BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN042A21

Length=624
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241481.1|  PREDICTED: coiled-coil domain-containing pro...    150   3e-42   Solanum lycopersicum
ref|XP_006347381.1|  PREDICTED: coiled-coil domain-containing pro...    149   1e-41   Solanum tuberosum [potatoes]
gb|KDP45824.1|  hypothetical protein JCGZ_17431                         147   8e-41   Jatropha curcas
ref|XP_009777239.1|  PREDICTED: coiled-coil domain-containing pro...    144   1e-39   Nicotiana sylvestris
ref|XP_009608865.1|  PREDICTED: coiled-coil domain-containing pro...    143   3e-39   Nicotiana tomentosiformis
ref|XP_010687588.1|  PREDICTED: coiled-coil domain-containing pro...    142   7e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010093549.1|  hypothetical protein L484_013982                   140   5e-38   Morus notabilis
ref|XP_010322514.1|  PREDICTED: coiled-coil domain-containing pro...    140   6e-38   Solanum lycopersicum
gb|AFK47380.1|  unknown                                                 138   3e-37   Lotus japonicus
ref|XP_010248829.1|  PREDICTED: coiled-coil domain-containing pro...    137   5e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010248821.1|  PREDICTED: coiled-coil domain-containing pro...    137   5e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010101177.1|  hypothetical protein L484_005414                   136   1e-36   Morus notabilis
ref|XP_009355920.1|  PREDICTED: coiled-coil domain-containing pro...    135   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_008375067.1|  PREDICTED: coiled-coil domain-containing pro...    135   3e-36   Malus domestica [apple tree]
ref|XP_002263858.1|  PREDICTED: coiled-coil domain-containing pro...    135   3e-36   Vitis vinifera
ref|XP_002305693.1|  hypothetical protein POPTR_0004s06590g             135   6e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008240328.1|  PREDICTED: coiled-coil domain-containing pro...    134   7e-36   Prunus mume [ume]
ref|XP_011035412.1|  PREDICTED: coiled-coil domain-containing pro...    134   1e-35   Populus euphratica
emb|CDP18672.1|  unnamed protein product                                134   2e-35   Coffea canephora [robusta coffee]
ref|XP_008375068.1|  PREDICTED: coiled-coil domain-containing pro...    132   4e-35   
ref|XP_009355916.1|  PREDICTED: coiled-coil domain-containing pro...    132   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_010069536.1|  PREDICTED: coiled-coil domain-containing pro...    132   5e-35   Eucalyptus grandis [rose gum]
ref|XP_008437152.1|  PREDICTED: coiled-coil domain-containing pro...    132   6e-35   Cucumis melo [Oriental melon]
ref|XP_011086938.1|  PREDICTED: coiled-coil domain-containing pro...    132   9e-35   Sesamum indicum [beniseed]
ref|XP_004137537.1|  PREDICTED: coiled-coil domain-containing pro...    130   2e-34   Cucumis sativus [cucumbers]
ref|XP_010546632.1|  PREDICTED: coiled-coil domain-containing pro...    130   3e-34   Tarenaya hassleriana [spider flower]
gb|KGN64223.1|  hypothetical protein Csa_1G043260                       131   4e-34   
ref|NP_566245.1|  uncharacterized protein                               129   6e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008393522.1|  PREDICTED: coiled-coil domain-containing pro...    129   8e-34   Malus domestica [apple tree]
gb|KJB60515.1|  hypothetical protein B456_009G312100                    129   8e-34   Gossypium raimondii
ref|XP_008393521.1|  PREDICTED: coiled-coil domain-containing pro...    129   1e-33   Malus domestica [apple tree]
ref|XP_004495490.1|  PREDICTED: coiled-coil domain-containing pro...    129   1e-33   Cicer arietinum [garbanzo]
gb|KHG26990.1|  Coiled-coil domain-containing 12                        128   1e-33   Gossypium arboreum [tree cotton]
gb|EYU17804.1|  hypothetical protein MIMGU_mgv1a015162mg                129   2e-33   Erythranthe guttata [common monkey flower]
ref|NP_001236672.1|  uncharacterized protein LOC100527227               127   4e-33   Glycine max [soybeans]
ref|XP_007009901.1|  Cwf18 isoform 1                                    127   4e-33   
ref|XP_009396161.1|  PREDICTED: coiled-coil domain-containing pro...    128   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ86026.1|  unknown                                                 127   6e-33   Medicago truncatula
ref|XP_006408114.1|  hypothetical protein EUTSA_v10021722mg             125   1e-32   Eutrema salsugineum [saltwater cress]
ref|XP_002882392.1|  hypothetical protein ARALYDRAFT_477790             125   1e-32   
gb|KEH42882.1|  cwf18 pre-mRNA splicing factor                          126   2e-32   Medicago truncatula
ref|XP_006441474.1|  hypothetical protein CICLE_v10022597mg             126   2e-32   Citrus clementina [clementine]
gb|KDO55952.1|  hypothetical protein CISIN_1g031113mg                   126   2e-32   Citrus sinensis [apfelsine]
gb|KJB60517.1|  hypothetical protein B456_009G312100                    125   2e-32   Gossypium raimondii
ref|XP_006478141.1|  PREDICTED: coiled-coil domain-containing pro...    125   3e-32   
ref|XP_002519582.1|  conserved hypothetical protein                     125   3e-32   
gb|KJB60516.1|  hypothetical protein B456_009G312100                    125   4e-32   Gossypium raimondii
emb|CDY27800.1|  BnaA05g32090D                                          124   4e-32   Brassica napus [oilseed rape]
gb|KFK23537.1|  hypothetical protein AALP_AAs63573U000100               124   7e-32   Arabis alpina [alpine rockcress]
ref|XP_010102099.1|  ATP-dependent RNA helicase dhx8                    133   9e-32   
ref|XP_010422930.1|  PREDICTED: coiled-coil domain-containing pro...    123   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_007009902.1|  Cwf18 isoform 2                                    123   1e-31   
gb|KCW57911.1|  hypothetical protein EUGRSUZ_H00657                     123   2e-31   Eucalyptus grandis [rose gum]
gb|KCW57913.1|  hypothetical protein EUGRSUZ_H00657                     122   3e-31   Eucalyptus grandis [rose gum]
emb|CDY41931.1|  BnaC05g46730D                                          122   3e-31   Brassica napus [oilseed rape]
ref|XP_009147281.1|  PREDICTED: coiled-coil domain-containing pro...    122   3e-31   Brassica rapa
gb|ADE77638.1|  unknown                                                 122   4e-31   Picea sitchensis
ref|XP_004299453.1|  PREDICTED: coiled-coil domain-containing pro...    120   4e-30   Fragaria vesca subsp. vesca
ref|XP_010485909.1|  PREDICTED: coiled-coil domain-containing pro...    119   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010464015.1|  PREDICTED: coiled-coil domain-containing pro...    119   4e-30   Camelina sativa [gold-of-pleasure]
gb|KDO55954.1|  hypothetical protein CISIN_1g031113mg                   119   6e-30   Citrus sinensis [apfelsine]
ref|XP_010935583.1|  PREDICTED: coiled-coil domain-containing pro...    120   8e-30   Elaeis guineensis
ref|XP_010108874.1|  putative ATP-dependent RNA helicase DHX35          125   1e-29   
ref|XP_006478142.1|  PREDICTED: coiled-coil domain-containing pro...    118   1e-29   Citrus sinensis [apfelsine]
ref|XP_007208967.1|  hypothetical protein PRUPE_ppb020505mg             120   1e-29   
ref|NP_001238051.1|  uncharacterized protein LOC100306131               118   1e-29   
ref|XP_006300259.1|  hypothetical protein CARUB_v10016498mg             117   3e-29   Capsella rubella
gb|EPS62441.1|  hypothetical protein M569_12350                         115   8e-29   Genlisea aurea
gb|KHN14750.1|  Coiled-coil domain-containing protein 12                115   1e-28   Glycine soja [wild soybean]
ref|XP_008802780.1|  PREDICTED: coiled-coil domain-containing pro...    116   3e-28   Phoenix dactylifera
ref|XP_007161569.1|  hypothetical protein PHAVU_001G080600g             112   2e-27   Phaseolus vulgaris [French bean]
ref|XP_009134809.1|  PREDICTED: LOW QUALITY PROTEIN: coiled-coil ...    109   2e-26   Brassica rapa
ref|XP_006848659.1|  hypothetical protein AMTR_s00171p00065800          109   5e-26   Amborella trichopoda
ref|XP_006644463.1|  PREDICTED: coiled-coil domain-containing pro...    105   1e-24   Oryza brachyantha
gb|EEC81357.1|  hypothetical protein OsI_24550                          105   2e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001058658.1|  Os06g0730800                                       105   2e-24   
gb|EMS53919.1|  hypothetical protein TRIUR3_06239                       105   2e-24   Triticum urartu
dbj|BAJ90654.1|  predicted protein                                      103   1e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006656528.1|  PREDICTED: coiled-coil domain-containing pro...    102   2e-23   Oryza brachyantha
gb|EMT31131.1|  hypothetical protein F775_07814                         101   3e-23   
ref|XP_004966558.1|  PREDICTED: coiled-coil domain-containing pro...    101   5e-23   Setaria italica
ref|XP_003563215.1|  PREDICTED: coiled-coil domain-containing pro...    101   7e-23   Brachypodium distachyon [annual false brome]
ref|XP_002437648.1|  hypothetical protein SORBIDRAFT_10g031190        99.8    3e-22   Sorghum bicolor [broomcorn]
ref|XP_006372638.1|  hypothetical protein POPTR_0017s03480g           96.7    4e-22   
ref|NP_001141270.1|  hypothetical protein                             98.2    1e-21   Zea mays [maize]
ref|XP_002984337.1|  hypothetical protein SELMODRAFT_445863           96.3    4e-21   Selaginella moellendorffii
ref|XP_010239286.1|  PREDICTED: coiled-coil domain-containing pro...  96.7    5e-21   Brachypodium distachyon [annual false brome]
ref|XP_001780929.1|  predicted protein                                92.0    2e-20   
ref|XP_002972762.1|  hypothetical protein SELMODRAFT_413348           92.8    6e-20   
ref|XP_011461976.1|  PREDICTED: coiled-coil domain-containing pro...  84.7    5e-17   Fragaria vesca subsp. vesca
emb|CDX74154.1|  BnaA03g28930D                                        77.4    1e-14   
ref|XP_005647392.1|  hypothetical protein COCSUDRAFT_16114            75.9    6e-14   Coccomyxa subellipsoidea C-169
gb|KIZ00598.1|  Coiled-coil domain-containing protein 12              72.4    1e-12   Monoraphidium neglectum
ref|XP_004365664.1|  hypothetical protein CAOG_00793                  68.6    5e-11   Capsaspora owczarzaki ATCC 30864
ref|XP_002947930.1|  hypothetical protein VOLCADRAFT_116633           67.0    8e-11   Volvox carteri f. nagariensis
ref|XP_009067757.1|  PREDICTED: coiled-coil domain-containing pro...  65.1    3e-10   Acanthisitta chloris
ref|XP_004342218.1|  cwf18 pre-mRNA splicing factor protein           65.1    6e-10   Acanthamoeba castellanii str. Neff
ref|XP_001422700.1|  predicted protein                                63.9    7e-10   Ostreococcus lucimarinus CCE9901
ref|XP_011418659.1|  PREDICTED: coiled-coil domain-containing pro...  64.3    9e-10   Crassostrea gigas
ref|XP_010020082.1|  PREDICTED: coiled-coil domain-containing pro...  63.5    1e-09   Nestor notabilis
ref|XP_009878822.1|  PREDICTED: coiled-coil domain-containing pro...  63.9    2e-09   Charadrius vociferus
ref|XP_008120605.1|  PREDICTED: coiled-coil domain-containing pro...  63.9    2e-09   Anolis carolinensis [Carolina anole]
gb|KFP75017.1|  Coiled-coil domain-containing protein 12              62.4    2e-09   Acanthisitta chloris
ref|XP_010171939.1|  PREDICTED: coiled-coil domain-containing pro...  62.0    3e-09   Antrostomus carolinensis
ref|XP_006171088.1|  PREDICTED: coiled-coil domain-containing pro...  62.4    4e-09   
gb|KFU93677.1|  Coiled-coil domain-containing protein 12              62.0    5e-09   Chaetura pelagica
ref|XP_007509692.1|  unknown protein                                  62.0    5e-09   Bathycoccus prasinos
ref|XP_010001356.1|  PREDICTED: coiled-coil domain-containing pro...  61.6    5e-09   Chaetura pelagica
ref|XP_005934857.1|  PREDICTED: coiled-coil domain-containing pro...  62.0    6e-09   Haplochromis burtoni
ref|NP_001158518.1|  Coiled-coil domain-containing protein 12         62.0    6e-09   Oncorhynchus mykiss
emb|CDJ44745.1|  hypothetical protein, conserved                      62.0    6e-09   Eimeria tenella
ref|XP_003206961.1|  PREDICTED: coiled-coil domain-containing pro...  62.4    6e-09   Meleagris gallopavo [common turkey]
ref|NP_001003589.1|  coiled-coil domain-containing protein 12         62.0    6e-09   Danio rerio [leopard danio]
gb|ELV09682.1|  Coiled-coil domain-containing protein 12              62.0    7e-09   Tupaia chinensis
ref|XP_009705483.1|  PREDICTED: coiled-coil domain-containing pro...  61.2    8e-09   Cariama cristata
ref|XP_010393056.1|  PREDICTED: coiled-coil domain-containing pro...  61.2    8e-09   Corvus cornix cornix
emb|CDI84055.1|  hypothetical protein, conserved                      61.6    8e-09   Eimeria acervulina
ref|XP_008921036.1|  PREDICTED: coiled-coil domain-containing pro...  62.0    8e-09   
ref|XP_008641363.1|  PREDICTED: coiled-coil domain-containing pro...  61.6    9e-09   
ref|XP_005023364.1|  PREDICTED: coiled-coil domain-containing pro...  61.2    9e-09   
ref|XP_009936630.1|  PREDICTED: coiled-coil domain-containing pro...  61.2    9e-09   Opisthocomus hoazin [hoatzin]
ref|XP_005144041.1|  PREDICTED: coiled-coil domain-containing pro...  62.0    1e-08   
ref|XP_008321553.1|  PREDICTED: coiled-coil domain-containing pro...  61.2    1e-08   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_001697076.1|  hypothetical protein CHLREDRAFT_184951           60.8    1e-08   Chlamydomonas reinhardtii
ref|XP_009279299.1|  PREDICTED: coiled-coil domain-containing pro...  60.8    1e-08   Aptenodytes forsteri
ref|XP_009926465.1|  PREDICTED: coiled-coil domain-containing pro...  60.5    1e-08   Haliaeetus albicilla
ref|XP_009573010.1|  PREDICTED: coiled-coil domain-containing pro...  60.5    1e-08   Fulmarus glacialis
gb|EPB87798.1|  hypothetical protein HMPREF1544_05458                 60.8    1e-08   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_003059754.1|  predicted protein                                60.8    1e-08   Micromonas pusilla CCMP1545
gb|KGL89593.1|  Coiled-coil domain-containing protein 12              60.1    1e-08   Charadrius vociferus
ref|XP_629550.1|  mRNA splicing factor, Cwf18 family protein          63.2    1e-08   Dictyostelium discoideum AX4
ref|XP_009638389.1|  PREDICTED: coiled-coil domain-containing pro...  60.5    2e-08   Egretta garzetta
ref|XP_009473636.1|  PREDICTED: coiled-coil domain-containing pro...  60.8    2e-08   Nipponia nippon
gb|ACI66181.1|  Coiled-coil domain-containing protein 12              60.8    2e-08   Salmo salar
ref|XP_009015858.1|  hypothetical protein HELRODRAFT_160665           60.5    2e-08   Helobdella robusta
ref|XP_009554414.1|  PREDICTED: coiled-coil domain-containing pro...  60.5    2e-08   Cuculus canorus
ref|NP_001134087.1|  Coiled-coil domain-containing protein 12         60.5    2e-08   Salmo salar
ref|XP_001521551.2|  PREDICTED: coiled-coil domain-containing pro...  60.8    2e-08   
ref|XP_010133771.1|  PREDICTED: coiled-coil domain-containing pro...  60.1    2e-08   Buceros rhinoceros silvestris
gb|AAI29787.1|  LOC100037234 protein                                  60.5    2e-08   Xenopus laevis [clawed frog]
gb|ACI66996.1|  Coiled-coil domain-containing protein 12              60.5    2e-08   Salmo salar
