVKGCLGALDTAQKSTGSRGGKKHGPAQLRV  358

Query  180  YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  359
            YNLGNTSPVSV K+V+ILE LL  KAKKNVV MPRNGDVP+THANVSLA KDFGY+PTTD
Sbjct  359  YNLGNTSPVSVGKMVAILEELLGKKAKKNVVTMPRNGDVPYTHANVSLAEKDFGYRPTTD  418

Query  360  LSSGLRKFVKWYVSYYGIQ-SRVK  428
            L++GLR+FVKWYV Y G+  SR K
Sbjct  419  LATGLRRFVKWYVEYNGVAVSRAK  442



>ref|XP_009409770.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI V+  ++  ++ARDFTYIDDVVKGCV ALDTAE STGSGG+K+ PAQ R+Y
Sbjct  290  RNILQGKPITVFRGRDGTDLARDFTYIDDVVKGCVAALDTAEASTGSGGRKRSPAQYRIY  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L +KAKKNV +MP NGDVPFTHAN+SLA  + GYKPTT+L
Sbjct  350  NLGNTSPVTVPALVGILERHLKMKAKKNVAEMPGNGDVPFTHANISLARAELGYKPTTNL  409

Query  363  SSGLRKFVKWYVSYYGIQSRV  425
             +GL+KFVKWY+SYYG   RV
Sbjct  410  ETGLKKFVKWYLSYYGYSRRV  430



>ref|XP_006837081.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
 gb|ERM99934.1| hypothetical protein AMTR_s00110p00097630 [Amborella trichopoda]
Length=434

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTG+GGKK+GPAQLR++
Sbjct  291  KDILQGKTIPIFEGPNHGTVARDFTYIDDIVKGCLGSLDTAEKSTGTGGKKRGPAQLRIF  350

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V+ LVSILE LL +KAKK ++KMPRNGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  351  NLGNTSPVPVKDLVSILERLLKVKAKKTIIKMPRNGDVPFTHANISLAQRELGYKPTTDL  410

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFVKWY+ YY
Sbjct  411  QTGLKKFVKWYLGYY  425



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPAQLRV+
Sbjct  289  KDILNGKTIPIFEAANHGNVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPAQLRVF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVP+THAN+S A K+FGYKPTTDL
Sbjct  349  NLGNTSPVPVTDLVSILERLLKVKAKRNIMKLPRNGDVPYTHANISYAQKEFGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  409  QTGLKKFVRWYLSYYG  424



>ref|XP_001761086.1| predicted protein [Physcomitrella patens]
 gb|EDQ74153.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK IN+Y     K++ARDFTYIDD+VKGCVGALDTAEKSTGSGGKK GPAQLRV+
Sbjct  299  RDILRGKAINIYTGNGGKDLARDFTYIDDIVKGCVGALDTAEKSTGSGGKKTGPAQLRVF  358

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L  KAK+N++KMPRNGDVPFTHAN+S A   F Y PTT+L
Sbjct  359  NLGNTSPVTVPTLVDILEKYLKQKAKRNIIKMPRNGDVPFTHANISYAQSQFNYHPTTNL  418

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL  437
             +GL+KFVKWY+SYYG+ +  K  L
Sbjct  419  DTGLKKFVKWYLSYYGVGTDHKLWL  443



>ref|XP_009781927.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=408

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK INV+    +K VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG AQLRV+
Sbjct  264  KDILKGKSINVFEGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGNAQLRVF  323

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILE LL +KAKKNV+ +PRNGDV FTHAN+S A+K+FGYKPTT+L
Sbjct  324  NLGNTSPVPVTKLVSILEKLLKVKAKKNVLPLPRNGDVMFTHANISYAHKEFGYKPTTNL  383

Query  363  SSGLRKFVKWYVSYYGIQSRVKT  431
              GL+KFV WY+ YY +  + K+
Sbjct  384  QMGLQKFVNWYLDYYSVSEKKKS  406



>ref|XP_009380772.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 114/141 (81%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++  ++ARDFTYIDD+VKGCV ALDTAE STG G +K+ PAQ R+Y
Sbjct  290  RNILQGKPITVYRGRDGTDLARDFTYIDDIVKGCVAALDTAEASTGIGKQKRRPAQYRIY  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L +KA+KN+V+MP NGDVPFTHAN+SLA  + GYKPTT+L
Sbjct  350  NLGNTSPVTVPALVRILERYLKVKARKNMVEMPGNGDVPFTHANISLARAELGYKPTTNL  409

Query  363  SSGLRKFVKWYVSYYGIQSRV  425
             +GL+KFVKWY+SYYG   R 
Sbjct  410  ETGLKKFVKWYLSYYGYSRRA  430



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  ++  ++ARDFTYIDD+VKGC+G+LDTAEKSTGSGGKK+ PAQ R+Y
Sbjct  288  RNILQGKPITIYRGKDRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRRPAQYRIY  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+NVV+MP NGDVPFTHAN+SLA  + GYKPTT+L
Sbjct  348  NLGNTSPVTVPTLVSILERYLKVKAKRNVVEMPGNGDVPFTHANISLARAELGYKPTTNL  407

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFVKWY+ YYG + R
Sbjct  408  ETGLKKFVKWYLHYYGYRPR  427



>ref|XP_006397710.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
 gb|ESQ39163.1| hypothetical protein EUTSA_v10001454mg [Eutrema salsugineum]
Length=435

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I+++ +     VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+GPAQLRV+
Sbjct  292  KDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLRVF  351

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE  L +KAK+NV+KMPRNGDVPFTHAN+SLA  + GYKPTTDL
Sbjct  352  NLGNTSPVPVSDLVSILERQLKVKAKRNVIKMPRNGDVPFTHANISLAQHELGYKPTTDL  411

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  412  QTGLKKFVRWYLSYY  426



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkg-PAQLRV  179
            + +L G  I ++ T++  +V RDFTYIDDVVKGC+GALDTAEKSTGS G K+   AQLRV
Sbjct  302  KSILSGNAITLFKTRDGADVQRDFTYIDDVVKGCLGALDTAEKSTGSRGGKRRGAAQLRV  361

Query  180  YNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTD  359
            YNLGNTSPV V K+V+ILE LL  KAKKNVV MPRNGDVP+THANVSLA KDFGY+PTTD
Sbjct  362  YNLGNTSPVPVGKMVAILEELLGKKAKKNVVTMPRNGDVPYTHANVSLAEKDFGYRPTTD  421

Query  360  LSSGLRKFVKWYVSYYGIQS  419
            L++GLR+FVKWYV YYG+ +
Sbjct  422  LTAGLRRFVKWYVEYYGVTA  441



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             DML+GK I+++   +   VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  293  RDMLKGKSISIFEGADHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+ V+K+PRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  353  NLGNTSPVPVSDLVTILERLLKVKAKRAVMKLPRNGDVQFTHANISLAQRELGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  413  QTGLKKFVRWYLSYYG  428



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 120/141 (85%), Gaps = 2/141 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgs--ggkkkgPAQLR  176
            + +L GKPI ++   +   V RDFTYIDDVVKGC+GAL+TA+KSTG   GGKK+GPAQLR
Sbjct  304  KSILSGKPITLFRMPDGTAVQRDFTYIDDVVKGCLGALNTAKKSTGVPGGGKKRGPAQLR  363

Query  177  VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  356
            VYNLGNTSPV V ++VSILE+L+  KAKKNVV +P+NGDVPFTHANVSLA  DFGY+PTT
Sbjct  364  VYNLGNTSPVPVAEMVSILEHLIGKKAKKNVVTLPQNGDVPFTHANVSLAKTDFGYRPTT  423

Query  357  DLSSGLRKFVKWYVSYYGIQS  419
            DL++GLRKFVKWYV YYG+Q+
Sbjct  424  DLATGLRKFVKWYVEYYGVQT  444



>ref|XP_006295696.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
 gb|EOA28594.1| hypothetical protein CARUB_v10024814mg [Capsella rubella]
Length=436

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPAQLRV+
Sbjct  293  KDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE  L +KAKKN++KMPRNGDVP+THAN+SLA ++ GYKPTTDL
Sbjct  353  NLGNTSPVPVSDLVSILERQLKVKAKKNLIKMPRNGDVPYTHANISLAQRELGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYYGIQSRV  425
             +GL+KFV+WY+SYY  Q + 
Sbjct  413  QTGLKKFVRWYLSYYSGQKKA  433



>ref|XP_010506472.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Camelina sativa]
Length=444

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPAQLRV+
Sbjct  299  KDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAQLRVF  358

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV ILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  359  NLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTTDL  418

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  419  QTGLKKFVRWYLSYY  433



>ref|XP_002880171.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56430.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis lyrata subsp. lyrata]
Length=437

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I+++ +     VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+GPAQLRV+
Sbjct  294  KDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLRVF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV ILE  L +KAKKN++KMPRNGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  354  NLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTTDL  413

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  414  QTGLKKFVRWYLSYY  428



>ref|XP_010506473.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=442

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPAQLRV+
Sbjct  297  KDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAQLRVF  356

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV ILE  L +KAKKNV+KMPRNGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  357  NLGNTSPVPVSDLVRILERQLKVKAKKNVIKMPRNGDVPFTHANISLAQRELGYKPTTDL  416

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  417  QTGLKKFVRWYLSYY  431



>ref|NP_182056.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
 sp|O22141.1|GAE4_ARATH RecName: Full=UDP-glucuronate 4-epimerase 4; AltName: Full=UDP-glucuronic 
acid epimerase 4; Short=AtUGlcAE1 [Arabidopsis 
thaliana]
 gb|AAB82632.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO42241.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAO64072.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAT06796.1| UDP-glucuronic acid epimerase 1 [Arabidopsis thaliana]
 gb|AEC10537.1| UDP-D-glucuronate 4-epimerase 4 [Arabidopsis thaliana]
Length=437

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I+++ +     VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+GPAQLRV+
Sbjct  294  KDILKGKSISIFESANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGPAQLRVF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV ILE  L +KAKKN++KMPRNGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  354  NLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTTDL  413

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  414  QTGLKKFVRWYLSYY  428



>emb|CDP09891.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I +Y   +   VARDFTYIDDVVKGC+ ALDTA+KSTGSGGKK+G AQ R+Y
Sbjct  312  KDILRGKEIKIYEGVDHGTVARDFTYIDDVVKGCLAALDTAKKSTGSGGKKRGAAQFRIY  371

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNT+PV + +LVSILE LL +KAKK V++MPRNGDVPFTHAN+SLA+K+ GYKPTTDL
Sbjct  372  NLGNTTPVPIGRLVSILEKLLRVKAKKKVIQMPRNGDVPFTHANISLAHKELGYKPTTDL  431

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFVKWYV YYG + +
Sbjct  432  EAGLKKFVKWYVGYYGSKKK  451



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKK PAQLRV+
Sbjct  293  KDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKRPAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+NV+K+PRNGDVP+THAN+S A K+FGYK TTDL
Sbjct  353  NLGNTSPVPVTDLVSILERLLKVKAKRNVMKLPRNGDVPYTHANISYAQKEFGYKATTDL  412