emb|CDJ64512.1|  hypothetical protein, conserved                      60.5    2e-08   Eimeria necatrix
ref|XP_009812719.1|  PREDICTED: coiled-coil domain-containing pro...  60.1    2e-08   Gavia stellata
ref|XP_004316573.1|  PREDICTED: coiled-coil domain-containing pro...  60.5    2e-08   
ref|XP_004077894.1|  PREDICTED: coiled-coil domain-containing pro...  60.5    2e-08   
ref|XP_005308836.1|  PREDICTED: coiled-coil domain-containing pro...  60.5    2e-08   Chrysemys picta bellii
ref|XP_007070347.1|  PREDICTED: coiled-coil domain-containing pro...  60.1    2e-08   
ref|XP_004760838.1|  PREDICTED: coiled-coil domain-containing pro...  60.1    3e-08   Mustela putorius furo [black ferret]
ref|NP_001091259.1|  uncharacterized protein LOC100037064             60.1    3e-08   Xenopus laevis [clawed frog]
ref|XP_005804720.1|  PREDICTED: coiled-coil domain-containing pro...  60.5    3e-08   
ref|XP_005532203.1|  PREDICTED: coiled-coil domain-containing pro...  60.5    3e-08   
gb|KFO89314.1|  Coiled-coil domain-containing protein 12              59.7    3e-08   Buceros rhinoceros silvestris
ref|XP_008490404.1|  PREDICTED: coiled-coil domain-containing pro...  59.7    3e-08   
ref|XP_005428072.1|  PREDICTED: coiled-coil domain-containing pro...  59.7    3e-08   Geospiza fortis
ref|XP_005040505.1|  PREDICTED: coiled-coil domain-containing pro...  61.6    3e-08   Ficedula albicollis
gb|KFD48500.1|  hypothetical protein M513_10634                       60.1    3e-08   Trichuris suis
ref|XP_002109500.1|  hypothetical protein TRIADDRAFT_53602            60.1    3e-08   Trichoplax adhaerens
ref|XP_009945692.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    4e-08   Leptosomus discolor
ref|XP_007436316.1|  PREDICTED: coiled-coil domain-containing pro...  59.7    4e-08   
ref|XP_003454446.1|  PREDICTED: coiled-coil domain-containing pro...  59.7    4e-08   
ref|XP_006277376.1|  PREDICTED: coiled-coil domain-containing pro...  59.7    4e-08   
gb|EMC81123.1|  Coiled-coil domain-containing protein 12              59.3    4e-08   
ref|NP_001106902.1|  coiled-coil domain containing 12                 59.3    5e-08   Xenopus laevis [clawed frog]
ref|XP_006801430.1|  PREDICTED: coiled-coil domain-containing pro...  59.3    5e-08   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005229622.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    5e-08   Falco peregrinus [peregrine]
ref|XP_009084497.1|  PREDICTED: coiled-coil domain-containing pro...  59.3    5e-08   
gb|KFP61285.1|  Coiled-coil domain-containing protein 12              58.5    5e-08   Cariama cristata
dbj|GAN07616.1|  coiled-coil domain-containing protein 12             59.3    6e-08   Mucor ambiguus
ref|XP_005934856.1|  PREDICTED: coiled-coil domain-containing pro...  59.3    6e-08   
ref|XP_010710593.1|  PREDICTED: coiled-coil domain-containing pro...  59.3    6e-08   Meleagris gallopavo [common turkey]
ref|XP_010882732.1|  PREDICTED: coiled-coil domain-containing pro...  59.3    6e-08   Esox lucius
ref|XP_005600803.1|  PREDICTED: coiled-coil domain-containing pro...  59.7    6e-08   Equus caballus [domestic horse]
gb|KFO72623.1|  Coiled-coil domain-containing protein 12              58.2    7e-08   Cuculus canorus
ref|NP_001006353.1|  coiled-coil domain-containing protein 12         59.3    7e-08   Gallus gallus [bantam]
gb|EHJ70025.1|  coiled-coil domain containing 12-like protein         58.9    7e-08   
ref|XP_006200792.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    7e-08   
gb|KFO12662.1|  Coiled-coil domain-containing protein 12              58.2    7e-08   Balearica regulorum gibbericeps
gb|KIJ69082.1|  hypothetical protein HYDPIDRAFT_123148                58.9    7e-08   Hydnomerulius pinastri MD-312
ref|XP_002912813.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    7e-08   
ref|XP_005512181.1|  PREDICTED: coiled-coil domain-containing pro...  59.3    7e-08   Columba livia [carrier pigeon]
ref|XP_002406102.1|  coiled-coil domain-containing protein, putative  58.9    7e-08   
ref|XP_009487206.1|  PREDICTED: coiled-coil domain-containing pro...  58.2    7e-08   Pelecanus crispus
ref|XP_008283900.1|  PREDICTED: coiled-coil domain-containing pro...  59.3    8e-08   Stegastes partitus
ref|XP_008430786.1|  PREDICTED: coiled-coil domain-containing pro...  59.7    8e-08   Poecilia reticulata
ref|XP_005669523.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    8e-08   Sus scrofa [pigs]
ref|XP_006928752.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    8e-08   Felis catus [cat]
ref|XP_003762982.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    8e-08   Sarcophilus harrisii
gb|KFM08706.1|  Coiled-coil domain-containing protein 12              57.8    8e-08   Aptenodytes forsteri
ref|XP_007126145.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    8e-08   
ref|XP_006173541.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    8e-08   
ref|XP_004399222.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    8e-08   Odobenus rosmarus divergens
ref|XP_541901.2|  PREDICTED: coiled-coil domain-containing protei...  58.9    8e-08   Canis lupus familiaris [dogs]
ref|XP_006129858.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    8e-08   
ref|XP_010304384.1|  PREDICTED: coiled-coil domain-containing pro...  58.2    8e-08   Balearica regulorum gibbericeps
ref|XP_007088492.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    8e-08   Panthera tigris altaica
ref|XP_005600802.1|  PREDICTED: coiled-coil domain-containing pro...  60.1    8e-08   
ref|XP_004419680.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    9e-08   
ref|XP_006914932.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    9e-08   
dbj|GAA51052.1|  coiled-coil domain-containing protein 12             58.9    9e-08   Clonorchis sinensis [oriental liver fluke]
ref|XP_010755218.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    9e-08   
ref|XP_005496692.1|  PREDICTED: uncharacterized protein LOC102063747  59.7    9e-08   
ref|XP_009176425.1|  hypothetical protein T265_11492                  58.9    1e-07   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_005696078.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    1e-07   Capra hircus [domestic goat]
ref|XP_004676293.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    1e-07   Condylura cristata
ref|XP_004614568.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    1e-07   Sorex araneus [Eurasian shrew]
ref|XP_010083497.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    1e-07   Pterocles gutturalis
ref|XP_005600801.1|  PREDICTED: coiled-coil domain-containing pro...  60.1    1e-07   
ref|XP_009906078.1|  PREDICTED: coiled-coil domain-containing pro...  58.2    1e-07   Picoides pubescens
emb|CDS10767.1|  hypothetical protein LRAMOSA11253                    58.2    1e-07   Lichtheimia ramosa
ref|XP_007168907.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    1e-07   Balaenoptera acutorostrata scammoni
ref|XP_005696079.1|  PREDICTED: coiled-coil domain-containing pro...  58.2    1e-07   Capra hircus [domestic goat]
gb|KIJ10497.1|  hypothetical protein PAXINDRAFT_177458                58.2    1e-07   Paxillus involutus ATCC 200175
gb|ELK24973.1|  Coiled-coil domain-containing protein 12              58.5    1e-07   Myotis davidii
ref|XP_010860802.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    1e-07   Bison bison bison
ref|XP_004368774.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    1e-07   
emb|CDH48230.1|  hypothetical protein RO3G_10424                      58.2    1e-07   Lichtheimia corymbifera JMRC:FSU:9682
gb|EOA98534.1|  Coiled-coil domain-containing protein 12              58.2    1e-07   Anas platyrhynchos [duck]
ref|XP_007470325.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    1e-07   Lipotes vexillifer [baiji]
ref|XP_004211306.1|  PREDICTED: coiled-coil domain-containing pro...  57.4    1e-07   
ref|NP_001069934.1|  coiled-coil domain-containing protein 12         58.5    1e-07   Bos taurus [bovine]
ref|XP_009926464.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    1e-07   Haliaeetus albicilla
ref|XP_004283914.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    1e-07   Orcinus orca [Orca]
gb|ELK10175.1|  Coiled-coil domain-containing protein 12              58.2    1e-07   Pteropus alecto
ref|XP_008154223.1|  PREDICTED: coiled-coil domain-containing pro...  58.2    1e-07   Eptesicus fuscus
ref|XP_005223151.2|  PREDICTED: coiled-coil domain-containing pro...  58.2    1e-07   
ref|XP_003966144.1|  PREDICTED: coiled-coil domain-containing pro...  58.2    1e-07   Takifugu rubripes [tiger puffer]
ref|XP_001641486.1|  predicted protein                                58.2    1e-07   Nematostella vectensis
ref|XP_007256563.1|  PREDICTED: coiled-coil domain-containing pro...  58.2    2e-07   
ref|XP_005955215.1|  PREDICTED: coiled-coil domain-containing pro...  58.2    2e-07   
gb|EFA75691.1|  mRNA splicing factor                                  60.1    2e-07   Heterostelium album PN500
ref|XP_010816234.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    2e-07   
ref|XP_007499795.1|  PREDICTED: coiled-coil domain-containing pro...  57.0    2e-07   
gb|EST07333.1|  hypothetical protein PSEUBRA_SCAF20g03109             58.2    2e-07   Kalmanozyma brasiliensis GHG001
gb|EPQ08394.1|  Coiled-coil domain-containing protein 12              57.8    2e-07   Myotis brandtii
gb|KHJ46962.1|  hypothetical protein D918_02502                       57.8    2e-07   Trichuris suis
emb|CBQ71313.1|  conserved hypothetical protein                       58.2    2e-07   Sporisorium reilianum SRZ2
ref|XP_010773265.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    2e-07   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007883027.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    2e-07   Callorhinchus milii [Australian ghost shark]
emb|CAG11969.1|  unnamed protein product                              57.8    2e-07   Tetraodon nigroviridis
ref|XP_005075048.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    2e-07   Mesocricetus auratus [Syrian golden hamster]
ref|XP_003384885.1|  PREDICTED: coiled-coil domain-containing pro...  57.0    2e-07   Amphimedon queenslandica
ref|XP_010281762.1|  PREDICTED: coiled-coil domain-containing pro...  58.5    2e-07   Phaethon lepturus
ref|XP_009979166.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    2e-07   Tauraco erythrolophus
gb|EPY89395.1|  coiled-coil domain-containing protein 12-like pro...  58.5    2e-07   Camelus ferus
ref|XP_005348055.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    2e-07   
gb|KIL00934.1|  hypothetical protein PAXRUDRAFT_821140                57.4    2e-07   Paxillus rubicundulus Ve08.2h10
dbj|GAM18895.1|  hypothetical protein SAMD00019534_020700             59.7    2e-07   Acytostelium subglobosum LB1
ref|XP_003504302.1|  PREDICTED: coiled-coil domain-containing pro...  57.4    2e-07   Cricetulus griseus [Chinese hamsters]
ref|XP_790871.3|  PREDICTED: coiled-coil domain-containing protei...  57.4    3e-07   Strongylocentrotus purpuratus [purple urchin]
ref|XP_006770487.1|  PREDICTED: coiled-coil domain-containing pro...  58.2    3e-07   
ref|XP_005867263.1|  PREDICTED: coiled-coil domain-containing pro...  58.2    3e-07   Myotis brandtii
ref|XP_007347865.1|  mRNA splicing factor                             57.4    3e-07   
ref|XP_009501322.1|  PREDICTED: coiled-coil domain-containing pro...  56.6    3e-07   Phalacrocorax carbo [common cormorant]
emb|CDH48231.1|  hypothetical protein RO3G_10424                      57.0    3e-07   Lichtheimia corymbifera JMRC:FSU:9682
gb|KFW90119.1|  Coiled-coil domain-containing protein 12              56.6    3e-07   Phalacrocorax carbo [common cormorant]
ref|NP_001040312.1|  coiled-coil domain containing 12-like protein    57.4    3e-07   Bombyx mori [silk moth]
ref|XP_006975600.1|  PREDICTED: coiled-coil domain-containing pro...  57.0    3e-07   
gb|KIK31102.1|  hypothetical protein PISMIDRAFT_670057                57.4    3e-07   Pisolithus microcarpus 441
ref|XP_007572731.1|  PREDICTED: coiled-coil domain-containing pro...  57.4    3e-07   Poecilia formosa
ref|XP_002132159.1|  PREDICTED: coiled-coil domain-containing pro...  57.4    3e-07   Ciona intestinalis [sea vase]
ref|XP_005223150.1|  PREDICTED: coiled-coil domain-containing pro...  58.9    3e-07   
ref|XP_009682438.1|  PREDICTED: coiled-coil domain-containing pro...  57.4    3e-07   Struthio camelus australis
ref|XP_011221225.1|  PREDICTED: coiled-coil domain-containing pro...  57.8    3e-07   
ref|XP_007632918.1|  PREDICTED: coiled-coil domain-containing pro...  57.0    4e-07   
ref|XP_011392403.1|  Coiled-coil domain-containing protein 12 (CC...  57.4    4e-07   Ustilago maydis 521
ref|XP_007534029.1|  PREDICTED: coiled-coil domain-containing pro...  57.0    4e-07   Erinaceus europaeus [common hedgehog]
ref|XP_004704212.1|  PREDICTED: coiled-coil domain-containing pro...  56.6    4e-07   
ref|NP_001096533.1|  coiled-coil domain containing 12                 56.6    4e-07   Xenopus tropicalis [western clawed frog]
gb|KFD69694.1|  hypothetical protein M514_10634                       57.4    4e-07   Trichuris suis
ref|XP_006026480.1|  PREDICTED: coiled-coil domain-containing pro...  55.8    4e-07   
ref|XP_002740668.1|  PREDICTED: coiled-coil domain-containing pro...  57.0    4e-07   Saccoglossus kowalevskii
emb|CDW54990.1|  cwf18 domain containing protein                      57.0    4e-07   Trichuris trichiura
ref|XP_008970042.1|  PREDICTED: coiled-coil domain-containing pro...  57.0    5e-07   Pan paniscus [bonobo]
emb|CBY21471.1|  unnamed protein product                              56.2    6e-07   Oikopleura dioica
emb|CBY33569.1|  unnamed protein product                              55.8    7e-07   Oikopleura dioica
ref|NP_001102253.1|  coiled-coil domain-containing protein 12         56.2    7e-07   Rattus norvegicus [brown rat]
emb|CEG80712.1|  hypothetical protein RMATCC62417_15008               55.8    7e-07   Rhizopus microsporus
gb|KIO13462.1|  hypothetical protein M404DRAFT_993013                 55.8    8e-07   Pisolithus tinctorius Marx 270
ref|XP_010152314.1|  PREDICTED: coiled-coil domain-containing pro...  55.1    8e-07   Eurypyga helias
gb|KFV94185.1|  Coiled-coil domain-containing protein 12              55.1    8e-07   
ref|XP_006635772.1|  PREDICTED: coiled-coil domain-containing pro...  55.8    9e-07   
ref|XP_008474827.1|  PREDICTED: coiled-coil domain-containing pro...  55.8    9e-07   
gb|KIM65377.1|  hypothetical protein SCLCIDRAFT_113194                55.8    9e-07   
ref|XP_004662097.1|  PREDICTED: coiled-coil domain-containing pro...  55.8    9e-07   
emb|CEI94738.1|  hypothetical protein RMCBS344292_08943               55.5    9e-07   
ref|XP_008935812.1|  PREDICTED: coiled-coil domain-containing pro...  54.3    1e-06   
gb|ELU11114.1|  hypothetical protein CAPTEDRAFT_179668                55.5    1e-06   
ref|XP_002371983.1|  hypothetical protein TGME49_079430               55.5    1e-06   
ref|XP_007863007.1|  mRNA splicing factor                             55.5    1e-06   
ref|XP_007322034.1|  hypothetical protein SERLADRAFT_475766           55.8    1e-06   
ref|XP_003880793.1|  conserved hypothetical protein                   55.5    1e-06   
ref|XP_623598.1|  PREDICTED: coiled-coil domain-containing protei...  55.5    1e-06   
emb|CEG65639.1|  hypothetical protein RMATCC62417_02381               55.5    1e-06   
gb|EUB57237.1|  Activin receptor type-2A                              58.2    1e-06   
ref|XP_006624564.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_003704154.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_005383476.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_004640743.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_004877900.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_006893018.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_010622648.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_006770486.1|  PREDICTED: coiled-coil domain-containing pro...  57.0    1e-06   
ref|XP_008571868.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_004581473.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|NP_082588.2|  coiled-coil domain-containing protein 12            55.5    1e-06   
ref|XP_007949942.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
gb|EPT04081.1|  hypothetical protein FOMPIDRAFT_1114933               55.5    1e-06   
ref|XP_003694341.1|  PREDICTED: coiled-coil domain-containing pro...  55.1    1e-06   
ref|XP_005332982.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_005006900.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_010588161.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    1e-06   
ref|XP_008571867.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    2e-06   
gb|KFQ21930.1|  Coiled-coil domain-containing protein 12              54.3    2e-06   
gb|KIJ35756.1|  hypothetical protein M422DRAFT_51369                  55.1    2e-06   
gb|KDR19864.1|  Coiled-coil domain-containing protein 12              55.1    2e-06   
ref|XP_011312115.1|  PREDICTED: coiled-coil domain-containing pro...  55.1    2e-06   
ref|XP_004662096.1|  PREDICTED: coiled-coil domain-containing pro...  55.5    2e-06   
gb|AAH26668.1|  Coiled-coil domain containing 12                      55.1    2e-06   
ref|XP_008887726.1|  cwf18 pre-mRNA splicing factor protein           55.1    2e-06   
ref|XP_002713376.2|  PREDICTED: coiled-coil domain-containing pro...  55.8    2e-06   
dbj|BAC04857.1|  unnamed protein product                              55.1    2e-06   
ref|XP_010180345.1|  PREDICTED: coiled-coil domain-containing pro...  53.9    2e-06   
ref|XP_005828552.1|  hypothetical protein GUITHDRAFT_46122            53.9    2e-06   
ref|XP_002475492.1|  predicted protein                                55.1    2e-06   
ref|XP_010622650.1|  PREDICTED: coiled-coil domain-containing pro...  54.7    2e-06   
ref|XP_001833092.1|  hypothetical protein CC1G_01154                  54.7    2e-06   
ref|XP_009057340.1|  hypothetical protein LOTGIDRAFT_233303           55.1    2e-06   
emb|CDS15770.1|  mRNA splicing factor Cwf18                           55.5    2e-06   
gb|ACI69160.1|  Coiled-coil domain-containing protein 12              54.3    2e-06   
gb|KIK46388.1|  hypothetical protein CY34DRAFT_76296                  54.7    2e-06   
dbj|GAK67405.1|  mRNA splicing factor                                 55.1    2e-06   
gb|KDR73579.1|  hypothetical protein GALMADRAFT_620576                54.7    2e-06   
ref|XP_010622651.1|  PREDICTED: coiled-coil domain-containing pro...  54.7    2e-06   
ref|XP_003294293.1|  hypothetical protein DICPUDRAFT_96005            56.6    2e-06   
ref|XP_011496654.1|  PREDICTED: coiled-coil domain-containing pro...  54.7    2e-06   
gb|EJU05608.1|  mRNA splicing factor                                  54.7    2e-06   
ref|XP_010588164.1|  PREDICTED: coiled-coil domain-containing pro...  54.7    2e-06   
ref|XP_001842700.1|  coiled-coil domain-containing protein 12         54.7    2e-06   
gb|EHA98666.1|  Coiled-coil domain-containing protein 12              55.8    3e-06   
emb|CDJ03302.1|  mRNA splicing factor, Cwf18                          55.1    3e-06   
gb|KIY73268.1|  mRNA splicing factor                                  54.3    3e-06   
ref|XP_006868867.1|  PREDICTED: coiled-coil domain-containing pro...  54.3    3e-06   
gb|ETS60401.1|  hypothetical protein PaG_05607                        54.7    4e-06   
ref|XP_003487410.1|  PREDICTED: coiled-coil domain-containing pro...  54.3    4e-06   
dbj|GAC76315.1|  uncharacterized conserved protein                    54.7    4e-06   
gb|KJA27054.1|  hypothetical protein HYPSUDRAFT_63313                 53.9    4e-06   
ref|XP_001654121.1|  AAEL009922-PB                                    53.9    4e-06   
gb|KDQ60903.1|  hypothetical protein JAAARDRAFT_124325                53.9    5e-06   
ref|XP_007764577.1|  mRNA splicing factor                             53.9    5e-06   
ref|XP_003401446.1|  PREDICTED: coiled-coil domain-containing pro...  53.5    5e-06   
ref|XP_003477083.2|  PREDICTED: coiled-coil domain-containing pro...  53.9    6e-06   
ref|NP_001264003.1|  coiled-coil domain-containing protein 12 2       53.5    6e-06   
ref|XP_008559088.1|  PREDICTED: coiled-coil domain-containing pro...  53.1    6e-06   
dbj|BAB28353.1|  unnamed protein product                              53.5    6e-06   
gb|EAW64797.1|  coiled-coil domain containing 12, isoform CRA_c       53.5    7e-06   
ref|XP_007982206.1|  PREDICTED: coiled-coil domain-containing pro...  53.9    7e-06   
ref|XP_009199195.1|  PREDICTED: coiled-coil domain-containing pro...  53.5    7e-06   
ref|XP_010373066.1|  PREDICTED: coiled-coil domain-containing pro...  53.5    7e-06   
ref|XP_003926327.1|  PREDICTED: coiled-coil domain-containing pro...  53.5    7e-06   
ref|XP_001113784.2|  PREDICTED: coiled-coil domain-containing pro...  53.9    7e-06   
gb|EHH16416.1|  hypothetical protein EGK_11696                        53.5    7e-06   
ref|XP_004877899.1|  PREDICTED: coiled-coil domain-containing pro...  53.5    7e-06   
ref|NP_653317.2|  coiled-coil domain-containing protein 12 1          53.9    7e-06   
gb|EAW64799.1|  coiled-coil domain containing 12, isoform CRA_d       53.5    7e-06   
ref|XP_003794580.1|  PREDICTED: coiled-coil domain-containing pro...  53.5    8e-06   
ref|XP_003257040.1|  PREDICTED: coiled-coil domain-containing pro...  53.5    8e-06   
ref|XP_005843872.1|  hypothetical protein CHLNCDRAFT_139725           52.4    8e-06   
ref|XP_006106813.1|  PREDICTED: coiled-coil domain-containing pro...  54.7    1e-05   
ref|XP_002058410.1|  GJ14326                                          53.1    1e-05   
ref|XP_008069423.1|  PREDICTED: coiled-coil domain-containing pro...  53.1    1e-05   
ref|XP_002073345.1|  GK14082                                          52.8    1e-05   
gb|KIK59549.1|  hypothetical protein GYMLUDRAFT_1004355               52.8    1e-05   
gb|KEP54473.1|  cwf18 pre-mRNA splicing factor                        52.8    1e-05   
ref|XP_008829145.1|  PREDICTED: coiled-coil domain-containing pro...  54.3    1e-05   
ref|XP_003376350.1|  coiled-coil domain-containing protein 12         54.3    1e-05   
gb|KGL81817.1|  Coiled-coil domain-containing protein 12              51.6    2e-05   
ref|XP_009237373.1|  PREDICTED: coiled-coil domain-containing pro...  53.1    2e-05   
ref|XP_007982203.1|  PREDICTED: coiled-coil domain-containing pro...  53.5    2e-05   
ref|XP_009199194.1|  PREDICTED: coiled-coil domain-containing pro...  52.4    2e-05   
ref|XP_007852654.1|  hypothetical protein Moror_10788                 52.0    2e-05   
gb|EIE85714.1|  hypothetical protein RO3G_10424                       52.0    2e-05   
gb|KIR83833.1|  coiled-coil domain-containing protein 12              52.0    2e-05   
gb|KIR45257.1|  coiled-coil domain-containing protein 12              52.0    2e-05   
emb|CCM04402.1|  predicted protein                                    52.0    2e-05   
ref|XP_003191719.1|  hypothetical protein CGB_A8500C                  52.0    2e-05   
ref|XP_010120764.1|  PREDICTED: coiled-coil domain-containing pro...  50.4    2e-05   
gb|AFR92891.1|  coiled-coil domain-containing protein 12              52.0    3e-05   
ref|XP_006713054.1|  PREDICTED: coiled-coil domain-containing pro...  52.8    3e-05   
emb|CBN74611.1|  conserved unknown protein                            52.4    3e-05   
gb|KIM48775.1|  hypothetical protein M413DRAFT_85897                  51.6    3e-05   
gb|KDN53280.1|  hypothetical protein K437DRAFT_97238                  51.6    3e-05   
ref|XP_010219525.1|  PREDICTED: coiled-coil domain-containing pro...  53.1    3e-05   
ref|XP_001950344.1|  PREDICTED: coiled-coil domain-containing pro...  52.0    3e-05   
ref|XP_004034090.1|  PREDICTED: coiled-coil domain-containing pro...  52.0    4e-05   
ref|XP_007300569.1|  mRNA splicing factor                             51.2    4e-05   
gb|AAW26108.1|  SJCHGC05178 protein                                   52.0    4e-05   
emb|CCD79629.1|  putative pre-mRNA splicing factor                    52.0    4e-05   
dbj|GAC94231.1|  hypothetical protein PHSY_001802                     52.0    4e-05   
gb|KIO19999.1|  hypothetical protein M407DRAFT_245977                 51.6    4e-05   
gb|EFX71926.1|  hypothetical protein DAPPUDRAFT_308635                50.8    5e-05   
ref|XP_001357627.1|  GA13783                                          51.2    5e-05   
gb|EJK63884.1|  hypothetical protein THAOC_15433                      50.8    5e-05   
gb|KGB32889.1|  Coiled-coil domain-containing protein 12              51.6    5e-05   
ref|XP_008045302.1|  mRNA splicing factor                             50.8    6e-05   
ref|XP_005777455.1|  hypothetical protein EMIHUDRAFT_115649           50.1    6e-05   
ref|XP_001902305.1|  zgc:101038 protein                               51.6    6e-05   
emb|CDP91854.1|  Protein Bm7017, isoform b                            51.2    6e-05   
ref|XP_006457923.1|  hypothetical protein AGABI2DRAFT_190318          50.8    6e-05   
ref|XP_777601.1|  hypothetical protein CNBA7220                       50.8    8e-05   
gb|EUC61682.1|  cwf18 pre-mRNA splicing factor                        50.8    8e-05   
ref|XP_002001451.1|  GI21967                                          50.4    8e-05   
gb|EFO23336.2|  hypothetical protein LOAG_05143                       50.8    8e-05   
emb|CCO27709.1|  Coiled-coil domain-containing protein 12             50.8    8e-05   
emb|CDR19135.1|  unnamed protein product                              48.9    9e-05   
ref|XP_007395405.1|  hypothetical protein PHACADRAFT_160984           50.4    9e-05   
ref|XP_011397172.1|  Coiled-coil domain-containing protein 12         50.1    9e-05   
emb|CDI56605.1|  Coiled-coil domain-containing protein 12 (CCDC12)    50.8    9e-05   
ref|XP_001981269.1|  GG11979                                          50.4    1e-04   
emb|CCF49151.1|  uncharacterized protein UHOR_08576                   50.8    1e-04   
ref|XP_009015860.1|  hypothetical protein HELRODRAFT_160668           49.7    1e-04   
ref|XP_003140728.1|  hypothetical protein LOAG_05143                  50.8    1e-04   
ref|XP_009267640.1|  Coiled-coil domain-containing protein 12         50.1    1e-04   
ref|XP_002423163.1|  coiled-coil domain-containing protein, putative  50.1    1e-04   
ref|XP_011373744.1|  PREDICTED: coiled-coil domain-containing pro...  49.7    1e-04   
gb|KFM81533.1|  Coiled-coil domain-containing protein 12              50.1    1e-04   
ref|XP_002105442.1|  GD17487                                          50.1    1e-04   
ref|NP_651757.1|  CG15525                                             50.1    1e-04   
ref|XP_001874778.1|  predicted protein                                48.9    1e-04   
ref|XP_001993899.1|  GH22169                                          50.1    1e-04   
ref|XP_001955518.1|  GF16213                                          50.1    1e-04   
gb|KIK08777.1|  hypothetical protein K443DRAFT_672294                 50.1    1e-04   
gb|EMD38065.1|  hypothetical protein CERSUDRAFT_113210                49.7    2e-04   
gb|KIY43508.1|  mRNA splicing factor                                  49.7    2e-04   
emb|CDI95535.1|  protein kinase                                       51.6    2e-04   
ref|XP_006680507.1|  hypothetical protein BATDEDRAFT_90113            50.1    2e-04   
emb|CDI95516.1|  protein kinase                                       51.6    2e-04   
ref|XP_011203557.1|  PREDICTED: coiled-coil domain-containing pro...  49.7    2e-04   
gb|KDQ33401.1|  hypothetical protein PLEOSDRAFT_1110559               49.3    2e-04   
gb|KII89123.1|  hypothetical protein PLICRDRAFT_124305                49.3    2e-04   
gb|ELU44975.1|  amidophosphoribosyltransferase                        51.2    2e-04   
ref|XP_001607823.1|  PREDICTED: coiled-coil domain-containing pro...  49.3    2e-04   
ref|XP_011260768.1|  PREDICTED: coiled-coil domain-containing pro...  49.3    2e-04   
ref|XP_003035309.1|  hypothetical protein SCHCODRAFT_81458            49.3    2e-04   
ref|XP_011062868.1|  PREDICTED: coiled-coil domain-containing pro...  48.9    2e-04   
ref|XP_002098499.1|  GE10404                                          49.3    3e-04   
ref|XP_972150.2|  PREDICTED: coiled-coil domain-containing protei...  49.3    3e-04   
ref|XP_011190442.1|  PREDICTED: coiled-coil domain-containing pro...  49.7    3e-04   
gb|EEZ97173.1|  hypothetical protein TcasGA2_TC004360                 48.9    3e-04   
gb|EYC31815.1|  hypothetical protein Y032_0003g1256                   49.3    3e-04   
gb|EJW85238.1|  hypothetical protein WUBG_03851                       49.7    3e-04   
gb|KIL69949.1|  hypothetical protein M378DRAFT_184310                 48.9    3e-04   
ref|XP_002156513.2|  PREDICTED: coiled-coil domain-containing pro...  48.9    3e-04   
gb|AAM51122.1|  SD23244p                                              48.9    3e-04   
ref|XP_009926466.1|  PREDICTED: coiled-coil domain-containing pro...  48.1    4e-04   
gb|KII63656.1|  Coiled-coil domain-containing protein 12              48.1    4e-04   
gb|KIH48264.1|  Cwf18 pre-mRNA splicing factor                        47.8    4e-04   
gb|ETN80671.1|  Cwf18 pre-mRNA splicing factor                        48.1    4e-04   
ref|XP_011159165.1|  PREDICTED: coiled-coil domain-containing pro...  48.5    4e-04   
ref|XP_011348736.1|  PREDICTED: coiled-coil domain-containing pro...  48.1    5e-04   
gb|KIP06031.1|  hypothetical protein PHLGIDRAFT_46883                 48.5    5e-04   
ref|XP_318355.4|  AGAP004668-PA                                       48.5    5e-04   
ref|XP_011146632.1|  PREDICTED: coiled-coil domain-containing pro...  48.1    5e-04   
ref|XP_001728980.1|  hypothetical protein MGL_3768                    48.1    6e-04   
ref|XP_005094457.1|  PREDICTED: coiled-coil domain-containing pro...  48.1    6e-04   
ref|XP_004367393.1|  mRNA splicing factor                             49.7    7e-04   
ref|XP_007385490.1|  mRNA splicing factor                             48.1    7e-04   
gb|KHN85627.1|  Coiled-coil domain-containing protein 12              48.9    7e-04   
gb|EYC31817.1|  hypothetical protein Y032_0003g1256                   49.3    0.001   
gb|KIM79682.1|  hypothetical protein PILCRDRAFT_823220                47.8    0.001   
gb|EYC31819.1|  hypothetical protein Y032_0003g1256                   49.3    0.001   
ref|XP_008611473.1|  hypothetical protein SDRG_07418                  47.0    0.001   