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  413  QTGLKKFVRWYLSYYG  428



>dbj|BAF00333.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=292

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  147  RDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVF  206

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++FGYKP+TDL
Sbjct  207  NLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPSTDL  266

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  267  QTGLKKFVRWYLGYY  281



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L GK I ++       VARDFTYIDD+VKGC+G+LDTAEKSTGSGGKKKGPAQLRV+
Sbjct  289  KDILNGKTIPIFEAANHGNVARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKKGPAQLRVF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDVP+THAN+S A K+FGYKPTTDL
Sbjct  349  NLGNTSPVPVTDLVSILERLLKVKAKRKIMKLPRNGDVPYTHANISYAQKEFGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  409  QTGLKKFVRWYLSYYG  424



>ref|XP_004234942.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum lycopersicum]
Length=406

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +++L+GKPI+V+    +K VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKK  AQLRV+
Sbjct  264  KNILKGKPISVFQGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKKNAQLRVF  323

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILE LL +KAK+NV+ +P NGDV FTHAN+S A+K+FGYKPTTDL
Sbjct  324  NLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPTNGDVMFTHANISYAHKEFGYKPTTDL  383

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL KFV WY+ YY +  +
Sbjct  384  QTGLHKFVNWYLDYYSVSEK  403



>gb|AFK41785.1| unknown [Medicago truncatula]
Length=154

 Score =   180 bits (456),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I V+ + +   VARDFTYIDDVVKGC+GALDTA+KSTGSGGKKKG AQ RV+
Sbjct  8    KDILKGKQITVFESPDGGSVARDFTYIDDVVKGCLGALDTAKKSTGSGGKKKGSAQFRVF  67

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLV+ILE LL + AKK V+ MPRNGDV FTHAN+SLA ++FGYKPT DL
Sbjct  68   NLGNTSPVPVSKLVAILEKLLKVNAKKRVLPMPRNGDVKFTHANISLAQREFGYKPTIDL  127

Query  363  SSGLRKFVKWYVSYY  407
             +GLRKFVKWY+ +Y
Sbjct  128  ETGLRKFVKWYLEFY  142



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score =   189 bits (480),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +3

Query  9    MLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNL  188
            +L G  I ++ T++  +V RDFTYIDDVV+GC+GALDTA KSTG+GGKK+GPAQLRVYNL
Sbjct  303  ILSGNAITLFKTRDGVDVQRDFTYIDDVVQGCLGALDTAGKSTGTGGKKRGPAQLRVYNL  362

Query  189  GNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSS  368
            GNTSPV V K+V+ILE LL  KAKKNVV MPRNGDVP+THANV+LA KDF Y+PTTDL++
Sbjct  363  GNTSPVPVGKMVAILEELLGKKAKKNVVTMPRNGDVPYTHANVTLAQKDFKYRPTTDLAT  422

Query  369  GLRKFVKWYVSYYGIQS  419
            GLR+FVKWYV YYG+ +
Sbjct  423  GLRRFVKWYVEYYGVAA  439



>ref|XP_009111519.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica rapa]
Length=430

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GKPI+V+       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  288  RDILKGKPISVFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+N+VKMPRNGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  348  NLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPRNGDVPFTHANISSAQRELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KF +WY+ YY
Sbjct  408  QTGLKKFARWYLGYY  422



>gb|EYU31982.1| hypothetical protein MIMGU_mgv1a012102mg [Erythranthe guttata]
Length=261

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG AQLRV+
Sbjct  119  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGAAQLRVF  178

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  179  NLGNTSPVPVSDLVSILERLLKVKAKRLIMKLPRNGDVQFTHANISLAQRELGYKPTTDL  238

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  239  QTGLKKFVRWYLSYYG  254



>emb|CAN73017.1| hypothetical protein VITISV_004389 [Vitis vinifera]
Length=149

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+ K I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPAQLR++
Sbjct  8    RDILKEKSIPIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLRIF  67

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  68   NLGNTSPVPVTDLVSILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYKPTTDL  127

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  128  QTGLKKFVRWYLKYY  142



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  295  KDILKGKAIQIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVY  354

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  355  NLGNTSPVPVSDLVSILERLLKVKAKRTIMKLPRNGDVQFTHANISLAQRELGYKPTTDL  414

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  415  QTGLKKFVRWYLSYYG  430



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTAEKSTGSGGKK+GPAQ R+Y
Sbjct  288  RNILQGKPITVYSGKDRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRGPAQYRIY  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L  KAK+NVV MP NGDVPFTHAN+SLA  + GYKPTT+L
Sbjct  348  NLGNTSPVTVPMLVSILERHLKAKAKRNVVAMPGNGDVPFTHANISLARAELGYKPTTNL  407

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFVKWY+ YYG   R
Sbjct  408  ETGLKKFVKWYLHYYGYSPR  427



>emb|CAN83831.1| hypothetical protein VITISV_003974 [Vitis vinifera]
Length=150

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+ K I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  8    RDILKEKSIPIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLRVF  67

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  68   NLGNTSPVPVTDLVNILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYKPTTDL  127

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFVKWY++YY
Sbjct  128  QTGLKKFVKWYLNYY  142



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 119/140 (85%), Gaps = 2/140 (1%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsgg--kkkgPAQLR  176
            + +L GKPI ++   +   V RDFT+I+DVVKGC+GALDTA+KSTG  G  KK+GPAQLR
Sbjct  304  KSILSGKPITLFRMPDGTAVQRDFTFIEDVVKGCLGALDTAKKSTGVAGGGKKRGPAQLR  363

Query  177  VYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTT  356
            +YNLGNTSPV V K+VSILE+LL  KAKKNVV +P+NGDVPFTHANVSLA +DFGY+PTT
Sbjct  364  IYNLGNTSPVPVAKMVSILEDLLRKKAKKNVVTLPQNGDVPFTHANVSLAERDFGYRPTT  423

Query  357  DLSSGLRKFVKWYVSYYGIQ  416
            DL++GL+KFVKWYV YYG++
Sbjct  424  DLATGLKKFVKWYVEYYGVE  443



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFT+IDD+VKGCV +LDTAEKSTGSGG+K  PAQ R+Y
Sbjct  289  RNILQGKPITVYRGKNRVDLARDFTFIDDIVKGCVASLDTAEKSTGSGGRKGSPAQYRIY  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L +KAKKNVV+MP NGDVPFTHAN+SLA  + GYKPTT+L
Sbjct  349  NLGNTSPVTVPALVGILERHLKVKAKKNVVEMPGNGDVPFTHANISLARAELGYKPTTNL  408

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFV+WY+SYYG   R
Sbjct  409  ETGLKKFVRWYLSYYGYSPR  428



>gb|KHN25558.1| UDP-glucuronate 4-epimerase 3 [Glycine soja]
Length=261

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLR++
Sbjct  119  RDLLKGKSIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLRIF  178

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A  + GYKPTTDL
Sbjct  179  NLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQSELGYKPTTDL  238

Query  363  SSGLRKFVKWYVSYY  407
             SGL+KFV+WY++YY
Sbjct  239  QSGLKKFVRWYLNYY  253



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPAQLRV+
Sbjct  293  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA K+FGYKPTTDL
Sbjct  353  NLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPRNGDVQFTHANISLAQKEFGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  413  QTGLKKFVRWYLSYYG  428



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPAQLRV+
Sbjct  293  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ ++K+PRNGDV FTHAN+SLA K+FGYKPTTDL
Sbjct  353  NLGNTSPVPVSDLVSILEKLLKVKAKRLIMKLPRNGDVQFTHANISLAQKEFGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  413  QTGLKKFVRWYLSYYG  428



>gb|KHN17533.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=262

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R++
Sbjct  119  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPAPYRIF  178

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  179  NLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYKPTTDL  238

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  239  QTGLKKFVKWYLSYYG  254



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA+KSTGSGGKK+GPAQ R+Y
Sbjct  288  RNILQGKPITVYSGKNRVDLARDFTYIDDIVKGCLGSLDTAKKSTGSGGKKRGPAQYRIY  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+NV++MP NGDVPFTHAN+SLA  + GYKPTT+L
Sbjct  348  NLGNTSPVTVPMLVSILERHLKVKAKRNVMEMPGNGDVPFTHANISLARAELGYKPTTNL  407

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFVKWY+ YYG   R
Sbjct  408  ETGLKKFVKWYLQYYGYSRR  427



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+G  I+++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLRV+
Sbjct  285  KDILKGNSISIFEAPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLRVF  344

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL +KAK+NV+KMPRNGDV FTHAN+S A K+FGYKPTTDL
Sbjct  345  NLGNTSPVPVTELVSILERLLKVKAKRNVMKMPRNGDVQFTHANISYAKKEFGYKPTTDL  404

Query  363  SSGLRKFVKWYVSYYGIQS  419
             +GL+ FV+WY++YY + +
Sbjct  405  ETGLKNFVRWYLNYYSVAA  423



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GKPI ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLRV+
Sbjct  296  RDLLKGKPIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLRVF  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A  + GYKPTTDL
Sbjct  356  NLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQSELGYKPTTDL  415

Query  363  SSGLRKFVKWYVSYY  407
             SGL+KFV+WY++YY
Sbjct  416  QSGLKKFVRWYLNYY  430



>ref|XP_010508183.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Camelina sativa]
Length=443

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I+++ +     VARDFTYIDD+VKGC+ +LDTAEKSTG+GGKK+GPA LRV+
Sbjct  298  KDILKGKSISIFESANHGTVARDFTYIDDIVKGCLASLDTAEKSTGTGGKKRGPAMLRVF  357

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV ILE  L +KAKKN++KMPRNGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  358  NLGNTSPVPVSDLVRILERQLKVKAKKNLIKMPRNGDVPFTHANISLAQRELGYKPTTDL  417

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
             +GL+KFV+WY+SYY    + K
Sbjct  418  QTGLKKFVRWYLSYYSSSGQSK  439



>ref|XP_010544649.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Tarenaya hassleriana]
Length=436

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+LQGK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGS GKKKGPAQLRV+
Sbjct  291  RDILQGKTIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSRGKKKGPAQLRVF  350

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV ILE LL +KAK+N++KMPRNGDVPFTHAN+S A  + GYKP+TDL
Sbjct  351  NLGNTSPVPVSDLVGILERLLKVKAKRNIMKMPRNGDVPFTHANISSAQHELGYKPSTDL  410

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WYVSYY
Sbjct  411  QTGLKKFVRWYVSYY  425



>ref|XP_010687680.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=434

 Score =   186 bits (471),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDDVVKGC+GALD++ KSTGSGGKK+GPA  R+Y
Sbjct  291  RNILQGKPITIYRGKNKVDLARDFTYIDDVVKGCLGALDSSGKSTGSGGKKRGPAPYRIY  350

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNT PV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +DFGYKPTTDL
Sbjct  351  NLGNTQPVTVPTLVSILEKSLKVKAKKNVVEMPGNGDVPFTHANISLARRDFGYKPTTDL  410

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  411  QTGLKKFVRWYLSYYG  426



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  6    DMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYN  185
            ++L+GKPI ++  Q+   V RDFTYIDDVVKGC+GALDTAE+STGSGGKK+GPAQLRVYN
Sbjct  304  NILRGKPITLFRVQDGTAVQRDFTYIDDVVKGCLGALDTAERSTGSGGKKRGPAQLRVYN  363

Query  186  LGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLS  365
            LGNTSPV V K+V ILE LL  KAKK+VV +P+NGDVP+THANVS+A +D GY+ TTDL+
Sbjct  364  LGNTSPVPVAKMVGILEELLGKKAKKHVVTLPQNGDVPYTHANVSMAERDLGYRATTDLA  423

Query  366  SGLRKFVKWYVSYYGIQSR  422
            +GL+KFV+WYV YY  +S+
Sbjct  424  TGLKKFVRWYVEYYDRKSK  442



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score =   186 bits (471),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+ PAQLRV+
Sbjct  295  RDILKGKPISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRRPAQLRVF  354

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYKPTTDL
Sbjct  355  NLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTTDL  414

Query  363  SSGLRKFVKWYVSYY  407
             SGL+KF +WY+ YY
Sbjct  415  QSGLKKFARWYLGYY  429



>ref|XP_009390535.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++  ++ARDFTYIDD+VKGCV +LDTAEKSTG+GG+K+GPAQ R+Y
Sbjct  288  RNILQGKPITVYRGKDRVDLARDFTYIDDIVKGCVASLDTAEKSTGTGGRKRGPAQYRIY  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE+ L +KAK+NVV+MP NGDVPFTHAN+SLA  + GYKPTT+L
Sbjct  348  NLGNTSPVTVPALVGILEHHLKMKAKRNVVEMPGNGDVPFTHANISLARAELGYKPTTNL  407

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL++FV+WY+ YYG  +R
Sbjct  408  ETGLKRFVRWYLLYYGYNTR  427



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            + +L GK I ++ T +   V RDFTYIDDVV+GC+GALDTA KSTGSGGKK+GPAQLRVY
Sbjct  299  KSILSGKAITLFKTHDGVGVRRDFTYIDDVVQGCLGALDTAGKSTGSGGKKRGPAQLRVY  358

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGN SPV V K+V+ILE LL  KAKKNVV MP NGDVP+THANVS A KDFGY+PTTDL
Sbjct  359  NLGNKSPVPVSKMVAILEELLGKKAKKNVVTMPMNGDVPYTHANVSSAEKDFGYRPTTDL  418

Query  363  SSGLRKFVKWYVSYYGI  413
            ++GLR+FVKWYV YYG+
Sbjct  419  ATGLRRFVKWYVEYYGV  435



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  279  KDILRGKSITIFEGPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGTAQLRVF  338

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+NV+KMPRNGDV FTHAN+S A K+FGYKPTTDL
Sbjct  339  NLGNTSPVPVTDLVSILERLLKVKAKRNVMKMPRNGDVQFTHANISYAKKEFGYKPTTDL  398

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WYV+YY
Sbjct  399  QTGLKKFVRWYVNYY  413



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  274  RDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVF  333

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++FGYKP+TDL
Sbjct  334  NLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPSTDL  393

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  394  QTGLKKFVRWYLGYY  408



>ref|XP_008794398.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Phoenix dactylifera]
Length=432

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDTAEKSTGSGGKK+ PAQ R+Y
Sbjct  288  RNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTAEKSTGSGGKKRRPAQYRIY  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+NVV+MP NGDVPFTHAN+SLA  +  YKPTT+L
Sbjct  348  NLGNTSPVTVPTLVSILERHLKVKAKRNVVEMPGNGDVPFTHANISLARAELRYKPTTNL  407

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFVKWY+ YYG   R
Sbjct  408  ETGLKKFVKWYLRYYGYSPR  427



>ref|XP_006365249.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Solanum tuberosum]
Length=406

 Score =   184 bits (467),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +++L+G PI+V+    +K VARDFTYID++VKGC+GALDTAEKSTGSGGKKK  AQLRV+
Sbjct  264  KNILKGNPISVFQGSNNKSVARDFTYIDEIVKGCLGALDTAEKSTGSGGKKKKNAQLRVF  323

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILE LL +KAK+NV+ +PRNGDV FTHAN+S A K+FGYKPTTDL
Sbjct  324  NLGNTSPVPVTKLVSILEKLLKVKAKRNVLPLPRNGDVMFTHANISYAQKEFGYKPTTDL  383

Query  363  SSGLRKFVKWYVSYYGI  413
              GL+KFV WY+ YY I
Sbjct  384  QMGLQKFVNWYLDYYSI  400



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA  R++
Sbjct  288  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V KLV+ILE  L +KAKKNV++MP NGDVPFTHAN+S A K+FGY+PTTDL
Sbjct  348  NLGNTSPVTVPKLVNILERHLKVKAKKNVIEMPGNGDVPFTHANISSAQKEFGYRPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  408  QTGLKKFVRWYLSYYG  423



>emb|CDY63064.1| BnaAnng18570D [Brassica napus]
Length=430

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+V+       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  288  RDILKGKAISVFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+N+VKMPRNGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  348  NLGNTSPVPVTDLVTILERLLKVKAKRNIVKMPRNGDVPFTHANISSAQRELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KF +WY+ YY
Sbjct  408  QTGLKKFARWYLGYY  422



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGCVGALDTA+KSTGSGGKKKGPAQLRV+
Sbjct  293  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCVGALDTAKKSTGSGGKKKGPAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A+K+ GYKPTTDL
Sbjct  353  NLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAHKELGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  413  QTGLKKFVRWYLSYYG  428



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  289  RDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++FGYKP+TDL
Sbjct  349  NLGNTSPVPVTDLVSILERLLKVKAKRNMMKLPRNGDVPFTHANISSAQREFGYKPSTDL  408

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  409  QTGLKKFVRWYLGYY  423



>ref|XP_009614886.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=434

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  294  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK++V+K+PRNGDV FTHAN+S A ++ GYKPTTDL
Sbjct  354  NLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPRNGDVQFTHANISFAKRELGYKPTTDL  413

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFV+WY+SYYG +++
Sbjct  414  HTGLKKFVRWYLSYYGDETK  433



>ref|XP_009621323.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana tomentosiformis]
Length=408

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +++L+GK INV+    +K VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKG AQLRV+
Sbjct  264  KNILKGKSINVFEGSNNKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGNAQLRVF  323

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVS+LE LL +KA+KNV+ +PRNGDV FTHAN+S A K+FGYKP+TDL
Sbjct  324  NLGNTSPVPVTKLVSLLEKLLKVKARKNVLPLPRNGDVMFTHANISYAQKEFGYKPSTDL  383

Query  363  SSGLRKFVKWYVSYYGIQSRVKT  431
              G++KF+ WY+ YY I  + K+
Sbjct  384  QMGIQKFLNWYLDYYSISEKKKS  406



>emb|CAN73016.1| hypothetical protein VITISV_004388 [Vitis vinifera]
Length=427

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  285  KDILKGKSIRIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLRVF  344

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  345  NLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPRNGDVQFTHANISLAQRELGYKPTTDL  404

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  405  QTGLKKFVRWYIKYY  419



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  291  KDILKGKSIRIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLRVF  350

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  351  NLGNTSPVPVTDLVSILERLLKVKAKRTMMKMPRNGDVQFTHANISLAQRELGYKPTTDL  410

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  411  QTGLKKFVRWYIKYY  425



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  295  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVY  354

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL + AK+N++K+PRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  355  NLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTTDL  414

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  415  QTGLKKFVRWYLSYY  429



>gb|KDP25603.1| hypothetical protein JCGZ_20759 [Jatropha curcas]
Length=436

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I V+ T + + VARDFTYIDD+V GC+ ALDTA+KSTGSGGKK+GPAQ RV+
Sbjct  292  KDILKGKEIGVFETADGRSVARDFTYIDDIVNGCLAALDTAKKSTGSGGKKRGPAQFRVF  351

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LV ILE+LL +KAKK V+ +PRNGDV FTHAN+SLA KD GYKPTTDL
Sbjct  352  NLGNTSPVPVSRLVGILESLLQVKAKKKVLPLPRNGDVEFTHANISLAQKDLGYKPTTDL  411

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  412  ETGLKKFVRWYLSYY  426



>ref|XP_002528222.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF34179.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=433

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA  R++
Sbjct  290  RNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPAPYRIF  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+NVV MP NGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  350  NLGNTSPVTVPTLVSILEKHLKMKAKRNVVDMPGNGDVPFTHANISLARRELGYKPTTDL  409

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  410  QTGLKKFVRWYLSYYG  425



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score =   184 bits (467),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLRV+
Sbjct  293  RDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  353  NLGNTSPVPVSDLVTILERLLKVKAKRNIMKLPRNGDVPFTHANISSAQRELGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WYVSYY
Sbjct  413  QTGLKKFVRWYVSYY  427



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGCV +LDTA+KSTGSGGKK+GPAQ R++
Sbjct  289  RNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCVASLDTAKKSTGSGGKKRGPAQYRIF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSP++V  +V ILE  L +KAKKNV++MP NGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  349  NLGNTSPITVPMMVGILEKHLKVKAKKNVIEMPGNGDVPFTHANISSARRELGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYG  410
             +GLRKFVKWY+SYYG
Sbjct  409  QTGLRKFVKWYLSYYG  424



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score =   184 bits (466),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++  ++ARDFT+IDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R++
Sbjct  288  RNILQGKPITVYRGKDRADLARDFTFIDDIVKGCVGSLDTSGKSTGSGGKKRGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVS+LE  L +KAK+N V MP NGDVPFTHAN+SLA+++ GYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVSLLERHLKVKAKRNFVDMPGNGDVPFTHANISLAHRELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
            ++GL+KFVKWY+SYYG
Sbjct  408  ATGLKKFVKWYLSYYG  423



>gb|KHN30291.1| UDP-glucuronate 4-epimerase 1 [Glycine soja]
Length=341

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R++
Sbjct  198  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPAPYRIF  257

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  258  NLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYKPTTDL  317

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  318  QTGLKKFVKWYLSYYG  333



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+ KPI ++       VARDFTYIDD+VKGC+ ALDTAEKSTG+GGKKKGPAQLRVY
Sbjct  293  RDILKRKPIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGTGGKKKGPAQLRVY  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +K K+N++K+PRNGDV FTHANVSLA ++ GYKPTTDL
Sbjct  353  NLGNTSPVPVSTLVSILERLLKVKVKRNIMKLPRNGDVQFTHANVSLAQRELGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFVKWY S+Y
Sbjct  413  QTGLKKFVKWYTSFY  427



>gb|KGN57287.1| hypothetical protein Csa_3G176330 [Cucumis sativus]
Length=262

 Score =   179 bits (454),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I V+   + K VARDFTYIDD+VKGC+GALDTAEKSTGSGG+KKG AQLRV+
Sbjct  119  KDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKAQLRVF  178