>ref|XP_004241481.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Solanum lycopersicum]
Length=149

 Score =   150 bits (380),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 99/121 (82%), Gaps = 7/121 (6%)
 Frame = +2

Query  125  ETPDDDKDASQDQQENDEN-FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  301
            +TPDDD   ++ ++E DEN  QMKFRNYLP DK LQEGK+ PPVLPKF+DP+A L PP++
Sbjct  31   QTPDDD--GNKTKEEEDENDVQMKFRNYLPHDKQLQEGKVTPPVLPKFEDPIATLPPPEE  88

Query  302  KKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEE-KRRLAEDLGTN  478
            KKE   DPFLNI PKKPNWDLRRDVQK+LDKLEKR++KAL QL EEEE KR++AE+  T 
Sbjct  89   KKE---DPFLNIVPKKPNWDLRRDVQKKLDKLEKRTMKALTQLMEEEEKKRKIAEEEDTE  145

Query  479  S  481
            +
Sbjct  146  N  146



>ref|XP_006347381.1| PREDICTED: coiled-coil domain-containing protein 12-like [Solanum 
tuberosum]
Length=149

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 99/118 (84%), Gaps = 5/118 (4%)
 Frame = +2

Query  125  ETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDK  304
            +TPDDD + + +++E++ + QMKFRNYLP DK LQEGK+ PPVLPKF+DP+A L PP++K
Sbjct  31   QTPDDDGNKT-NEEEDENDVQMKFRNYLPHDKQLQEGKVTPPVLPKFEDPIATLPPPEEK  89

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEE-KRRLAEDLGT  475
            KE   DPFLNI PKKPNWDLRRDVQK+L+KLEKR++KAL QL EEEE KR++AE+  T
Sbjct  90   KE---DPFLNIVPKKPNWDLRRDVQKKLEKLEKRTMKALTQLMEEEEKKRKIAEEEDT  144



>gb|KDP45824.1| hypothetical protein JCGZ_17431 [Jatropha curcas]
Length=149

 Score =   147 bits (371),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 93/117 (79%), Gaps = 4/117 (3%)
 Frame = +2

Query  128  TPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKK  307
            TPDDDK  ++++   D N  MKFRNY+PQ K LQE KLAPPVLPKF+DP+A   PP + K
Sbjct  31   TPDDDKTNNENETSADNNPSMKFRNYVPQAKELQEAKLAPPVLPKFEDPVAAAPPPSETK  90

Query  308  EKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEK-RRLAEDLGT  475
            E   DPFLNIAPKKPNWDLRRDVQK+LDKLEKR+ KA+++L EE+EK ++L ED GT
Sbjct  91   E---DPFLNIAPKKPNWDLRRDVQKKLDKLEKRTQKAIYKLMEEQEKQKQLDEDGGT  144



>ref|XP_009777239.1| PREDICTED: coiled-coil domain-containing protein 12 [Nicotiana 
sylvestris]
Length=157

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 98/127 (77%), Gaps = 6/127 (5%)
 Frame = +2

Query  125  ETPDDD-KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  301
            ETPDD   + + ++ +++ + QMKFRNYLP DK LQEGK+APPVLPKF+DP+A L P ++
Sbjct  31   ETPDDAADNNNTNEDDDENDVQMKFRNYLPHDKQLQEGKVAPPVLPKFEDPIATLPPVEE  90

Query  302  KKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR--LAEDLGT  475
            KKE   DPFLNIAPKKPNWDLRRDVQK+LDKLEKR++KAL QL EEEEK+R    ED G 
Sbjct  91   KKE---DPFLNIAPKKPNWDLRRDVQKKLDKLEKRTMKALSQLMEEEEKKRKMAEEDAGN  147

Query  476  NS*DFKV  496
               D  V
Sbjct  148  GGDDMDV  154



>ref|XP_009608865.1| PREDICTED: coiled-coil domain-containing protein 12 [Nicotiana 
tomentosiformis]
Length=158

 Score =   143 bits (361),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 85/107 (79%), Gaps = 5/107 (5%)
 Frame = +2

Query  182  FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWD  361
             QMKFRNYLP DK LQEGK+APPVLPKF+DP+A L P ++KKE   DPFLNIAPKKPNWD
Sbjct  51   VQMKFRNYLPHDKQLQEGKVAPPVLPKFEDPIATLPPVEEKKE---DPFLNIAPKKPNWD  107

Query  362  LRRDVQKRLDKLEKRSLKALHQLGEEEEKRR--LAEDLGTNS*DFKV  496
            LRRDVQK+LDKLEKR++KAL QL EEEEK+R    ED G    D  V
Sbjct  108  LRRDVQKKLDKLEKRTMKALSQLMEEEEKKRKMAEEDAGNGGDDMDV  154



>ref|XP_010687588.1| PREDICTED: coiled-coil domain-containing protein 12 [Beta vulgaris 
subsp. vulgaris]
Length=153

 Score =   142 bits (358),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 91/126 (72%), Gaps = 11/126 (9%)
 Frame = +2

Query  125  ETPDDD----KDASQD---QQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN  283
            +TPDDD    K+ SQD       D N  +KFRNYLP DK LQEGKLA P LPKF+DP+A 
Sbjct  30   DTPDDDSSHPKNTSQDGDSANNGDSNLNLKFRNYLPHDKELQEGKLAAPNLPKFEDPIAT  89

Query  284  LTPPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAE  463
              PP++K    EDPFLNIAPKKPNWDLRRDVQK+LDKLEKR+ KALHQL  E EK+R  E
Sbjct  90   APPPEEK----EDPFLNIAPKKPNWDLRRDVQKKLDKLEKRTQKALHQLMLEHEKQRQLE  145

Query  464  DLGTNS  481
            D G  +
Sbjct  146  DGGIAA  151



>ref|XP_010093549.1| hypothetical protein L484_013982 [Morus notabilis]
 gb|EXB54256.1| hypothetical protein L484_013982 [Morus notabilis]
Length=153

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 94/120 (78%), Gaps = 10/120 (8%)
 Frame = +2

Query  128  TPDDDKDASQDQQENDE------NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  289
            TPD+D    +D++ ND       N  MKFRNY+P D+HLQEGK+APPVLPKF+DP+A + 
Sbjct  31   TPDEDSVQVEDKKNNDNDSREETNPNMKFRNYVPHDEHLQEGKVAPPVLPKFEDPVAAMP  90

Query  290  PPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR-LAED  466
            PP    EK EDPF+NIAPKKPNWDLRRDVQK+ DKLE+R+ KA+++L EE+EK++ LAED
Sbjct  91   PPS---EKEEDPFVNIAPKKPNWDLRRDVQKKFDKLERRTQKAIYKLMEEQEKQKELAED  147



>ref|XP_010322514.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Solanum lycopersicum]
Length=159

 Score =   140 bits (352),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 87/102 (85%), Gaps = 4/102 (4%)
 Frame = +2

Query  125  ETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDK  304
            +TPDDD + ++++ E++ + QMKFRNYLP DK LQEGK+ PPVLPKF+DP+A L PP++K
Sbjct  31   QTPDDDGNKTKEE-EDENDVQMKFRNYLPHDKQLQEGKVTPPVLPKFEDPIATLPPPEEK  89

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            K   EDPFLNI PKKPNWDLRRDVQK+LDKLEKR++KAL QL
Sbjct  90   K---EDPFLNIVPKKPNWDLRRDVQKKLDKLEKRTMKALTQL  128



>gb|AFK47380.1| unknown [Lotus japonicus]
Length=160

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 89/117 (76%), Gaps = 6/117 (5%)
 Frame = +2

Query  134  DDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEK  313
            +DD+D S   QE  EN  MKFRNY+P DKHLQEGKLAP VLPKF+DP+A   P   +   
Sbjct  46   NDDRDESP--QEEQENLSMKFRNYVPHDKHLQEGKLAPAVLPKFEDPVAASAP---EPHP  100