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNGDVPFTHAN+SLA K+ GYKPTTDL
Sbjct  179  NLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYKPTTDL  238

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL++FV WY  YY   S+
Sbjct  239  KTGLKEFVDWYRLYYSNSSK  258



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  290  RDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVF  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  350  NLGNTSPVPVSDLVSILEKLLKVKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTTDL  409

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY++YY
Sbjct  410  QTGLKKFVRWYLNYY  424



>gb|EMT26004.1| UDP-glucuronate 4-epimerase 4 [Aegilops tauschii]
Length=176

 Score =   176 bits (446),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 116/150 (77%), Gaps = 4/150 (3%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQ----EDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQ  170
             D+L G+PI VY +         ++RDFTYIDD+VKGC+GALDTA +STGSGGKK+GPA 
Sbjct  8    RDILAGRPITVYESSGGGTHQTTISRDFTYIDDIVKGCIGALDTAGRSTGSGGKKRGPAP  67

Query  171  LRVYNLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKP  350
             R YNLGNTSPV V +LV +LE +L +KA + VVKMPRNGDVP+THAN+SLA ++ GY+P
Sbjct  68   FRTYNLGNTSPVPVTQLVDLLEKMLKVKAVRRVVKMPRNGDVPYTHANISLAQRELGYRP  127

Query  351  TTDLSSGLRKFVKWYVSYYGIQSRVKTELH  440
            +TDL +GL+KFV+WY+ YY  +  VK + H
Sbjct  128  STDLQTGLKKFVRWYLEYYNPELAVKQKQH  157



>gb|KFK42571.1| hypothetical protein AALP_AA1G012900 [Arabis alpina]
Length=436

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  294  RDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGQAQLRVF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAKKN++K+PRNGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  354  NLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPRNGDVPFTHANISSAQRELGYKPTTDL  413

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  414  QTGLKKFVRWYLGYY  428



>ref|XP_002993206.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
 gb|EFJ05726.1| hypothetical protein SELMODRAFT_136684 [Selaginella moellendorffii]
Length=455

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +3

Query  9    MLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNL  188
            +LQGKP+N+Y      ++ARDFTYIDD+VKGC GALDTA  STG+GGKK+GPAQLRVYNL
Sbjct  305  ILQGKPVNIYQGPNQVDLARDFTYIDDIVKGCFGALDTATPSTGTGGKKRGPAQLRVYNL  364

Query  189  GNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSS  368
            GNTSPV+V  LV+ILE  L +KAK+NVV+MPRNGDVPFTHANV+LA  + GY PTTDL +
Sbjct  365  GNTSPVTVPTLVAILEKHLKVKAKRNVVRMPRNGDVPFTHANVTLARVELGYNPTTDLQT  424

Query  369  GLRKFVKWYVSYY  407
            GL+KFVKWY  YY
Sbjct  425  GLKKFVKWYQLYY  437



>ref|XP_002965479.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
 gb|EFJ32899.1| hypothetical protein SELMODRAFT_84174 [Selaginella moellendorffii]
Length=456

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +3

Query  9    MLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYNL  188
            +LQGKP+N+Y      ++ARDFTYIDD+VKGC GALDTA  STG+GGKK+GPAQLRVYNL
Sbjct  305  ILQGKPVNIYQGPNQVDLARDFTYIDDIVKGCFGALDTATPSTGTGGKKRGPAQLRVYNL  364

Query  189  GNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLSS  368
            GNTSPV+V  LV+ILE  L +KAK+NVV+MPRNGDVPFTHANV+LA  + GY PTTDL +
Sbjct  365  GNTSPVTVPTLVAILEKHLKVKAKRNVVRMPRNGDVPFTHANVTLARVELGYNPTTDLQT  424

Query  369  GLRKFVKWYVSYY  407
            GL+KFVKWY  YY
Sbjct  425  GLKKFVKWYQLYY  437



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPAQLRV+
Sbjct  293  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAKKSTGSGGKKKGPAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A+K+ GYKPTTDL
Sbjct  353  NLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAHKELGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  413  QTGLKKFVRWYLSYYG  428



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  296  RDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVF  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  356  NLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTTDL  415

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY++YY
Sbjct  416  QTGLKKFVRWYMNYY  430



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  290  RDILKGKSIPIFEGADHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVF  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  350  NLGNTSPVPVSDLVSILEKLLKMKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPTTDL  409

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY++YY
Sbjct  410  QTGLKKFVRWYMNYY  424



>ref|XP_011010511.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
 ref|XP_011014870.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Populus euphratica]
Length=431

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++  ++ARDFT+IDD+VKGCVG+LDT+ KS GSGGKK+GPA  R++
Sbjct  288  RNILQGKPITVYRGKDRADLARDFTFIDDIVKGCVGSLDTSGKSPGSGGKKRGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVS+LE  L +KAK+N V MP NGDVPFTHAN+SLA+++ GYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVSLLERHLKVKAKRNFVDMPGNGDVPFTHANISLAHRELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
            ++GL+KFVKWY+SYYG
Sbjct  408  ATGLKKFVKWYLSYYG  423



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  289  RDILKGKAISIFQGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A ++FGYKP+TDL
Sbjct  349  NLGNTSPVPVTELVSILERLLKVKAKRNMMKLPRNGDVAFTHANISWAEREFGYKPSTDL  408

Query  363  SSGLRKFVKWYVSYYGIQS  419
             +GL+KFV+WY+ YY  Q+
Sbjct  409  QTGLKKFVRWYLGYYKQQA  427



>ref|XP_010426564.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
 ref|XP_010456322.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
Length=428

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+G AQLRV+
Sbjct  286  RDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGAAQLRVF  345

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  346  NLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPRNGDVPFTHANISSAQRELGYKPTTDL  405

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KF +WY+ YY
Sbjct  406  QTGLKKFARWYLGYY  420



>ref|XP_008223573.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Prunus mume]
Length=432

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA  R++
Sbjct  289  RNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPAPYRIF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKKN V MP NGDVPFTHAN+SLA ++FGYKPTTDL
Sbjct  349  NLGNTSPVTVPTLVSILERHLKMKAKKNFVDMPGNGDVPFTHANISLARREFGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  409  QTGLKKFVRWYLSYYG  424



>ref|XP_007222381.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
 gb|EMJ23580.1| hypothetical protein PRUPE_ppa006006mg [Prunus persica]
Length=432

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA  R++
Sbjct  289  RNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPAPYRIF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKKN V MP NGDVPFTHAN+SLA ++FGYKPTTDL
Sbjct  349  NLGNTSPVTVPTLVSILERHLKMKAKKNFVDMPGNGDVPFTHANISLARREFGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  409  QTGLKKFVRWYLSYYG  424



>ref|XP_001769370.1| predicted protein [Physcomitrella patens]
 gb|EDQ65739.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GKPIN+Y    DK++ARDFT+IDD+VKGCVGALDTA +STGSGGKKKGPA LR++
Sbjct  304  RDILKGKPINIYQGPHDKDLARDFTFIDDIVKGCVGALDTAGESTGSGGKKKGPAMLRLF  363

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV +LE  L +KA K  +KMPRNGDVPFTHANVSLA     YKPTT+L
Sbjct  364  NLGNTSPVTVPVLVELLEKHLKVKAVKQFIKMPRNGDVPFTHANVSLAQAQLAYKPTTNL  423

Query  363  SSGLRKFVKWYVSYYGIQSRVKTE  434
             +GL+KFV WY+ YY +QS   T 
Sbjct  424  DTGLKKFVTWYLKYYNVQSTKSTR  447



>gb|KJB09908.1| hypothetical protein B456_001G174300 [Gossypium raimondii]
Length=437

 Score =   183 bits (464),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  295  RDILKGKSISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVF  354

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL + AK+N++K+PRNGDV FTHAN+SLA ++ GYKP+TDL
Sbjct  355  NLGNTSPVPVSDLVSILERLLKVNAKRNIMKLPRNGDVQFTHANISLAQRELGYKPSTDL  414

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  415  QTGLKKFVRWYLSYY  429



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score =   182 bits (463),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  284  RDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVF  343

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+N +K+PRNGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  344  NLGNTSPVPVTDLVTILERLLKVKAKRNTMKLPRNGDVPFTHANISSAQRELGYKPTTDL  403

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KF +WY+ YY
Sbjct  404  QTGLKKFARWYLGYY  418



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score =   182 bits (463),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             +MLQGKPI VY  +   +++RDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+G A  R++
Sbjct  292  RNMLQGKPITVYRGKNRVDLSRDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGAAPYRIF  351

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE LL +KAKKN+V MP NGDVPFTHAN++ A ++FGYKPTTD+
Sbjct  352  NLGNTSPVTVPTLVSILERLLKVKAKKNIVDMPGNGDVPFTHANITSARREFGYKPTTDI  411

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  412  QTGLKKFVKWYLSYYG  427



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK+GPA  R++
Sbjct  290  RNILQGKPITIYRGKNRADLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKRGPAPYRIF  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LV+ILE  L +KAK+N+V MP NGDVPFTHAN+S A ++FGYKPTTDL
Sbjct  350  NLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNGDVPFTHANISSAQREFGYKPTTDL  409

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFV+WY+SYYG  +R
Sbjct  410  QTGLKKFVRWYLSYYGYNNR  429



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA  R++
Sbjct  283  RNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPAPYRIF  342

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  +V ILE  L +KAKKN V+MP NGDVPFTHAN+S A K+FGYKPTTDL
Sbjct  343  NLGNTSPVTVPMMVGILEKHLKVKAKKNFVEMPGNGDVPFTHANISSARKEFGYKPTTDL  402

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  403  QTGLKKFVKWYLSYYG  418



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGCVGALDTAEKSTGSGGKK+G AQLRV+
Sbjct  293  RDILKGKAISIFEGANHGTVARDFTYIDDIVKGCVGALDTAEKSTGSGGKKRGAAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE  L +KAK+N++K+PRNGDV FTHAN+SLA  + GYKPTTDL
Sbjct  353  NLGNTSPVPVSELVSILERHLKVKAKRNIMKLPRNGDVQFTHANISLAQGELGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYYGI  413
             +GL+KFVKWY+ YY +
Sbjct  413  HTGLKKFVKWYLGYYNV  429



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  303  RDILKGKAISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVF  362

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK++++K+PRNGDV FTHAN+S A ++ GYKPTTDL
Sbjct  363  NLGNTSPVPVSDLVSILERLLKVKAKRHIMKLPRNGDVQFTHANISWAQRELGYKPTTDL  422

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  423  QTGLKKFVRWYLSYY  437



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKG AQLRV+
Sbjct  293  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGAAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDVPFTHAN+S A+K+ GYKPTTDL
Sbjct  353  NLGNTSPVPVSDLVSILERLLKVKAKRLVMKLPRNGDVPFTHANISSAHKELGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY++YYG
Sbjct  413  QTGLKKFVRWYLNYYG  428



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+V+GC+ ALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  294  RDILKGKSISIFEAANHGTVARDFTYIDDIVRGCLAALDTAEKSTGSGGKKKGPAQLRVY  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++++PRNGDV +THAN+SLA ++ GYKPTTDL
Sbjct  354  NLGNTSPVPVSDLVSILERLLKLKAKRNILRLPRNGDVQYTHANISLAQRELGYKPTTDL  413

Query  363  SSGLRKFVKWYVSYY  407
             SGL+KFV+WY+ +Y
Sbjct  414  QSGLKKFVRWYLRFY  428



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLR++
Sbjct  296  RDLLKGKSIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLRIF  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDV FTHAN+S A  + GYKPTTDL
Sbjct  356  NLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVQFTHANISYAQMELGYKPTTDL  415

Query  363  SSGLRKFVKWYVSYY  407
             SGL+KFV+WY++YY
Sbjct  416  QSGLKKFVRWYLNYY  430



>ref|XP_009781950.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=436

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ ALDT EKSTGSGGKKKGPAQLRV+
Sbjct  294  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTGEKSTGSGGKKKGPAQLRVF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK++V+K+PRNGDV FTHAN+S A ++ GYKPTTDL
Sbjct  354  NLGNTSPVPVSDLVSILERLLKVKAKRSVMKLPRNGDVQFTHANISFAKRELGYKPTTDL  413

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  414  QTGLKKFVRWYLSYYG  429



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R++
Sbjct  288  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  408  QTGLKKFVKWYLSYYG  423



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLRV+
Sbjct  290  RDILKGKVIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLRVF  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV ILE LL IKAK+N++K+PRNGDV FTHAN+S A ++ GYKPTTDL
Sbjct  350  NLGNTSPVPVSDLVGILERLLKIKAKRNIMKLPRNGDVQFTHANISYAQRELGYKPTTDL  409

Query  363  SSGLRKFVKWYVSYY  407
             SGL+KFV+WY++YY
Sbjct  410  HSGLKKFVRWYLNYY  424



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA  R++
Sbjct  294  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYRIF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYKPTT+L
Sbjct  354  NLGNTSPVTVPSLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLARQQLGYKPTTNL  413

Query  363  SSGLRKFVKWYVSYYG  410
              GL+KFVKWY+SYYG
Sbjct  414  DVGLKKFVKWYLSYYG  429



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R++
Sbjct  288  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSAKSTGSGGKKRGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARRELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  408  QTGLKKFVKWYLSYYG  423



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  292  RDILKGKSIPIFEAASHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVF  351

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL  KAK+N++K+PRNGDV FTHAN+SLA ++ GYKP+TDL
Sbjct  352  NLGNTSPVPVTDLVSILERLLKAKAKRNIMKLPRNGDVQFTHANISLAQRELGYKPSTDL  411

Query  363  SSGLRKFVKWYVSYYGI  413
             +GL+KFV+WY+SYY +
Sbjct  412  QTGLKKFVRWYLSYYRV  428



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA  R++
Sbjct  294  RNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYRIF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYKPTT+L
Sbjct  354  NLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYKPTTNL  413

Query  363  SSGLRKFVKWYVSYYG  410
              GL+KFVKWY+SYYG
Sbjct  414  DVGLKKFVKWYLSYYG  429



>ref|XP_010540291.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Tarenaya hassleriana]
Length=393

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  251  RDILKGKAISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGAAQLRVF  310

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LVSILE  L +KAK+NV+K+PRNGDV FTHAN+S+A ++ GYKPTTDL
Sbjct  311  NLGNTSPVPVSELVSILERHLKVKAKRNVMKLPRNGDVQFTHANISMAQRELGYKPTTDL  370

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  371  QTGLKKFVRWYMGYY  385



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTGSGGKK+GPA  R++
Sbjct  288  RNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGSGGKKRGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L +KAKKN+V MP NGDVPFTHAN+SLA  +FGYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVGILERHLKMKAKKNIVDMPGNGDVPFTHANISLARMEFGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY++YYG
Sbjct  408  QTGLKKFVRWYLNYYG  423



>ref|XP_008238641.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Prunus mume]
Length=434

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GKPI ++   +   VARDFTYIDDVVKGCV ALDTA+KSTGSGGKKKGPAQLR++
Sbjct  291  KDILKGKPITIFEAPDRGSVARDFTYIDDVVKGCVAALDTAKKSTGSGGKKKGPAQLRIF  350

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LV+ILE LL +KAK+ V+ MPRNGDV FTHAN+SLA+K+  YKP TDL
Sbjct  351  NLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPRNGDVKFTHANISLAHKELKYKPGTDL  410

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  411  ETGLKKFVRWYLSYY  425



>dbj|BAJ85817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96148.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA +STG+GGKK+GPA  R++
Sbjct  295  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTAGRSTGTGGKKRGPAPYRIF  354

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKK+VV+MP NGDVPFTHAN+SLA +  GYKPTT+L
Sbjct  355  NLGNTSPVTVPTLVSILEKHLRVKAKKHVVEMPGNGDVPFTHANISLARQQLGYKPTTNL  414

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  415  DAGLKKFVKWYLSYYG  430



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +++L+GKPI +Y  +   ++ARDFTYIDDVVKGCV +LDTAEKSTGSGGKK+ PAQ R++
Sbjct  287  KNILKGKPITIYRGKNQVDLARDFTYIDDVVKGCVASLDTAEKSTGSGGKKRRPAQYRIF  346

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  +VSILE  L +KAKKNVV MP NGDVPFTHAN++ A ++  YKPTTDL
Sbjct  347  NLGNTSPVTVPMMVSILEKHLKVKAKKNVVDMPGNGDVPFTHANITAARRELAYKPTTDL  406

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  407  QTGLKKFVRWYLSYYG  422



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score =   182 bits (461),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 116/145 (80%), Gaps = 21/145 (14%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQGKPI+VY T +DKEVARDFTYIDDVVKGC+GALDTAEKSTGSGGKKKGPAQLR+Y
Sbjct  303  KDILQGKPIDVYKTVDDKEVARDFTYIDDVVKGCLGALDTAEKSTGSGGKKKGPAQLRIY  362

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILE LL  KAKK+V+KMPR                     PTTDL
Sbjct  363  NLGNTSPVPVGKLVSILEGLLGTKAKKHVIKMPR---------------------PTTDL  401

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL  437
            +SGLRKFVKWYVSYYGI++RVK E+
Sbjct  402  ASGLRKFVKWYVSYYGIETRVKREM  426



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA  R++
Sbjct  294  RNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYRIF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYKPTT+L
Sbjct  354  NLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLARQQLGYKPTTNL  413

Query  363  SSGLRKFVKWYVSYYG  410
              GL+KFVKWY+SYYG
Sbjct  414  DVGLKKFVKWYLSYYG  429



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R++
Sbjct  288  RNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVNILERHLKVKAKRNIVDMPGNGDVPFTHANISLAQRELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY++YYG
Sbjct  408  ETGLKKFVKWYLTYYG  423



>emb|CDP21367.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            + +LQGKPI +Y  +   ++ARDFTYIDDVVKGCV +LDTA+KSTGSGGKK+GPAQ R++
Sbjct  289  KGILQGKPITIYRGKNRVDLARDFTYIDDVVKGCVASLDTAKKSTGSGGKKRGPAQYRIF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  +V ILE  L +KAKKN V MP NGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  349  NLGNTSPVTVPMMVGILERHLKVKAKKNYVDMPGNGDVPFTHANISLARRELGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY++YYG
Sbjct  409  QTGLKKFVKWYLAYYG  424



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKK+G AQLRV+
Sbjct  290  RDILKGKAISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKRGQAQLRVF  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAKKN++K+PRNGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  350  NLGNTSPVPVTDLVSILERLLKVKAKKNMMKLPRNGDVPFTHANISSAQRELGYKPTTDL  409

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KF +WY+ YY
Sbjct  410  QTGLKKFARWYLGYY  424



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L  K I ++ + +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK+G AQLRV+
Sbjct  297  RDILNRKSIPIFESPDHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGRAQLRVF  356

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+N++K+PRNGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  357  NLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVPFTHANISLAQRELGYKPTTDL  416

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYY 
Sbjct  417  QTGLKKFVRWYLSYYA  432



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA  R++
Sbjct  283  RNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPAPYRIF  342

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  +V ILE  L +KAKKN V+MP NGDVPFTHAN+S A K+FGYKPTTDL
Sbjct  343  NLGNTSPVTVPMMVGILEKHLKVKAKKNFVEMPGNGDVPFTHANISSARKEFGYKPTTDL  402

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  403  QTGLKKFVRWYLSYYG  418



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA  R++
Sbjct  288  RNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+S A  + GYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISSARAELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  408  QTGLKKFVKWYLSYYG  423



>ref|XP_003570280.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brachypodium distachyon]
Length=441

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA +STG+GGKK+GPA  R++
Sbjct  298  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTAGRSTGTGGKKRGPAPYRIF  357

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKK+V++MP NGDVPFTHAN+SLA +  GYKPTT+L
Sbjct  358  NLGNTSPVTVPTLVSILEKHLRVKAKKHVIEMPGNGDVPFTHANISLARQQLGYKPTTNL  417

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  418  DAGLKKFVKWYLSYYG  433



>ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cicer arietinum]
Length=432

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+G A  R++
Sbjct  291  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGSAPYRIF  350

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  351  NLGNTSPVTVPTLVSILERHLKVKAKRNIVDMPGNGDVPFTHANISLARRELGYKPTTDL  410

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  411  QTGLKKFVKWYLSYYG  426



>ref|XP_010419541.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Camelina sativa]
Length=428

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GKPI+++       VARDFTYIDD+VKGC+GALDTAEKSTG+GGKK+G AQLRV+
Sbjct  286  RDILKGKPISIFEGVNHGTVARDFTYIDDIVKGCLGALDTAEKSTGTGGKKRGAAQLRVF  345

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDVPFTHAN+S A ++ GYKPT DL
Sbjct  346  NLGNTSPVPVTDLVTILERLLKLKAKRNIMKLPRNGDVPFTHANISSAQRELGYKPTIDL  405

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KF +WY+ YY
Sbjct  406  QTGLKKFARWYLGYY  420



>ref|XP_001777338.1| predicted protein [Physcomitrella patens]
 gb|EDQ57868.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK IN+Y     K++ARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK GPAQLRV+
Sbjct  299  QDILRGKAINIYTGSGGKDLARDFTYIDDIVKGCMRALDTAEKSTGSGGKKTGPAQLRVF  358

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L  KA +N+VKMPRNGDVPFTHAN S A     Y PTT+L
Sbjct  359  NLGNTSPVTVPILVDILEKHLKQKAIRNIVKMPRNGDVPFTHANTSSAQSQLNYHPTTNL  418

Query  363  SSGLRKFVKWYVSYYGI  413
             +GLRKFVKWY+SYYG+
Sbjct  419  DTGLRKFVKWYLSYYGV  435



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 107/136 (79%), Gaps = 10/136 (7%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDT+            PA  R++
Sbjct  288  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCLGSLDTSAG----------PAPYRIF  337