Query  314  NEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR-LAEDLGTNS  481
             EDPFLNIAPKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK++ LAE   TN 
Sbjct  101  QEDPFLNIAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQKELAEGDDTNG  157



>ref|XP_010248829.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Nelumbo nucifera]
Length=155

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +2

Query  128  TPDDDKDASQDQQENDEN--FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  301
            T  +DK   +D  E +EN    MKFRNYLP DK LQEGKLAPPVLPKF+DP+A   PP  
Sbjct  37   TQKEDKPEEEDADETNENKTLNMKFRNYLPHDKQLQEGKLAPPVLPKFEDPVATEPPP--  94

Query  302  KKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGT  475
              +K EDPF+NIAPKKPNWDLRRDVQKRL+KLE+R+ KA+ QL EE+ +++ AE+ G 
Sbjct  95   -SQKTEDPFVNIAPKKPNWDLRRDVQKRLEKLERRTQKAIFQLMEEDRQKQEAEENGA  151



>ref|XP_010248821.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Nelumbo nucifera]
Length=162

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 89/118 (75%), Gaps = 5/118 (4%)
 Frame = +2

Query  128  TPDDDKDASQDQQENDEN--FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  301
            T  +DK   +D  E +EN    MKFRNYLP DK LQEGKLAPPVLPKF+DP+A   PP  
Sbjct  44   TQKEDKPEEEDADETNENKTLNMKFRNYLPHDKQLQEGKLAPPVLPKFEDPVATEPPP--  101

Query  302  KKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGT  475
              +K EDPF+NIAPKKPNWDLRRDVQKRL+KLE+R+ KA+ QL EE+ +++ AE+ G 
Sbjct  102  -SQKTEDPFVNIAPKKPNWDLRRDVQKRLEKLERRTQKAIFQLMEEDRQKQEAEENGA  158



>ref|XP_010101177.1| hypothetical protein L484_005414 [Morus notabilis]
 gb|EXB87538.1| hypothetical protein L484_005414 [Morus notabilis]
Length=150

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 93/120 (78%), Gaps = 10/120 (8%)
 Frame = +2

Query  128  TPDDDKDASQDQQEND------ENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  289
            TPD+D    +D++ ND       N  MKFRNY+P D+HLQEGK+APPVLPKF+DP+A + 
Sbjct  31   TPDEDSVQVEDKKNNDNDSREETNPNMKFRNYVPHDEHLQEGKVAPPVLPKFEDPVAAMP  90

Query  290  PPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR-LAED  466
            PP  K+E   DPF+NIAPKKPNWDLRRDVQK+ DKLE+R+ KA+++L E +EK++ LAED
Sbjct  91   PPSGKEE---DPFVNIAPKKPNWDLRRDVQKKFDKLERRTQKAIYKLMEAQEKQKELAED  147



>ref|XP_009355920.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Pyrus x bretschneideri]
Length=153

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 9/126 (7%)
 Frame = +2

Query  128  TPDDDKDASQDQQ------ENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  289
            TPD+D     D         ++ N  MKFRNY+P DK LQEGKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQVHDNTNENNAISDETNTNMKFRNYVPHDKQLQEGKLVPPVLPKFEDPVAGVP  90

Query  290  PPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDL  469
            PP +KKE   DPF+NIAPKKPNW+LRRDVQKRLDKLEKR+ KA+ +L EE+EK++  +  
Sbjct  91   PPSEKKE---DPFVNIAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMEEQEKQKQLDGD  147

Query  470  GTNS*D  487
            G N  D
Sbjct  148  GRNGED  153



>ref|XP_008375067.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X1 [Malus domestica]
Length=153

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 9/126 (7%)
 Frame = +2

Query  128  TPDDDKDASQDQQ------ENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  289
            TPD+D     D         ++ N  MKFRNY+P DK LQEGKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQVHDNTNESNPISDETNTNMKFRNYVPHDKQLQEGKLVPPVLPKFEDPVAGVP  90

Query  290  PPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDL  469
            PP +KKE   DPF+NIAPKKPNW+LRRDVQKRLDKLEKR+ KA+ +L EE+EK++  +  
Sbjct  91   PPSEKKE---DPFVNIAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMEEQEKQKQLDGD  147

Query  470  GTNS*D  487
            G N  D
Sbjct  148  GRNGED  153



>ref|XP_002263858.1| PREDICTED: coiled-coil domain-containing protein 12 [Vitis vinifera]
 emb|CBI26410.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   135 bits (340),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 86/106 (81%), Gaps = 4/106 (4%)
 Frame = +2

Query  173  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            ++N  MKFRNYLP DK LQEGKLAPPVLPKF+DP+A   PP ++KE   DPF+NIAPKKP
Sbjct  47   EDNPSMKFRNYLPHDKELQEGKLAPPVLPKFEDPVAAAPPPSEEKE---DPFVNIAPKKP  103

Query  353  NWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTNS*D  487
            NWDLRRDVQK+LDKLE+R+ KA+ +L EE+EK  +LAED G  S D
Sbjct  104  NWDLRRDVQKKLDKLERRTQKAIFKLMEEQEKENQLAEDGGNVSED  149



>ref|XP_002305693.1| hypothetical protein POPTR_0004s06590g [Populus trichocarpa]
 gb|EEE86204.1| hypothetical protein POPTR_0004s06590g [Populus trichocarpa]
Length=154

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +2

Query  179  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNW  358
            N  MKFRNY+PQDK LQEGKLAPPVLPKF+DP+A   PP    EK EDPFLNIAPKKPNW
Sbjct  53   NPSMKFRNYVPQDKELQEGKLAPPVLPKFEDPVAAAPPPS---EKEEDPFLNIAPKKPNW  109

Query  359  DLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
            DLRRDVQ +LDKLE+R+ KA+++L EE+EK +   + G N 
Sbjct  110  DLRRDVQNKLDKLERRTQKAIYKLMEEQEKEKQLSENGGNG  150



>ref|XP_008240328.1| PREDICTED: coiled-coil domain-containing protein 12 [Prunus mume]
Length=151

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 91/121 (75%), Gaps = 6/121 (5%)
 Frame = +2

Query  128  TPDDDK---DASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQ  298
            TPD+D    D++ D+        MKFRNY+P DK LQEGKL PPVLPKF+DP+A + PP 
Sbjct  31   TPDEDSSLVDSNADEDNETSEETMKFRNYVPHDKKLQEGKLVPPVLPKFEDPVAAVPPPS  90

Query  299  DKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTN  478
            +KKE   DPF+NIAPKKPNW+LRRDVQK+LDKLE+R+ KA+ +L EE+EK++  ++ G N
Sbjct  91   EKKE---DPFVNIAPKKPNWELRRDVQKKLDKLERRTQKAMCKLMEEQEKQKQLDEDGRN  147

Query  479  S  481
             
Sbjct  148  G  148



>ref|XP_011035412.1| PREDICTED: coiled-coil domain-containing protein 12 [Populus 
euphratica]
Length=156

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 3/103 (3%)
 Frame = +2

Query  173  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            + N  MKFRNY+PQDK LQEGKLAPPVLPKF+DP+A   PP    +K EDPFLNIAPKKP
Sbjct  53   ESNPSMKFRNYVPQDKELQEGKLAPPVLPKFEDPVAAAPPPS---QKEEDPFLNIAPKKP  109

Query  353  NWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
            NWDLRRDVQ +LDKLE+R+ KA+++L EE+EK +   + G N 
Sbjct  110  NWDLRRDVQNKLDKLERRTQKAIYKLMEEQEKEKQLSENGGNG  152



>emb|CDP18672.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 80/103 (78%), Gaps = 3/103 (3%)
 Frame = +2

Query  179  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNW  358
            N  MKFRNYLP DK LQEG++APPVLPKF+DP+A   P Q+KKE   DPFLNIAPKKPNW
Sbjct  75   NVNMKFRNYLPHDKQLQEGRVAPPVLPKFEDPVAEAPPCQEKKE---DPFLNIAPKKPNW  131

Query  359  DLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS*D  487
            DL RDVQK+LDKLEKR+ KA+ QL  EEEKRR   + G +  D
Sbjct  132  DLWRDVQKKLDKLEKRTQKAMFQLMAEEEKRRRLSEEGADGED  174



>ref|XP_008375068.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X2 [Malus domestica]
Length=154

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 90/127 (71%), Gaps = 10/127 (8%)
 Frame = +2

Query  128  TPDDDKDASQDQQ------ENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  289
            TPD+D     D         ++ N  MKFRNY+P DK LQEGKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQVHDNTNESNPISDETNTNMKFRNYVPHDKQLQEGKLVPPVLPKFEDPVAGVP  90

Query  290  PPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL-GEEEEKRRLAED  466
            PP +KKE   DPF+NIAPKKPNW+LRRDVQKRLDKLEKR+ KA+ +L  EE+EK++  + 
Sbjct  91   PPSEKKE---DPFVNIAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMAEEQEKQKQLDG  147

Query  467  LGTNS*D  487
             G N  D
Sbjct  148  DGRNGED  154



>ref|XP_009355916.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009355917.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Pyrus x bretschneideri]
Length=154

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 90/127 (71%), Gaps = 10/127 (8%)
 Frame = +2

Query  128  TPDDDKDASQDQQ------ENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  289
            TPD+D     D         ++ N  MKFRNY+P DK LQEGKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQVHDNTNENNAISDETNTNMKFRNYVPHDKQLQEGKLVPPVLPKFEDPVAGVP  90

Query  290  PPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL-GEEEEKRRLAED  466
            PP +KKE   DPF+NIAPKKPNW+LRRDVQKRLDKLEKR+ KA+ +L  EE+EK++  + 
Sbjct  91   PPSEKKE---DPFVNIAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMAEEQEKQKQLDG  147

Query  467  LGTNS*D  487
             G N  D
Sbjct  148  DGRNGED  154



>ref|XP_010069536.1| PREDICTED: coiled-coil domain-containing protein 12 [Eucalyptus 
grandis]
 gb|KCW57912.1| hypothetical protein EUGRSUZ_H00657 [Eucalyptus grandis]
Length=162

 Score =   132 bits (333),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 85/104 (82%), Gaps = 5/104 (5%)
 Frame = +2

Query  173  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            +EN  MKFRNY+P DK LQEGK+APPVLPKF+DP+A   PP +KK    DPF+NIAPKKP
Sbjct  60   EENPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVATEPPPAEKK----DPFINIAPKKP  115

Query  353  NWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR-LAEDLGTNS  481
            NWDLRRDVQK+LDKLE+R+ KA++++ +E+EK++  AE+ G N 
Sbjct  116  NWDLRRDVQKKLDKLERRTQKAMYKIVQEQEKQKEKAEEDGENG  159



>ref|XP_008437152.1| PREDICTED: coiled-coil domain-containing protein 12 [Cucumis 
melo]
 ref|XP_008437160.1| PREDICTED: coiled-coil domain-containing protein 12 [Cucumis 
melo]
Length=153

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 5/108 (5%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  316
            +DK+       ++ N  MKFRNY+P DK LQEGKLAPPVLPKF+DP+    PPQ K    
Sbjct  40   EDKENGATADTDETNLNMKFRNYVPHDKELQEGKLAPPVLPKFEDPVTT-EPPQQK----  94

Query  317  EDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  460
            EDPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KAL++L EE+EK++ A
Sbjct  95   EDPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKALYKLMEEQEKQKQA  142



>ref|XP_011086938.1| PREDICTED: coiled-coil domain-containing protein 12 [Sesamum 
indicum]
Length=171

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 75/92 (82%), Gaps = 3/92 (3%)
 Frame = +2

Query  179  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNW  358
            N  MKFRNYLP DK LQEGKLAPPVLPKF+DP+    PP++KKE   DPFLNIAPKKPNW
Sbjct  71   NVHMKFRNYLPHDKQLQEGKLAPPVLPKFEDPVLAAPPPEEKKE---DPFLNIAPKKPNW  127

Query  359  DLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
            DLRRDVQKRLDKLE+R+ K++  L E EE RR
Sbjct  128  DLRRDVQKRLDKLERRTQKSMLILMEREEARR  159



>ref|XP_004137537.1| PREDICTED: coiled-coil domain-containing protein 12-like [Cucumis 
sativus]
 ref|XP_004164500.1| PREDICTED: coiled-coil domain-containing protein 12-like [Cucumis 
sativus]
Length=153

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 5/108 (5%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  316
            +DK+    +  ++ N  MKFRNY+P DK LQEGKLAPPVLPKF+DP+ +  PPQ K    
Sbjct  40   EDKENGATEDSDETNLNMKFRNYVPHDKELQEGKLAPPVLPKFEDPVTS-EPPQLK----  94

Query  317  EDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  460
            EDPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KAL +L EE+EK++ A
Sbjct  95   EDPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKALFKLMEEQEKQKQA  142



>ref|XP_010546632.1| PREDICTED: coiled-coil domain-containing protein 12 [Tarenaya 
hassleriana]
Length=144

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  316
            ++K+  +D    + N  MKFRNY+PQDKHLQEGKLAPP LPKF+DP+A+  P  +KK   
Sbjct  30   ENKENEEDDAGEESNPTMKFRNYVPQDKHLQEGKLAPPELPKFEDPVASTLPVAEKK---  86

Query  317  EDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEK  448
            EDP +NIAPKKPNWDLRRDVQK+LDKLE+R+ KA+ +L EE EK
Sbjct  87   EDPLVNIAPKKPNWDLRRDVQKKLDKLERRTQKAMFKLMEEAEK  130



>gb|KGN64223.1| hypothetical protein Csa_1G043260 [Cucumis sativus]
Length=194

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 5/108 (5%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  316
            +DK+    +  ++ N  MKFRNY+P DK LQEGKLAPPVLPKF+DP+ +  PPQ K    
Sbjct  81   EDKENGATEDSDETNLNMKFRNYVPHDKELQEGKLAPPVLPKFEDPVTS-EPPQLK----  135

Query  317  EDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  460
            EDPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KAL +L EE+EK++ A
Sbjct  136  EDPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKALFKLMEEQEKQKQA  183



>ref|NP_566245.1| uncharacterized protein  [Arabidopsis thaliana]
 gb|AAF27013.1|AC009177_3 unknown protein [Arabidopsis thaliana]
 gb|AAM62522.1| unknown [Arabidopsis thaliana]
 gb|AAO44023.1| At3g05070 [Arabidopsis thaliana]
 dbj|BAE99439.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74182.1| uncharacterized protein AT3G05070 [Arabidopsis thaliana]
Length=144

 Score =   129 bits (324),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 87/115 (76%), Gaps = 4/115 (3%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  316
            + K+  +D+   ++   MKFRNY+PQ K LQ+GKLAPP LPKF+DP+  L P  +KKE  
Sbjct  30   ETKEDGEDEAVEEDGPAMKFRNYVPQAKELQDGKLAPPELPKFEDPIVALPPAVEKKE--  87

Query  317  EDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEK-RRLAEDLGTN  478
             DPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA+H+L EE+EK R +AE  G  
Sbjct  88   -DPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAMHKLMEEQEKEREMAEADGNT  141



>ref|XP_008393522.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X2 [Malus domestica]
Length=154

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 90/127 (71%), Gaps = 10/127 (8%)
 Frame = +2

Query  128  TPDDDKDASQDQQ------ENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  289
            TPD+D   + D         ++ N  MKFRNY+P DK LQ GKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQAHDNTNENNAISDEANANMKFRNYVPHDKQLQGGKLVPPVLPKFEDPVAAVP  90

Query  290  PPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL-GEEEEKRRLAED  466
            P  +KKE   DPF+NIAPKKPNW+LRRDVQKRLDKLEKR+ KA+ +L GE+E++++L  D
Sbjct  91   PLSEKKE---DPFVNIAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMGEQEKQKQLDRD  147

Query  467  LGTNS*D  487
             G    D
Sbjct  148  GGNGGED  154



>gb|KJB60515.1| hypothetical protein B456_009G312100 [Gossypium raimondii]
Length=151

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 7/120 (6%)
 Frame = +2

Query  128  TPDDDKDASQDQQENDENFQ----MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  295
             PD+D   + + Q +D N +    MKFRNY+P DK LQEGK+APPVLPKF+DP+A   P 
Sbjct  31   APDEDSSQAAENQTDDTNEENNPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVAAAPPA  90

Query  296  QDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGT  475
             ++KE   DPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA+ +L E++E+ +  ++ G 
Sbjct  91   SEEKE---DPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAIFKLMEQQEQEKQLDEGGN  147



>ref|XP_008393521.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X1 [Malus domestica]
Length=155

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 90/128 (70%), Gaps = 11/128 (9%)
 Frame = +2

Query  128  TPDDDKDASQDQQ------ENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  289
            TPD+D   + D         ++ N  MKFRNY+P DK LQ GKL PPVLPKF+DP+A + 
Sbjct  31   TPDEDSAQAHDNTNENNAISDEANANMKFRNYVPHDKQLQGGKLVPPVLPKFEDPVAAVP  90

Query  290  PPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL--GEEEEKRRLAE  463
            P  +KKE   DPF+NIAPKKPNW+LRRDVQKRLDKLEKR+ KA+ +L  GE+E++++L  
Sbjct  91   PLSEKKE---DPFVNIAPKKPNWELRRDVQKRLDKLEKRTQKAMLKLMAGEQEKQKQLDR  147

Query  464  DLGTNS*D  487
            D G    D
Sbjct  148  DGGNGGED  155



>ref|XP_004495490.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X1 [Cicer arietinum]
 ref|XP_004495491.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X2 [Cicer arietinum]
Length=168

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 82/99 (83%), Gaps = 2/99 (2%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNY+P DKHLQEGKLAP VLPKF+DP++ +  P+ + +  EDPFLNIAPKKPNWDLR
Sbjct  68   MKFRNYVPHDKHLQEGKLAPAVLPKFEDPVS-VPEPEPETQPKEDPFLNIAPKKPNWDLR  126

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTNS  481
            RDVQK+LDKLEKR+ KAL+QL  E+EK+ +LAE   TN 
Sbjct  127  RDVQKKLDKLEKRTQKALYQLMVEQEKQNQLAEGDDTNG  165



>gb|KHG26990.1| Coiled-coil domain-containing 12 [Gossypium arboreum]
Length=151

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 89/121 (74%), Gaps = 7/121 (6%)
 Frame = +2

Query  128  TPDDDKDASQDQQENDENFQ----MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  295
             PD+D   + + Q +D N +    MKFRNY+P DK LQEGK+APPVLPKF+DP+A   P 
Sbjct  31   APDEDSSQASENQTDDTNEENNPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVAAEPPA  90

Query  296  QDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGT  475
             ++KE   DPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA+ +L E++E+ +  ++ G 
Sbjct  91   SEEKE---DPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAIFKLMEQQEQEKQLDEGGN  147

Query  476  N  478
             
Sbjct  148  T  148



>gb|EYU17804.1| hypothetical protein MIMGU_mgv1a015162mg [Erythranthe guttata]
 gb|EYU17805.1| hypothetical protein MIMGU_mgv1a015162mg [Erythranthe guttata]
Length=166

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 76/95 (80%), Gaps = 2/95 (2%)
 Frame = +2

Query  182  FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWD  361
              MKFRNYLP DK LQEGKLAPPVLPKF+DP   + PP D  E  EDPFLNIAPKKPNWD
Sbjct  66   VNMKFRNYLPHDKELQEGKLAPPVLPKFEDPAFAIPPPVD--ENKEDPFLNIAPKKPNWD  123

Query  362  LRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAED  466
            LRRDVQKRLDKL++R+ KA+  L E+EE +R +E+
Sbjct  124  LRRDVQKRLDKLDRRTQKAMLTLMEQEEAKRNSEE  158



>ref|NP_001236672.1| uncharacterized protein LOC100527227 [Glycine max]
 gb|ACU16280.1| unknown [Glycine max]
 gb|KHN05004.1| Coiled-coil domain-containing protein 12 [Glycine soja]
Length=152

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 3/100 (3%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDL  364
            +MKFRNY+P DK+LQEGKLAP VLPKF+DP+  + PP+   E  EDPFLNIAPKKPNWDL
Sbjct  52   EMKFRNYVPHDKNLQEGKLAPAVLPKFEDPVDAVPPPE--PEAAEDPFLNIAPKKPNWDL  109

Query  365  RRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTNS  481
            RRDVQK+LDKLEKR+ KAL+QL  E+EK+ +L E   TN 
Sbjct  110  RRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLTEGDDTNG  149



>ref|XP_007009901.1| Cwf18 isoform 1 [Theobroma cacao]
 gb|EOY18711.1| Cwf18 isoform 1 [Theobroma cacao]
Length=151

 Score =   127 bits (319),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 89/121 (74%), Gaps = 7/121 (6%)
 Frame = +2

Query  128  TPDDDK-DASQDQQ-ENDE--NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  295
            TPD+D   A++D+  E DE  N  MKFRNY+P D  LQEGK+APPVLPKF+DP+    PP
Sbjct  31   TPDEDSAQAAEDKTNETDEENNRSMKFRNYVPHDIQLQEGKVAPPVLPKFEDPVEVAPPP  90

Query  296  QDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGT  475
                E  EDPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA++ L E++E+ +   + G 
Sbjct  91   ---SEDQEDPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAIYILMEQQEQEKQLAEGGN  147

Query  476  N  478
            N
Sbjct  148  N  148



>ref|XP_009396161.1| PREDICTED: coiled-coil domain-containing protein 12 [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 87/117 (74%), Gaps = 7/117 (6%)
 Frame = +2

Query  128  TPDDD--KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANL-TPPQ  298
            TPD++  K  S+ +   DE   MKFRNYLP DK LQEGK+AP  LPKF+DP+A    PP 
Sbjct  86   TPDEEAAKHDSKTEDSEDEMPSMKFRNYLPHDKQLQEGKVAPATLPKFEDPVAAAPLPP-  144

Query  299  DKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDL  469
               EK EDPFLNIAPKKPNWDLRRDVQK+LDKLE+R+ KAL++L +E+EK   A D+
Sbjct  145  ---EKIEDPFLNIAPKKPNWDLRRDVQKKLDKLERRTQKALYKLMQEQEKETEAMDI  198



>gb|ACJ86026.1| unknown [Medicago truncatula]
Length=169

 Score =   127 bits (319),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 90/117 (77%), Gaps = 4/117 (3%)
 Frame = +2

Query  134  DDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEK  313
            DDD+   +   E +E   MKFRNY+P DK+LQEGKLAP VLPKF+DP++    P+ K++ 
Sbjct  53   DDDEQREEKDGEGEEKLSMKFRNYVPHDKNLQEGKLAPAVLPKFEDPVSV---PEPKEKP  109

Query  314  NEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTNS  481
             EDPFLNIAPKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK+ +LAE   TN 
Sbjct  110  KEDPFLNIAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLAEGDDTNG  166



>ref|XP_006408114.1| hypothetical protein EUTSA_v10021722mg [Eutrema salsugineum]
 gb|ESQ49567.1| hypothetical protein EUTSA_v10021722mg [Eutrema salsugineum]
Length=141

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 83/110 (75%), Gaps = 5/110 (5%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED  322
            K+  QD    ++   MKFRNY+PQDK LQ+GK+APP LPKF+DP+A L P  +KKE   D
Sbjct  32   KEDGQDDAVEEDGPAMKFRNYVPQDKELQDGKVAPPELPKFEDPIAALAPAVEKKE---D  88

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLG  472
            PF+NIAPKKPNWDLRRDVQK+LDKLE+R+  A+ +L   +EKR +AE  G
Sbjct  89   PFVNIAPKKPNWDLRRDVQKKLDKLERRTQAAMSKLT--QEKREMAEADG  136



>ref|XP_002882392.1| hypothetical protein ARALYDRAFT_477790 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58651.1| hypothetical protein ARALYDRAFT_477790 [Arabidopsis lyrata subsp. 
lyrata]
Length=144

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED  322
            K+  +D+   ++   MKFRNY+PQ K LQ+GKLAPP LPKF+DP+  L P  +KKE   D
Sbjct  32   KEDGEDEAVEEDGPAMKFRNYVPQAKELQDGKLAPPELPKFEDPILALPPAVEKKE---D  88

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
            PF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA+++L EE EK R   +   N+
Sbjct  89   PFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMEEHEKERETAEADGNT  141



>gb|KEH42882.1| cwf18 pre-mRNA splicing factor [Medicago truncatula]
Length=169

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 4/117 (3%)
 Frame = +2

Query  134  DDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEK  313
            DDD+   +   E +E   MKFRNY+P DK+LQEGKLAP VLPKF+DP++    P+ +++ 
Sbjct  53   DDDEQQEEKDGEGEEKLSMKFRNYVPHDKNLQEGKLAPAVLPKFEDPVSV---PEPEEKP  109

Query  314  NEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTNS  481
             EDPFLNIAPKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK+ +LAE   TN 
Sbjct  110  KEDPFLNIAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLAEGDDTNG  166



>ref|XP_006441474.1| hypothetical protein CICLE_v10022597mg [Citrus clementina]
 gb|ESR54714.1| hypothetical protein CICLE_v10022597mg [Citrus clementina]
Length=164

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = +2

Query  179  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNW  358
            N  MKFRNY+P DK LQEGK+ PP LPKF+DP+A   PPQ   EK EDPF+NIAPKKPNW
Sbjct  63   NLSMKFRNYVPHDKQLQEGKVTPPELPKFEDPVA-AAPPQS--EKKEDPFVNIAPKKPNW  119

Query  359  DLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  460
            DLRRDVQK+LDKLE+R+ KA+  L +++EK +L 
Sbjct  120  DLRRDVQKKLDKLERRTQKAMFTLMQQQEKEKLT  153



>gb|KDO55952.1| hypothetical protein CISIN_1g031113mg [Citrus sinensis]
Length=165

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 75/94 (80%), Gaps = 3/94 (3%)
 Frame = +2

Query  179  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNW  358
            N  MKFRNY+P DK LQEGK+ PP LPKF+DP+A   PPQ   EK EDPF+NIAPKKPNW
Sbjct  64   NLSMKFRNYVPHDKQLQEGKVTPPELPKFEDPVA-AAPPQS--EKKEDPFVNIAPKKPNW  120

Query  359  DLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  460
            DLRRDVQK+LDKLE+R+ KA+  L +++EK +L 
Sbjct  121  DLRRDVQKKLDKLERRTQKAMFTLMQQQEKEKLT  154



>gb|KJB60517.1| hypothetical protein B456_009G312100 [Gossypium raimondii]
Length=164

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 80/105 (76%), Gaps = 7/105 (7%)
 Frame = +2

Query  128  TPDDDKDASQDQQENDENFQ----MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  295
             PD+D   + + Q +D N +    MKFRNY+P DK LQEGK+APPVLPKF+DP+A   P 
Sbjct  31   APDEDSSQAAENQTDDTNEENNPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVAAAPPA  90

Query  296  QDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             ++KE   DPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA+ +L
Sbjct  91   SEEKE---DPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAIFKL  132



>ref|XP_006478141.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X1 [Citrus sinensis]
Length=165

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 3/94 (3%)
 Frame = +2

Query  179  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNW  358
            N  MKFRNY+P DK LQEGK+ PP LPKF+DP+A   PPQ   EK EDPF+NIAPKKPNW
Sbjct  64   NLSMKFRNYVPHDKQLQEGKVTPPELPKFEDPVA-AAPPQS--EKKEDPFVNIAPKKPNW  120

Query  359  DLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  460
            DLRRDVQK+LDKLE R+ KA+  L +++EK +L 
Sbjct  121  DLRRDVQKKLDKLESRTQKAMFTLMQQQEKEKLT  154



>ref|XP_002519582.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42793.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 72/84 (86%), Gaps = 3/84 (4%)
 Frame = +2

Query  179  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNW  358
            N  MKFRNY+PQDK LQEGKLAP VLPKF+DP+A   PP +KKE   DPFLNIAPKKPNW
Sbjct  64   NPSMKFRNYVPQDKELQEGKLAPAVLPKFEDPVAAAPPPSEKKE---DPFLNIAPKKPNW  120

Query  359  DLRRDVQKRLDKLEKRSLKALHQL  430
            DLRRDVQK+LDKLE+R+ KA+++L
Sbjct  121  DLRRDVQKKLDKLERRTQKAIYKL  144



>gb|KJB60516.1| hypothetical protein B456_009G312100 [Gossypium raimondii]
Length=165