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V KLV+ILE  L +KAKKNV++MP NGDVPFTHAN+S A K+FGY+PTTDL
Sbjct  338  NLGNTSPVTVPKLVNILERHLKVKAKKNVIEMPGNGDVPFTHANISSAQKEFGYRPTTDL  397

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  398  QTGLKKFVRWYLSYYG  413



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGCVG+LDT+ KSTGSGGKK+GPA  R++
Sbjct  288  RNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCVGSLDTSGKSTGSGGKKRGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++ GYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVNILERHLRVKAKRNIVDMPGNGDVPFTHANISLAQRELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY++YYG
Sbjct  408  ETGLKKFVKWYLTYYG  423



>gb|KDP38751.1| hypothetical protein JCGZ_04104 [Jatropha curcas]
Length=431

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA  R++
Sbjct  288  RNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L  KAK+++V MP NGDVPFTHAN++LA ++FGYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVSILEKHLKTKAKRHIVDMPGNGDVPFTHANITLARREFGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+ YYG
Sbjct  408  QTGLKKFVKWYLWYYG  423



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKG AQLRV+
Sbjct  293  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGAAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV ILE LL +KAK+ V+K+PRNGDVPFTHAN+S A+K+ GYKPTTDL
Sbjct  353  NLGNTSPVPVSDLVGILERLLKVKAKRLVMKLPRNGDVPFTHANISSAHKELGYKPTTDL  412

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY++YYG
Sbjct  413  QTGLKKFVRWYLNYYG  428



>gb|KJB76605.1| hypothetical protein B456_012G096800 [Gossypium raimondii]
Length=431

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKKKG A  R++
Sbjct  288  RNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKKGNAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++FGYKPTTDL
Sbjct  348  NLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNGDVPFTHANISLAQREFGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFV+WY+SYYG  +R
Sbjct  408  QTGLKKFVRWYLSYYGYNNR  427



>ref|XP_008234372.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Prunus mume]
Length=409

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            ++ML+GKPI V+   +   VARDFTYIDDVVKGC+ ALDTAEKSTGSGG+ +GPAQLRV+
Sbjct  268  KNMLRGKPIVVFEGPDHGSVARDFTYIDDVVKGCLAALDTAEKSTGSGGRVEGPAQLRVF  327

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V ++VSI+E LL +KAKK VV MPRNGDV FTHAN+SLA ++ GY PTTDL
Sbjct  328  NLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPRNGDVLFTHANISLARRELGYMPTTDL  387

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GLRKF+ WY+ YY    R
Sbjct  388  KTGLRKFLNWYLDYYSESKR  407



>ref|XP_001759693.1| predicted protein [Physcomitrella patens]
 gb|EDQ75605.1| predicted protein [Physcomitrella patens]
Length=441

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+G PI+VY     K++ARDFT+IDD+VKGCV +LDTAEKSTGSGGKK GPA LRV+
Sbjct  290  RDILKGNPISVYSGAGGKDLARDFTFIDDIVKGCVASLDTAEKSTGSGGKKTGPAMLRVF  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L+ KAK+ ++KMPRNGDVPFTHAN+S A    GY+PTT+L
Sbjct  350  NLGNTSPVTVPTLVDILEKHLNTKAKRQIIKMPRNGDVPFTHANISSAQAQLGYRPTTNL  409

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  410  DTGLKKFVKWYLSYYG  425



>gb|EYU34305.1| hypothetical protein MIMGU_mgv1a006903mg [Erythranthe guttata]
Length=427

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +++LQGKPI +Y  +   E+ARDFTYIDD+VKGCV +LDTA++STGSGGKK+GPAQ R++
Sbjct  289  KNILQGKPITIYRGKNRVELARDFTYIDDIVKGCVASLDTAKRSTGSGGKKRGPAQFRIF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  +V ILE  L  KA KNVV+MP NGDVPFTHAN+S A  + GYKPTTDL
Sbjct  349  NLGNTSPVTVPMMVGILEKQLKTKAHKNVVEMPGNGDVPFTHANISSARIELGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  409  QTGLKKFVRWYLSYYG  424



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQ RVY
Sbjct  291  RDILKGKTISIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQFRVY  350

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL + AK+NV+K+P+NGDV FTHAN+SLA ++ GYKP+TDL
Sbjct  351  NLGNTSPVPVSDLVSILERLLKVDAKRNVMKLPQNGDVRFTHANISLAQRELGYKPSTDL  410

Query  363  SSGLRKFVKWYVSYY  407
             +G++KFV+WY+SYY
Sbjct  411  QTGMKKFVRWYLSYY  425



>ref|XP_007221187.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
 gb|EMJ22386.1| hypothetical protein PRUPE_ppa021672mg [Prunus persica]
Length=410

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            ++ML GKPI V+   +   VARDFTYIDDVVKGC+ ALDTAEKSTGSGG+ +GPAQLRV+
Sbjct  268  KNMLSGKPIVVFEGPDHGSVARDFTYIDDVVKGCLAALDTAEKSTGSGGRVEGPAQLRVF  327

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V ++VSI+E LL +KAKK VV MPRNGDV FTHAN+SLA ++ GY PTTDL
Sbjct  328  NLGNTSPVPVSEVVSIMERLLRVKAKKVVVPMPRNGDVLFTHANISLARRELGYMPTTDL  387

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GLRKF+ WY+ YY    R
Sbjct  388  KTGLRKFLNWYLDYYSESKR  407



>ref|XP_010662214.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Vitis vinifera]
Length=341

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L GKPI ++   +   VARDFTYIDD+VKGC+ +LDTA+KSTG+GGKKKG AQ R++
Sbjct  198  RDILTGKPITIFEGPDHGSVARDFTYIDDIVKGCLASLDTAKKSTGTGGKKKGAAQFRIF  257

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLVSILE LL +KAK+ V+ MPRNGDV +THAN+SLA ++ GYKPTTDL
Sbjct  258  NLGNTSPVDVSKLVSILEKLLKVKAKRRVLPMPRNGDVQYTHANISLAQRELGYKPTTDL  317

Query  363  SSGLRKFVKWYVSY  404
             SGL+KFV+WY++Y
Sbjct  318  ESGLKKFVRWYITY  331



>ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
 ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=432

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  290  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVY  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL  KAK+ V+K+PRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  350  NLGNTSPVPVSDLVSILERLLKTKAKRLVMKLPRNGDVQFTHANISLAQRELGYKPTTDL  409

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY++YY
Sbjct  410  QTGLKKFVRWYLNYY  424



>ref|XP_006343570.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=425

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA  R++
Sbjct  284  RNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPAPYRIF  343

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  +V++LE  L +KAKKN V MP NGDVPFTHAN+S A K+FGYKPTTDL
Sbjct  344  NLGNTSPVTVPMMVAMLEKHLKVKAKKNFVVMPGNGDVPFTHANISSARKEFGYKPTTDL  403

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  404  QTGLKKFVKWYLSYYG  419



>ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
 gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
Length=439

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGK I +Y  +   E+ARDFTY+DDVV+GCV ALDTA+ STGSGG+K+G AQ R+Y
Sbjct  295  RNILQGKAITIYRARGGAELARDFTYVDDVVRGCVAALDTAQPSTGSGGRKRGSAQYRIY  354

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNT+P+SV +LVSILE  L +KA +NVV+MP NGDVPFTHANV++A  + GYKPTTDL
Sbjct  355  NLGNTTPLSVPQLVSILERHLRVKATRNVVEMPGNGDVPFTHANVTMARLELGYKPTTDL  414

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL  437
             +GL+KFVKWY++YYG +   K ++
Sbjct  415  QAGLKKFVKWYLNYYGYEHNGKGKI  439



>ref|XP_010323223.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Solanum lycopersicum]
Length=425

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDDVVKGC+G+LDT+ KSTGSGGKK+GPA  R++
Sbjct  284  RNILQGKPITVYRGKNRVDLARDFTYIDDVVKGCIGSLDTSGKSTGSGGKKRGPAPYRIF  343

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  +V++LE  L +KAKKN V MP NGDVPFTHAN+S A K+FGYKPTTDL
Sbjct  344  NLGNTSPVTVPMMVAMLEKHLKVKAKKNFVVMPGNGDVPFTHANISSARKEFGYKPTTDL  403

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  404  QTGLKKFVKWYLSYYG  419



>ref|XP_004171294.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I V+   + K VARDFTYIDD+VKGC+GALDTAEKSTGSGG+KKG AQLRV+
Sbjct  265  KDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKAQLRVF  324

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNGDVPFTHAN+SLA K+ GYKPTTDL
Sbjct  325  NLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYKPTTDL  384

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL++FV WY  YY   S+
Sbjct  385  KTGLKEFVDWYRLYYSNSSK  404



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLRV+
Sbjct  290  RDILKGKTIPIFEAANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLRVF  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYKPTTDL
Sbjct  350  NLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTTDL  409

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  410  QTGLKKFVRWYLSYY  424



>gb|KEH31675.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=436

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I V+ + +   VARDFTYIDDVVKGC+GALDTA+KSTGSGGKKKG AQ RV+
Sbjct  290  KDILKGKQITVFESPDGGSVARDFTYIDDVVKGCLGALDTAKKSTGSGGKKKGSAQFRVF  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V KLV+ILE LL + AKK V+ MPRNGDV FTHAN+SLA ++FGYKPT DL
Sbjct  350  NLGNTSPVPVSKLVAILEKLLKVNAKKRVLPMPRNGDVKFTHANISLAQREFGYKPTIDL  409

Query  363  SSGLRKFVKWYVSYY  407
             +GLRKFVKWY+ +Y
Sbjct  410  ETGLRKFVKWYLEFY  424



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI V+  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKK GPA  R++
Sbjct  288  RNILQGKPITVFRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKTGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVSILERHLKVKAKKNVVEMPGNGDVPFTHANISSARRELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  408  QTGLKKFVRWYLSYYG  423



>gb|EYU37123.1| hypothetical protein MIMGU_mgv1a006776mg [Erythranthe guttata]
Length=432

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   E+ARDFTYIDD+VKGCV +LDT++KSTGSGGKK+GPAQ R++
Sbjct  289  RNILQGKPITIYRGKNRVELARDFTYIDDIVKGCVASLDTSKKSTGSGGKKRGPAQFRIF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  +VS+LE  L +KAKK+ ++MP NGDVPFTHAN+S A  + GYKPTTDL
Sbjct  349  NLGNTSPVTVPMMVSLLEKHLKVKAKKHFLEMPGNGDVPFTHANISSAQIELGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYG  410
             +GLRKFV+WY+SYYG
Sbjct  409  QTGLRKFVRWYLSYYG  424



>ref|XP_004148129.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cucumis sativus]
Length=408

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I V+   + K VARDFTYIDD+VKGC+GALDTAEKSTGSGG+KKG AQLRV+
Sbjct  265  KDILKGKKIRVFEGADQKSVARDFTYIDDIVKGCLGALDTAEKSTGSGGRKKGKAQLRVF  324

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V +LV  LE LL++KAK+ V+ MPRNGDVPFTHAN+SLA K+ GYKPTTDL
Sbjct  325  NLGNTSPVTVSELVDNLEKLLNLKAKRMVLPMPRNGDVPFTHANISLAQKELGYKPTTDL  384

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL++FV WY  YY   S+
Sbjct  385  KTGLKEFVDWYRLYYSNSSK  404



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCV +LDTA+KSTGSGG+K+GPAQ R++
Sbjct  288  RNILQGKPITVYRGKNHVDLARDFTYIDDIVKGCVASLDTAQKSTGSGGRKRGPAQYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L +KAK++VV+MP NGDVPFTHAN+S A  + GY PTT+L
Sbjct  348  NLGNTSPVTVPALVGILERHLKVKAKRHVVEMPGNGDVPFTHANISSARTELGYNPTTNL  407

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFVKWY+SYYG   R
Sbjct  408  EAGLKKFVKWYLSYYGYNPR  427



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  295  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVY  354

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL + AK++++K+PRNGDV FTHAN+SLA ++ GYKP+TDL
Sbjct  355  NLGNTSPVPVSDLVSILERLLKVNAKRDIMKLPRNGDVQFTHANISLAQRELGYKPSTDL  414

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  415  QTGLKKFVRWYLGYY  429



>gb|ACJ11754.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=431

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKKKG A  R++
Sbjct  288  RNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKKGNAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LV+ILE  L +KAK+N+V MP NGDVPFTHAN+SLA ++FGYKP+TDL
Sbjct  348  NLGNTSPVKVPELVNILERHLKVKAKRNIVDMPGNGDVPFTHANISLAQREFGYKPSTDL  407

Query  363  SSGLRKFVKWYVSYYGIQSR  422
             +GL+KFV+WY+SYYG  +R
Sbjct  408  QTGLKKFVRWYLSYYGYNNR  427



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+ K I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  291  RDILKEKSIPIFEAPNHGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLRVF  350

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  351  NLGNTSPVPVTDLVNILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYKPTTDL  410

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFVKWY++YY
Sbjct  411  QTGLKKFVKWYLNYY  425



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA  R++
Sbjct  294  RNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYRIF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKK+VV+MP NGDVPFTHAN+SLA +  GYKP+T+L
Sbjct  354  NLGNTSPVTVPNLVSILEKHLRVKAKKHVVEMPGNGDVPFTHANISLAREQLGYKPSTNL  413

Query  363  SSGLRKFVKWYVSYYG  410
              GL+KFVKWY+SYYG
Sbjct  414  DVGLKKFVKWYLSYYG  429



>ref|XP_010676680.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +DML+GK I V+       VARDFTYIDD+VKGC+GALDTA+KSTG+GGKKKGPAQ R++
Sbjct  306  KDMLKGKEITVFEGPNHSTVARDFTYIDDIVKGCLGALDTAKKSTGTGGKKKGPAQFRIF  365

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV +LVSILE LL +K+ K V+ +PRNGDV FTHAN++LA ++  YKPTTDL
Sbjct  366  NLGNTSPVSVNQLVSILEKLLKVKSNKKVLPLPRNGDVQFTHANITLAQRELRYKPTTDL  425

Query  363  SSGLRKFVKWYVSYYGIQSRVKTEL  437
             +GL+KFV+WY+SYY    R  T +
Sbjct  426  QTGLKKFVRWYLSYYSGTKRKTTSV  450



>ref|XP_007209167.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
 gb|EMJ10366.1| hypothetical protein PRUPE_ppa006148mg [Prunus persica]
Length=425

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I ++   +   VARDFTYIDDVVKGCV ALDTA+KSTGSGGKKKGPAQLR++
Sbjct  282  KDILKGKTITIFEASDHGSVARDFTYIDDVVKGCVAALDTAKKSTGSGGKKKGPAQLRIF  341

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V +LV+ILE LL +KAK+ V+ MPRNGDV FTHAN+SLA+K+  YKP TDL
Sbjct  342  NLGNTSPVPVSELVNILEKLLKVKAKRKVLPMPRNGDVKFTHANISLAHKELRYKPGTDL  401

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  402  ETGLKKFVRWYLSYY  416



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLRV+
Sbjct  296  RDILKGKTIPIFEGANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLRVF  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYKPTTDL
Sbjct  356  NLGNTSPVPVMDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTTDL  415

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  416  QTGLKKFVRWYLSYY  430



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+ K I ++       VARDFTYIDD+VKGCV ALDTAEKSTGSGGKKKGPAQLR++
Sbjct  285  RDILKEKSIPIFEAPNRGTVARDFTYIDDIVKGCVAALDTAEKSTGSGGKKKGPAQLRIF  344

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ ++KMPRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  345  NLGNTSPVPVTDLVSILERLLKVKAKRKMIKMPRNGDVQFTHANISLAQRELGYKPTTDL  404

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  405  QTGLKKFVRWYLKYY  419



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLRV+
Sbjct  296  RDILKGKTIPIFEGANHGTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLRVF  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+N++K+PRNGDV FTHAN+S A ++ GYKPTTDL
Sbjct  356  NLGNTSPVPVTDLVTILERLLKVKAKRNIMKLPRNGDVQFTHANISSAQRELGYKPTTDL  415

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  416  QTGLKKFVRWYLSYY  430



>ref|XP_002437985.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
 gb|EER89352.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
Length=440

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++   +ARDFTYIDD+V+GC+ +LDTA +STG+GGKK+GPAQ R++
Sbjct  294  RNILQGKPITVYRGRDHVALARDFTYIDDIVRGCLASLDTAGRSTGTGGKKRGPAQYRIF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV+ILE  L +KAKKNVV+MP NGDVP+THAN+SLA ++ GYKPTT L
Sbjct  354  NLGNTSPVTVPTLVAILERYLRVKAKKNVVEMPGNGDVPYTHANISLAREELGYKPTTSL  413

Query  363  SSGLRKFVKWYVSYYGIQSRVKT  431
              GL+KFV+WY+SYYG      T
Sbjct  414  EMGLKKFVRWYLSYYGYNRGTHT  436



>ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera]
Length=431

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTGS GKK GPA  R++
Sbjct  286  RNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGSRGKKHGPAPYRIF  345

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L +KAKKN++ MP NGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  346  NLGNTSPVTVPALVGILERNLKMKAKKNIIDMPGNGDVPFTHANISSARRELGYKPTTDL  405

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  406  QTGLKKFVRWYLSYYG  421



>ref|XP_001751991.1| predicted protein [Physcomitrella patens]
 gb|EDQ83426.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GKPI++Y     K++ARDFTYIDD+VKGCV +LDTAEKSTGSGGKK GPA LRV+
Sbjct  295  RDILKGKPISIYSGAGGKDLARDFTYIDDIVKGCVASLDTAEKSTGSGGKKSGPAMLRVF  354

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L +KAK+  +KMPRNGDVPFTHAN+S A     YKP T+L
Sbjct  355  NLGNTSPVTVPTLVDILEKYLKVKAKRETIKMPRNGDVPFTHANISSAELQLHYKPVTNL  414

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
             +GL+KFVKWY+SYYG  S  K
Sbjct  415  DTGLKKFVKWYLSYYGDSSNRK  436



>ref|NP_001142515.1| hypothetical protein [Zea mays]
 gb|ACG24575.1| hypothetical protein [Zea mays]
 gb|ACN27084.1| unknown [Zea mays]
 gb|AFW73831.1| hypothetical protein ZEAMMB73_770166 [Zea mays]
Length=439

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++  ++ARDFTYIDD+VKGC+G+LDTA KSTG+GGKK+GPA  R++
Sbjct  294  RNILQGKPITVYRGKDRVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYRIF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNT+PV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN++LA +  GYKPTT+L
Sbjct  354  NLGNTAPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANITLARQQLGYKPTTNL  413

Query  363  SSGLRKFVKWYVSYYG  410
              GL+KFVKWY SYYG
Sbjct  414  DVGLKKFVKWYQSYYG  429



>ref|XP_006350062.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Solanum tuberosum]
Length=431

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK+GPA  R++
Sbjct  288  RNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKRGPAMFRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  +V++LE  L +KAKK+V+ MP NGDVPFTHAN+SLA K+ GYKPTT+L
Sbjct  348  NLGNTSPVTVPMMVAMLEKHLKVKAKKHVLDMPGNGDVPFTHANISLAQKELGYKPTTNL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL KFV+WY+SYYG
Sbjct  408  QTGLGKFVRWYLSYYG  423



>ref|XP_002266529.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like [Vitis vinifera]
Length=408

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+LQG  I ++   +   VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKK  PAQLRVY
Sbjct  268  KDILQGNSIRIFEGGKGGVVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKMRPAQLRVY  327

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KA++    MPRNGDV +THAN+SLA K+ GYKPTTDL
Sbjct  328  NLGNTSPVEVGSLVSILERLLKVKARRVATPMPRNGDVMYTHANISLAEKELGYKPTTDL  387

Query  363  SSGLRKFVKWYVSYY  407
             SGL KFVKWY++YY
Sbjct  388  RSGLEKFVKWYLTYY  402



>ref|XP_008443815.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis melo]
Length=432

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  + + ++ARDFTYIDD+VKGC+G+LDT+ KSTGSGGKKKGPA  R++
Sbjct  289  RNILQGKPITVYRGKNEVDLARDFTYIDDIVKGCLGSLDTSGKSTGSGGKKKGPAPYRIF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L   AKKN+V MP NGDVPFTHAN+S A  +FGYKPTTDL
Sbjct  349  NLGNTSPVTVPALVSILEEHLKTPAKKNIVDMPGNGDVPFTHANISSARIEFGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYGIQ  416
             +GL+KFV+WY+SYYG +
Sbjct  409  QTGLKKFVRWYLSYYGYE  426



>ref|XP_006845469.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
 gb|ERN07144.1| hypothetical protein AMTR_s00019p00132110 [Amborella trichopoda]
Length=432

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGK I VY  ++  ++ARDFTYIDD+VKGCV +LDT+ KSTGSGGKKKGPA  R++
Sbjct  288  RNILQGKRITVYRGKDHTDLARDFTYIDDIVKGCVASLDTSGKSTGSGGKKKGPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L +KAK+NVV+MP NGDVPFTHAN+SLA K+ GYKPTTDL
Sbjct  348  NLGNTSPVTVPDLVGILEKHLKVKAKRNVVEMPGNGDVPFTHANISLAQKELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY SYYG
Sbjct  408  QTGLKKFVKWYQSYYG  423



>ref|XP_001754001.1| predicted protein [Physcomitrella patens]
 gb|EDQ81323.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +3

Query  6    DMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVYN  185
            D+L+GKPI+VY     K++ARDFT+IDD+VKGCV +LDTAEKSTGSGGKK GPA LRV+N
Sbjct  296  DILKGKPISVYSGPGGKDLARDFTFIDDIVKGCVASLDTAEKSTGSGGKKTGPAMLRVFN  355