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 80/105 (76%), Gaps = 7/105 (7%)
 Frame = +2

Query  128  TPDDDKDASQDQQENDENFQ----MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  295
             PD+D   + + Q +D N +    MKFRNY+P DK LQEGK+APPVLPKF+DP+A   P 
Sbjct  31   APDEDSSQAAENQTDDTNEENNPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVAAAPPA  90

Query  296  QDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             ++KE   DPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA+ +L
Sbjct  91   SEEKE---DPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAIFKL  132



>emb|CDY27800.1| BnaA05g32090D [Brassica napus]
Length=147

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 3/89 (3%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNY+PQ K LQ+ K+ PP LPKF+DP+A L P     EKNEDPF+NIAPKKPNWDLR
Sbjct  50   MKFRNYVPQAKELQDSKVVPPELPKFEDPVAALPPAV---EKNEDPFVNIAPKKPNWDLR  106

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
            RDVQK+LDKLE+R+ KA+++L EE EK R
Sbjct  107  RDVQKKLDKLERRTQKAMYKLMEEHEKER  135



>gb|KFK23537.1| hypothetical protein AALP_AAs63573U000100 [Arabis alpina]
Length=156

 Score =   124 bits (311),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 4/118 (3%)
 Frame = +2

Query  122  HETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  301
             E  +  +D   D  E ++  +MKFRNY+PQ K LQ+GK+ PP LPKF+DP+A L P  +
Sbjct  37   QELSESKEDGEDDAVEQEDGPEMKFRNYVPQAKELQDGKVVPPELPKFEDPIAALPPVVE  96

Query  302  KKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEK-RRLAEDLG  472
            KKE   DPF+NIAPKKPNWDLRRDVQK+LDKLE+++ KA+ +L EE EK R +AE  G
Sbjct  97   KKE---DPFVNIAPKKPNWDLRRDVQKKLDKLERKTQKAMFKLMEEHEKEREMAEADG  151



>ref|XP_010102099.1| ATP-dependent RNA helicase dhx8 [Morus notabilis]
 gb|EXB92318.1| ATP-dependent RNA helicase dhx8 [Morus notabilis]
Length=941

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 85/110 (77%), Gaps = 9/110 (8%)
 Frame = +2

Query  128  TPDDDKDASQDQQEND------ENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLT  289
            TPD+D    +D++ ND       N  MKFRNY+P D+HLQEGK+APPV+PKF+DP+A + 
Sbjct  467  TPDEDSVQVEDKKNNDNDSREETNPNMKFRNYVPHDEHLQEGKVAPPVVPKFEDPVAAMP  526

Query  290  PPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEE  439
            PP    EK EDPF+NIAPKKPNWDLRRDVQK+ DKLE+R+ KA+++L +E
Sbjct  527  PP---SEKEEDPFVNIAPKKPNWDLRRDVQKKFDKLERRTHKAIYKLMDE  573



>ref|XP_010422930.1| PREDICTED: coiled-coil domain-containing protein 12-like [Camelina 
sativa]
Length=144

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 84/115 (73%), Gaps = 3/115 (3%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  316
            D K+  +D+   ++   MKFRNY+PQ K LQ+GK+APP LP+F+DP+  L P  +KKE  
Sbjct  30   DTKEDGEDEAVEEDGPAMKFRNYVPQAKELQDGKVAPPELPQFEDPIVALPPAVEKKE--  87

Query  317  EDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
             DPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA+++L  E EK R   +   N+
Sbjct  88   -DPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMAEHEKEREITEADGNT  141



>ref|XP_007009902.1| Cwf18 isoform 2, partial [Theobroma cacao]
 gb|EOY18712.1| Cwf18 isoform 2, partial [Theobroma cacao]
Length=145

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 88/113 (78%), Gaps = 5/113 (4%)
 Frame = +2

Query  128  TPDDDK-DASQDQQ-ENDE--NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPP  295
            TPD+D   A++D+  E DE  N  MKFRNY+P D  LQEGK+APPVLPKF+DP+  + PP
Sbjct  31   TPDEDSAQAAEDKTNETDEENNRSMKFRNYVPHDIQLQEGKVAPPVLPKFEDPV-EVAPP  89

Query  296  QDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
              + ++  DPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA++ L E++E+ +
Sbjct  90   PSEDQEVLDPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAIYILMEQQEQEK  142



>gb|KCW57911.1| hypothetical protein EUGRSUZ_H00657 [Eucalyptus grandis]
Length=162

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 4/84 (5%)
 Frame = +2

Query  173  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            +EN  MKFRNY+P DK LQEGK+APPVLPKF+DP+A   PP +KK    DPF+NIAPKKP
Sbjct  60   EENPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVATEPPPAEKK----DPFINIAPKKP  115

Query  353  NWDLRRDVQKRLDKLEKRSLKALH  424
            NWDLRRDVQK+LDKLE+R+ KA++
Sbjct  116  NWDLRRDVQKKLDKLERRTQKAMY  139



>gb|KCW57913.1| hypothetical protein EUGRSUZ_H00657 [Eucalyptus grandis]
Length=147

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 4/83 (5%)
 Frame = +2

Query  173  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            +EN  MKFRNY+P DK LQEGK+APPVLPKF+DP+A   PP +KK    DPF+NIAPKKP
Sbjct  60   EENPSMKFRNYVPHDKQLQEGKVAPPVLPKFEDPVATEPPPAEKK----DPFINIAPKKP  115

Query  353  NWDLRRDVQKRLDKLEKRSLKAL  421
            NWDLRRDVQK+LDKLE+R+ KA+
Sbjct  116  NWDLRRDVQKKLDKLERRTQKAI  138



>emb|CDY41931.1| BnaC05g46730D [Brassica napus]
Length=147

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 3/89 (3%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNY+PQ K LQ+ K+ PP LPKF+DP+A L P  +KKE   DPF+NIAPKKPNWDLR
Sbjct  50   MKFRNYVPQAKELQDSKVVPPELPKFEDPVAALPPAVEKKE---DPFVNIAPKKPNWDLR  106

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
            RDVQK+LDKLE+R+ KA+++L EE EK R
Sbjct  107  RDVQKKLDKLERRTQKAMYKLMEEHEKER  135



>ref|XP_009147281.1| PREDICTED: coiled-coil domain-containing protein 12 [Brassica 
rapa]
Length=147

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 3/89 (3%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNY+PQ K LQ+ K+ PP LPKF+DP+A L P  +KKE   DPF+NIAPKKPNWDLR
Sbjct  50   MKFRNYVPQAKELQDSKVVPPELPKFEDPVAALPPAVEKKE---DPFVNIAPKKPNWDLR  106

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
            RDVQK+LDKLE+R+ KA+++L EE EK R
Sbjct  107  RDVQKKLDKLERRTQKAMYKLMEEHEKER  135



>gb|ADE77638.1| unknown [Picea sitchensis]
Length=151

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 3/108 (3%)
 Frame = +2

Query  131  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKE  310
            P  +      ++E DE   MKFRNYLP+DKHLQ+ ++APP +PKFDDP+A  T P     
Sbjct  30   PQQETKTQPQEEEQDEKQDMKFRNYLPRDKHLQQNRVAPPTIPKFDDPVA--TAP-SATN  86

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
              EDP ++IAPKKPNWDLRRDVQK+LDKLE+R+ +A+ +L  EEE+RR
Sbjct  87   GTEDPIISIAPKKPNWDLRRDVQKKLDKLERRTQRAIIELMHEEERRR  134



>ref|XP_004299453.1| PREDICTED: coiled-coil domain-containing protein 12 [Fragaria 
vesca subsp. vesca]
Length=162

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 86/119 (72%), Gaps = 12/119 (10%)
 Frame = +2

Query  125  ETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDK  304
            E PD+D D      EN  N  MKFRNY+P DK LQE KL PP   KF++P+A + PP   
Sbjct  53   EAPDNDVD------ENSTN--MKFRNYVPHDKKLQEAKLEPPKPSKFEEPVAAVAPPS--  102

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
             EK EDPF+NIAPKKPNW+LRRDVQK+LDKLE+R+ KA+ +L E+E++++L E+ G N 
Sbjct  103  -EKTEDPFVNIAPKKPNWELRRDVQKKLDKLERRTQKAMCKLMEQEKQKQLEEE-GING  159



>ref|XP_010485909.1| PREDICTED: coiled-coil domain-containing protein 12-like [Camelina 
sativa]
Length=144

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNY+PQ K LQ+GKLAPP LP+F+DP+  L    +KKE   DPF+NIAPKKPNWDLR
Sbjct  47   MKFRNYVPQAKELQDGKLAPPELPQFEDPIVALPAAVEKKE---DPFVNIAPKKPNWDLR  103

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
            RDVQK+LDKLE+R+ KA+++L  E EK R
Sbjct  104  RDVQKKLDKLERRTQKAMYKLMAEHEKER  132



>ref|XP_010464015.1| PREDICTED: coiled-coil domain-containing protein 12-like [Camelina 
sativa]
 ref|XP_010464016.1| PREDICTED: coiled-coil domain-containing protein 12-like [Camelina 
sativa]
Length=144

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 80/106 (75%), Gaps = 3/106 (3%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  316
            + K+  +D+   ++   MKFRNY+PQ K LQ+GK+APP LP+F+DP+  L    +KKE  
Sbjct  30   ETKEDGEDEAVEEDGPAMKFRNYVPQAKELQDGKVAPPELPQFEDPIVALPAAVEKKE--  87

Query  317  EDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
             DPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA+++L  E EK R
Sbjct  88   -DPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMAEHEKER  132



>gb|KDO55954.1| hypothetical protein CISIN_1g031113mg [Citrus sinensis]
Length=148

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 3/84 (4%)
 Frame = +2

Query  179  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNW  358
            N  MKFRNY+P DK LQEGK+ PP LPKF+DP+A   PPQ   EK EDPF+NIAPKKPNW
Sbjct  64   NLSMKFRNYVPHDKQLQEGKVTPPELPKFEDPVA-AAPPQS--EKKEDPFVNIAPKKPNW  120

Query  359  DLRRDVQKRLDKLEKRSLKALHQL  430
            DLRRDVQK+LDKLE+R+ KA+  L
Sbjct  121  DLRRDVQKKLDKLERRTQKAMFTL  144



>ref|XP_010935583.1| PREDICTED: coiled-coil domain-containing protein 12 [Elaeis guineensis]
 ref|XP_010935584.1| PREDICTED: coiled-coil domain-containing protein 12 [Elaeis guineensis]
Length=209

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 3/85 (4%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNYLP DK LQEGK+AP VLPKF+DP+A +       EK EDPF+NIAPKKPNWDLR
Sbjct  112  MKFRNYLPHDKQLQEGKVAPAVLPKFEDPVAAVP---SAPEKIEDPFVNIAPKKPNWDLR  168

Query  368  RDVQKRLDKLEKRSLKALHQLGEEE  442
            RDVQK+LDKLE+R+ KA++QL +E+
Sbjct  169  RDVQKKLDKLERRTQKAIYQLMQEQ  193



>ref|XP_010108874.1| putative ATP-dependent RNA helicase DHX35 [Morus notabilis]
 gb|EXC20514.1| putative ATP-dependent RNA helicase DHX35 [Morus notabilis]
Length=672

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 73/85 (86%), Gaps = 3/85 (4%)
 Frame = +2

Query  176  ENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPN  355
            +N  MKFRNY+P D+HLQEGK+APPVLPKF+DP+A + PP    EK EDPF+NIAPKKPN
Sbjct  547  QNPNMKFRNYVPHDEHLQEGKVAPPVLPKFEDPVAAMPPPS---EKEEDPFVNIAPKKPN  603

Query  356  WDLRRDVQKRLDKLEKRSLKALHQL  430
            WDLRRDVQK+ DKLE+R+ KA+++L
Sbjct  604  WDLRRDVQKKFDKLERRTQKAIYKL  628



>ref|XP_006478142.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X2 [Citrus sinensis]
Length=148

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 67/84 (80%), Gaps = 3/84 (4%)
 Frame = +2

Query  179  NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNW  358
            N  MKFRNY+P DK LQEGK+ PP LPKF+DP+A   PPQ   EK EDPF+NIAPKKPNW
Sbjct  64   NLSMKFRNYVPHDKQLQEGKVTPPELPKFEDPVA-AAPPQS--EKKEDPFVNIAPKKPNW  120

Query  359  DLRRDVQKRLDKLEKRSLKALHQL  430
            DLRRDVQK+LDKLE R+ KA+  L
Sbjct  121  DLRRDVQKKLDKLESRTQKAMFTL  144



>ref|XP_007208967.1| hypothetical protein PRUPE_ppb020505mg, partial [Prunus persica]
 gb|EMJ10166.1| hypothetical protein PRUPE_ppb020505mg, partial [Prunus persica]
Length=232

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNY+P DK LQEGKL PPVLPKF+DP+A +  P +KKE   DPF+NIAPKKPNW+LR
Sbjct  109  MKFRNYVPHDKKLQEGKLVPPVLPKFEDPVAAVPSPSEKKE---DPFVNIAPKKPNWELR  165

Query  368  RDVQKRLDKLEKRSLKALHQL  430
            RDVQK+LDKLE+R+ KA+ +L
Sbjct  166  RDVQKKLDKLERRTQKAMCKL  186



>ref|NP_001238051.1| uncharacterized protein LOC100306131 [Glycine max]
 gb|ACU14163.1| unknown [Glycine max]
Length=152

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 90/118 (76%), Gaps = 5/118 (4%)
 Frame = +2

Query  131  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKE  310
            P+ +KD   D +E+ E  +MKFRNY+P DK+LQEGKLAP VLPKF+DP+ ++     K E
Sbjct  36   PNGNKD--DDNEEDQEPQEMKFRNYVPHDKNLQEGKLAPAVLPKFEDPVDDVP--PPKPE  91

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTNS  481
              EDPFLNIAPKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK+ +L E   TN 
Sbjct  92   AKEDPFLNIAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLTEGDDTNG  149



>ref|XP_006300259.1| hypothetical protein CARUB_v10016498mg [Capsella rubella]
 gb|EOA33157.1| hypothetical protein CARUB_v10016498mg [Capsella rubella]
Length=145