Query  186  LGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDLS  365
            LGNTSPV+V  LV ILE  L++KAK+ ++ MPRNGDVPFTHAN+S A +   Y+P T+L 
Sbjct  356  LGNTSPVTVPALVDILEKYLNVKAKREIINMPRNGDVPFTHANISSAQEQLHYRPVTNLD  415

Query  366  SGLRKFVKWYVSYYGIQSRVKTELHPTHQ  452
            +GL+KFVKWY+SYYG  S  K  L    Q
Sbjct  416  TGLKKFVKWYLSYYGDNSNRKLWLGKHEQ  444



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I+++       VARDFTYIDD+VKGC+GALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  293  RDILKGKSISIFEGANHGTVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAQLRVF  352

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+ ++K+PRNGDV FTHAN+S A ++ GYKPTT L
Sbjct  353  NLGNTSPVPVSDLVTILERLLKVKAKRALMKLPRNGDVQFTHANISFAQRELGYKPTTYL  412

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  413  QTGLKKFVRWYLSYY  427



>ref|XP_010103125.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
 gb|EXB94890.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
Length=432

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  +   ++ARDFTYIDD+VKGC+G+LDTA KSTGSGGKKK PA  R++
Sbjct  288  RNILQGKPITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGSGGKKKRPAPYRIF  347

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L +KAK+NVV MP NGDVPFTHAN++ A ++ GYKPTTDL
Sbjct  348  NLGNTSPVTVPTLVDILERHLKVKAKRNVVDMPGNGDVPFTHANITSARRELGYKPTTDL  407

Query  363  SSGLRKFVKWYVSYYGIQSRVK  428
             +GL+KFV+WY+SYYG     K
Sbjct  408  QTGLKKFVRWYLSYYGYNRGTK  429



>ref|XP_011079342.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGCV +LDTA+KSTGSGGKK+ PAQ R++
Sbjct  289  RNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCVASLDTAKKSTGSGGKKRRPAQYRIF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  +V ILE  L +KA+K +V+MP NGDVPFTHAN+S A ++ GYKPTTDL
Sbjct  349  NLGNTSPVTVPMMVGILEKQLKVKARKKMVEMPGNGDVPFTHANISSARRELGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFV+WY+SYYG
Sbjct  409  QTGLKKFVRWYLSYYG  424



>ref|XP_010047879.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Eucalyptus grandis]
 gb|KCW79891.1| hypothetical protein EUGRSUZ_C01241 [Eucalyptus grandis]
Length=432

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGCVG+LDTA KSTGSGGKK GPA  R++
Sbjct  289  RNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCVGSLDTAGKSTGSGGKKAGPAPYRIF  348

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAK+ VV MP NGDVPFTHAN+S A    GYKPTTDL
Sbjct  349  NLGNTSPVTVPTLVSILERHLKVKAKRKVVDMPGNGDVPFTHANISSAQGQLGYKPTTDL  408

Query  363  SSGLRKFVKWYVSYYG  410
             +GL+KFVKWY+SYYG
Sbjct  409  QTGLKKFVKWYLSYYG  424



>ref|XP_011093361.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=434

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+VKGC+ ALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  292  RDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKKGPAQLRVY  351

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL +KAK+ V+K+PRNGDV FTHAN+S A ++ GYKPTTDL
Sbjct  352  NLGNTSPVPVSDLVSILEKLLKVKAKRLVMKLPRNGDVQFTHANISSAQRELGYKPTTDL  411

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+ YY
Sbjct  412  KTGLKKFVEWYLGYY  426



>ref|XP_001761984.1| predicted protein [Physcomitrella patens]
 gb|EDQ73088.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK IN+Y  Q D+++ARDFT+IDD+VKGCV +LDTA +STGSGGKK+G A  R +
Sbjct  302  RDILKGKEINIYKGQNDRDLARDFTFIDDIVKGCVASLDTAGRSTGSGGKKRGAALFRTF  361

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPVSV  LV ILE  L + AKK  +KMPRNGDVPFTHANVSLA    GYKPTT+L
Sbjct  362  NLGNTSPVSVPVLVEILEKYLKVPAKKVFIKMPRNGDVPFTHANVSLAQTQLGYKPTTNL  421

Query  363  SSGLRKFVKWYVSYYGIQS  419
             +GL+KFV WY+ YYG+QS
Sbjct  422  DTGLKKFVTWYMKYYGVQS  440



>ref|XP_008677814.1| PREDICTED: LOC732831 isoform X1 [Zea mays]
 gb|ACF78800.1| unknown [Zea mays]
 gb|ACN28799.1| unknown [Zea mays]
 gb|ACR36221.1| unknown [Zea mays]
 gb|AFW64179.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++  ++ARDFTYIDD+VKGC+ +L+TA KSTG+GGKK+GPA  R++
Sbjct  294  RNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLASLETAGKSTGTGGKKRGPAPYRIF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYKPTT+L
Sbjct  354  NLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYKPTTNL  413

Query  363  SSGLRKFVKWYVSYYG  410
              GL+KFVKWY+SYYG
Sbjct  414  DVGLKKFVKWYLSYYG  429



>ref|NP_001105911.1| LOC732831 [Zea mays]
 gb|ABB51650.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI VY  ++  ++ARDFTYIDD+VKGC+ +L+TA KSTG+GGKK+GPA  R++
Sbjct  294  RNILQGKPITVYRGKDHVDLARDFTYIDDIVKGCLASLETAGKSTGTGGKKRGPAPYRIF  353

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LVSILE  L +KAKKNVV+MP NGDVPFTHAN+SLA +  GYKPTT+L
Sbjct  354  NLGNTSPVTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYKPTTNL  413

Query  363  SSGLRKFVKWYVSYYG  410
              GL+KFVKWY+SYYG
Sbjct  414  DVGLKKFVKWYLSYYG  429



>gb|EPS72617.1| hypothetical protein M569_02133, partial [Genlisea aurea]
Length=435

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GKPI ++       VARDFT+IDD+VKGCV ALDTAEKSTGSGGKKKGPAQLRVY
Sbjct  290  RDILKGKPIPIFEASNHGTVARDFTFIDDIVKGCVSALDTAEKSTGSGGKKKGPAQLRVY  349

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL  KA + V+K+PRNGDV FTHAN+SLA ++  YKPTTDL
Sbjct  350  NLGNTSPVPVSDLVTILEKLLKKKANRMVMKLPRNGDVQFTHANISLAQRELDYKPTTDL  409

Query  363  SSGLRKFVKWYVSYYGIQS  419
             +GL+KFV+WY+ YY + +
Sbjct  410  QTGLKKFVRWYLDYYAVDA  428



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKKKGPAQLRV+
Sbjct  298  RDILKGKTIPIFEAPNHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKKGPAQLRVF  357

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE LL  KAK+NV+K+PRNGDV FTHAN+S A  + GYKP TDL
Sbjct  358  NLGNTSPVPVSDLVSILERLLKTKAKRNVMKLPRNGDVQFTHANISYAQTELGYKPVTDL  417

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY++YY
Sbjct  418  QTGLKKFVRWYLNYY  432



>gb|KFK29619.1| hypothetical protein AALP_AA7G157500 [Arabis alpina]
Length=430

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             ++LQGKPI +Y  +   ++ARDFTYIDD+VKGC+G+LD++ KSTGSGGKK+G A  R++
Sbjct  285  RNILQGKPITIYRGKNRVDLARDFTYIDDIVKGCLGSLDSSGKSTGSGGKKRGSAPYRIF  344

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV+V  LV ILE  L +KAK+N V+MP NGDVPFTHAN+S A  +FGYKPTTDL
Sbjct  345  NLGNTSPVTVPILVDILEKHLKVKAKRNFVEMPGNGDVPFTHANISFARNEFGYKPTTDL  404

Query  363  SSGLRKFVKWYVSYYGIQSRVKTELH  440
             +GL+KFV+WY+SYYG  ++ K  +H
Sbjct  405  ETGLKKFVRWYLSYYGYNTKAKLNVH  430



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
            +D+L+GK I ++       VARDFTYIDD+VKGC+GALDTA+KSTGSGGKKKGPAQLRV+
Sbjct  307  KDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAQKSTGSGGKKKGPAQLRVF  366

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LVSILE+LL +KAK+ V+K+PRNGDV +THAN+S A ++ GYKPTTDL
Sbjct  367  NLGNTSPVPVSDLVSILESLLKVKAKRTVMKLPRNGDVQYTHANISYAKRELGYKPTTDL  426

Query  363  SSGLRKFVKWYVSYY  407
              GL+KFV+WY++YY
Sbjct  427  QGGLKKFVRWYLNYY  441



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK   ++     + VARDFTYIDD+VKGC+ +LDTAEKSTGSGGKKKGPAQLRV+
Sbjct  296  RDILKGKTXPIFEGANHRTVARDFTYIDDIVKGCLASLDTAEKSTGSGGKKKGPAQLRVF  355

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV+ILE LL +KAK+ + K+PRNGDV FTHAN+SLA ++ GYKPTTDL
Sbjct  356  NLGNTSPVPVTDLVTILERLLKVKAKRKITKLPRNGDVQFTHANISLAQRELGYKPTTDL  415

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY+SYY
Sbjct  416  QTGLKKFVRWYLSYY  430



>ref|XP_009370520.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Pyrus 
x bretschneideri]
Length=370

 Score =   176 bits (446),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             DML+GKPI V+     + VARDFTYIDDVVKG + A+DTAEKSTGSGGK + PAQLRV+
Sbjct  227  RDMLRGKPIVVFEGPGHRSVARDFTYIDDVVKGLLAAVDTAEKSTGSGGKVERPAQLRVF  286

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V ++V ILE LL +KAKK VV MPRNGDV FTHANVSLA ++ GY PTTDL
Sbjct  287  NLGNTSPVPVNEVVGILERLLGVKAKKVVVPMPRNGDVLFTHANVSLARRELGYVPTTDL  346

Query  363  SSGLRKFVKWYVSYY  407
             +GLRKFV WY+ YY
Sbjct  347  KTGLRKFVDWYLDYY  361



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = +3

Query  3    EDMLQGKPINVYVTQEDKEVARDFTYIDDVVKGCVGALDTAEkstgsggkkkgPAQLRVY  182
             D+L+GK I ++       VARDFTYIDD+V+GC+GALDTAEKSTGSGGKK+GPAQLRV+
Sbjct  298  RDILKGKTIPIFEAANHGTVARDFTYIDDIVRGCLGALDTAEKSTGSGGKKRGPAQLRVF  357

Query  183  NLGNTSPVSVRKLVSILENLLSIKAKKNVVKMPRNGDVPFTHANVSLAYKDFGYKPTTDL  362
            NLGNTSPV V  LV ILE LL  KAK+N++K+PRNGDV FTHAN+S A ++ GYKP TDL
Sbjct  358  NLGNTSPVPVSDLVGILERLLKTKAKRNIMKLPRNGDVQFTHANISYAQRELGYKPVTDL  417

Query  363  SSGLRKFVKWYVSYY  407
             +GL+KFV+WY++YY
Sbjct  418  QAGLKKFVRWYLNYY  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880