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 3/81 (4%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNY+PQ K LQ+GK+APP LPKF+DP+  L P  +KKE   DPF+NIAPKKPNWDLR
Sbjct  47   MKFRNYVPQAKELQDGKVAPPELPKFEDPIVALPPAVEKKE---DPFVNIAPKKPNWDLR  103

Query  368  RDVQKRLDKLEKRSLKALHQL  430
            RDVQK+LDKLE+R+ KA+++L
Sbjct  104  RDVQKKLDKLERRTQKAMYKL  124



>gb|EPS62441.1| hypothetical protein M569_12350, partial [Genlisea aurea]
Length=131

 Score =   115 bits (289),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +2

Query  140  DKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNE  319
            D++++    +   +  M+FRNY+P DK LQEGKL P VLPKF+DP      P   +E  E
Sbjct  34   DENSTNGNADGLPDINMRFRNYIPHDKQLQEGKLVPHVLPKFEDPPQLAAAPASSEETKE  93

Query  320  DPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            DPFL IAPKKPNWDLRRDVQKR+DKL++R+ KALH+L
Sbjct  94   DPFLRIAPKKPNWDLRRDVQKRIDKLDRRTQKALHKL  130



>gb|KHN14750.1| Coiled-coil domain-containing protein 12 [Glycine soja]
Length=152

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 5/118 (4%)
 Frame = +2

Query  131  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKE  310
            P+ +KD   D +E+ E  +MKFRNY+P DK+LQEGKLAP VLPKF+DP+ ++     + E
Sbjct  36   PNGNKD--DDNEEDQEPQEMKFRNYVPHDKNLQEGKLAPAVLPKFEDPVDDVP--PPEPE  91

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKR-RLAEDLGTNS  481
              EDPFLNIAPKKPNWDLRRDVQK+LDKLEKR+ KAL+QL  E+EK+ +L E   TN 
Sbjct  92   AKEDPFLNIAPKKPNWDLRRDVQKKLDKLEKRTQKALYQLMVEQEKQNQLTEGDDTNG  149



>ref|XP_008802780.1| PREDICTED: coiled-coil domain-containing protein 12 [Phoenix 
dactylifera]
Length=209

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 78/99 (79%), Gaps = 5/99 (5%)
 Frame = +2

Query  152  SQDQQENDENF--QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDP  325
            ++D +EN+E+    MKFRNYLP DK LQEGKL P VLPKF+DP A +       EK EDP
Sbjct  98   AEDSEENEEDKMPNMKFRNYLPHDKQLQEGKLTPAVLPKFEDPAAAVP---PPPEKIEDP  154

Query  326  FLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEE  442
            F+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA++QL +E+
Sbjct  155  FVNIAPKKPNWDLRRDVQKKLDKLERRTQKAIYQLMQEQ  193



>ref|XP_007161569.1| hypothetical protein PHAVU_001G080600g [Phaseolus vulgaris]
 gb|ESW33563.1| hypothetical protein PHAVU_001G080600g [Phaseolus vulgaris]
Length=147

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 4/99 (4%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNY+P DK+LQEGKLAP VLPKF+DP+        + +  EDPFLNIAPKKPNWDLR
Sbjct  49   MKFRNYVPHDKNLQEGKLAPAVLPKFEDPVDVPP---PEPQVQEDPFLNIAPKKPNWDLR  105

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEK-RRLAEDLGTNS  481
            RDVQK+ DKLEKR+ KAL+QL  E+EK ++L E   TN 
Sbjct  106  RDVQKKFDKLEKRTQKALYQLMVEQEKQKQLTEGDDTNG  144



>ref|XP_009134809.1| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing 
protein 12-like [Brassica rapa]
Length=140

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 10/89 (11%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNY+PQDK LQ+G        KF+DP+A L P  +KKE   DPF+NIAPKKPNWDLR
Sbjct  50   MKFRNYVPQDKELQDGX-------KFEDPVAALPPAVEKKE---DPFVNIAPKKPNWDLR  99

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
            RDVQK+LDKLE+R+ KA+++L EE EK R
Sbjct  100  RDVQKKLDKLERRTQKAMYKLMEEHEKER  128



>ref|XP_006848659.1| hypothetical protein AMTR_s00171p00065800 [Amborella trichopoda]
 gb|ERN10240.1| hypothetical protein AMTR_s00171p00065800 [Amborella trichopoda]
Length=156

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNYLP DKHLQE KLAPP  PKF+DP+A   P     EK EDPF+NIAPKKPNWDL+
Sbjct  57   MKFRNYLPHDKHLQESKLAPPPPPKFEDPVA---PEPPVSEKPEDPFVNIAPKKPNWDLQ  113

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  460
            RDVQ +L KLEKR+ KA+ +L +E++K RLA
Sbjct  114  RDVQSKLKKLEKRTQKAMFELMQEQDKERLA  144



>ref|XP_006644463.1| PREDICTED: coiled-coil domain-containing protein 12-like [Oryza 
brachyantha]
Length=175

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = +2

Query  128  TPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKK  307
            TP +D +   D   +D+   MKFRNYLP D+ L+ GKLAP  LP F+DP++  T    + 
Sbjct  62   TPSEDSNKVND---DDDIPAMKFRNYLPHDEQLRGGKLAPVSLPNFEDPISAETA---EP  115

Query  308  EKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS*D  487
            ++ EDPF NIAPK PNWDL+RDVQKR+DKLEKR+ KAL ++  E+++ + A + G+++ D
Sbjct  116  KQLEDPFGNIAPKNPNWDLKRDVQKRIDKLEKRTQKALAEIAVEQQREKEALEEGSDAQD  175



>gb|EEC81357.1| hypothetical protein OsI_24550 [Oryza sativa Indica Group]
Length=182

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = +2

Query  146  DASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDP  325
            D S++ Q + +   MKFRNYLP D+ L+ GK+AP  LPKF+DP++  T    + ++ E+P
Sbjct  71   DESEEVQNDGDMPAMKFRNYLPHDEQLRGGKVAPVSLPKFEDPISAET---TEPKQVENP  127

Query  326  FLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
            F NIAPK PNWDL+RDVQKR+DKLEKR+ KAL ++  E++K + A   G+++
Sbjct  128  FGNIAPKNPNWDLKRDVQKRMDKLEKRTQKALAEIALEQQKEKEALGEGSDA  179



>ref|NP_001058658.1| Os06g0730800 [Oryza sativa Japonica Group]
 dbj|BAD62127.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD62486.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20572.1| Os06g0730800 [Oryza sativa Japonica Group]
 dbj|BAG92558.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66403.1| hypothetical protein OsJ_22745 [Oryza sativa Japonica Group]
Length=182

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = +2

Query  146  DASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDP  325
            D S++ Q + +   MKFRNYLP D+ L+ GK+AP  LPKF+DP++  T    + ++ E+P
Sbjct  71   DESEEVQNDGDMPAMKFRNYLPHDEQLRGGKVAPVSLPKFEDPISAET---TEPKQVENP  127

Query  326  FLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
            F NIAPK PNWDL+RDVQKR+DKLEKR+ KAL ++  E++K + A   G+++
Sbjct  128  FGNIAPKNPNWDLKRDVQKRMDKLEKRTQKALAEIALEQQKEKEALGEGSDA  179



>gb|EMS53919.1| hypothetical protein TRIUR3_06239 [Triticum urartu]
Length=170

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 83/120 (69%), Gaps = 7/120 (6%)
 Frame = +2

Query  122  HETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQD  301
            H +P  + D ++D  E      +KFRNYLP D+ L+ GK+AP  LPKF+DP   +T    
Sbjct  55   HVSPTKESDEAEDNGE----VPLKFRNYLPHDERLRGGKVAPLSLPKFEDP---ITADAA  107

Query  302  KKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
            + ++ E+PF NIAPK PNWDL+RDVQKR+DKLEKR+ KAL ++  E++K + A + G+++
Sbjct  108  EPKQLENPFGNIAPKNPNWDLKRDVQKRIDKLEKRTQKALAEIALEQQKEKEALEEGSDA  167



>dbj|BAJ90654.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=184

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 78/110 (71%), Gaps = 7/110 (6%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN--EDPFL  331
            D+ E++    +KFRNYLP D+ L+ GK+AP  LPKF+DP+A      D  E    E+PF 
Sbjct  77   DEAEDNGEVPLKFRNYLPHDERLRGGKVAPLSLPKFEDPIA-----ADAAEPKQLENPFG  131

Query  332  NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
            NIAPK PNWDL+RDVQKR+DKLEKR+ K+L ++  E++K + A + G+++
Sbjct  132  NIAPKNPNWDLKRDVQKRIDKLEKRTQKSLAEIALEQQKEKEALEEGSDA  181



>ref|XP_006656528.1| PREDICTED: coiled-coil domain-containing protein 12-like [Oryza 
brachyantha]
Length=177

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 75/100 (75%), Gaps = 3/100 (3%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNYLP D+ L+ GKLAP  LP F+DP++  T    + ++ EDPF NIAPK PNWDL+
Sbjct  81   MKFRNYLPHDEQLRGGKLAPVSLPNFEDPISAETA---EPKQLEDPFGNIAPKNPNWDLK  137

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS*D  487
            RDVQKR+DKLEKR+ KAL ++ + +++ + A + G+++ D
Sbjct  138  RDVQKRIDKLEKRTQKALAEIADIQQREKEALEEGSDAQD  177



>gb|EMT31131.1| hypothetical protein F775_07814 [Aegilops tauschii]
Length=149

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 78/110 (71%), Gaps = 7/110 (6%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN--EDPFL  331
            D+ E++    +KFRNYLP D+ L+ GK+AP  LPKF+DP+A      D  E    E+PF 
Sbjct  42   DEVEDNGEVPLKFRNYLPHDERLRGGKVAPLSLPKFEDPIA-----ADAAEPKQLENPFG  96

Query  332  NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
            NIAPK PNWDL+RDVQKR+DKLEKR+ KAL ++  +++K + A + G+++
Sbjct  97   NIAPKNPNWDLKRDVQKRIDKLEKRTQKALAEIALDQQKEKEALEEGSDA  146



>ref|XP_004966558.1| PREDICTED: coiled-coil domain-containing protein 12-like [Setaria 
italica]
Length=176

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 73/100 (73%), Gaps = 5/100 (5%)
 Frame = +2

Query  164  QENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPM-ANLTPPQDKKEKNEDPFLNIA  340
            Q++ E   MKFRNYLP D+ L+ GKLAP  LPKF+DP+ A    P+    + E+PF NIA
Sbjct  75   QDDGELPAMKFRNYLPHDEQLRGGKLAPVSLPKFEDPISAEAAEPK----QVENPFGNIA  130

Query  341  PKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  460
            PK PNWDL+RDVQKR+DKLEKR+ KAL ++  E+++ + A
Sbjct  131  PKNPNWDLKRDVQKRIDKLEKRTQKALAEIALEQQREKEA  170



>ref|XP_003563215.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Brachypodium distachyon]
Length=182

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 7/110 (6%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN--EDPFL  331
            D+ E++    +KFRNYLP D+ L+ GK+AP  LPKF+DP+A      D  E    E+PF 
Sbjct  77   DELEDNGEIPLKFRNYLPHDERLRGGKVAPLSLPKFEDPIA-----ADAAEPKQLENPFG  131

Query  332  NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTNS  481
            NIAPK PNWDL+RDVQKR+DKLEKR  KAL ++  E++K + A + G+++
Sbjct  132  NIAPKNPNWDLKRDVQKRVDKLEKRMQKALAEIALEQQKEKEALEEGSDA  181



>ref|XP_002437648.1| hypothetical protein SORBIDRAFT_10g031190 [Sorghum bicolor]
 gb|EER89015.1| hypothetical protein SORBIDRAFT_10g031190 [Sorghum bicolor]
Length=178

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNYLP D+ L+ GKLAP  LPKF+DP++  T    + ++ E+PF NIAPK PNWDL+
Sbjct  85   MKFRNYLPHDEQLRGGKLAPVSLPKFEDPISAETA---EPKEVENPFGNIAPKNPNWDLK  141

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  460
            R VQKR+DKLE+R+ KAL ++  E+++ + A
Sbjct  142  RHVQKRIDKLERRTQKALAEIALEQQREKEA  172



>ref|XP_006372638.1| hypothetical protein POPTR_0017s03480g [Populus trichocarpa]
 gb|ERP50435.1| hypothetical protein POPTR_0017s03480g [Populus trichocarpa]
Length=78

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 62/97 (64%), Gaps = 23/97 (24%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNY+PQDK   EGKLAPP                       DPFLNIAPKKPNWDLR
Sbjct  1    MKFRNYVPQDKEFHEGKLAPP-----------------------DPFLNIAPKKPNWDLR  37

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTN  478
            RDVQK+ DKLE+R+LKA+ +L EE+EK +   + G N
Sbjct  38   RDVQKKHDKLERRTLKAICKLMEEQEKEKQVVENGGN  74



>ref|NP_001141270.1| hypothetical protein [Zea mays]
 gb|ACF85922.1| unknown [Zea mays]
 gb|AFW69647.1| hypothetical protein ZEAMMB73_159078 [Zea mays]
Length=178

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            MKFRNYLP D+ L+ GKLAP  LPKF+DP++  T    + ++ E+ F NIAPK PNWDL+
Sbjct  85   MKFRNYLPHDEQLRGGKLAPVSLPKFEDPISAETA---EPKEVENLFGNIAPKNPNWDLK  141

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRRLA  460
            RDVQKR+DKLE+R+ KAL ++  E+++ + A
Sbjct  142  RDVQKRIDKLERRTQKALAEIALEQQREKEA  172



>ref|XP_002984337.1| hypothetical protein SELMODRAFT_445863 [Selaginella moellendorffii]
 gb|EFJ14387.1| hypothetical protein SELMODRAFT_445863 [Selaginella moellendorffii]
Length=153

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 77/118 (65%), Gaps = 15/118 (13%)
 Frame = +2

Query  140  DKDASQDQQEND-ENFQ--------MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTP  292
            D D  Q+   N  EN Q        ++FRNYLP+D+ LQ+ K  PPVLPKF+DP+A  T 
Sbjct  36   DGDGEQEVDANGKENLQEEKADLPPIRFRNYLPRDEELQKLKREPPVLPKFEDPVAVPTD  95

Query  293  PQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL--GEEEEKRRLA  460
              +     EDP L+IAPKK NWDLRRD  K+L+KLEKR+ +A+ +L  GE+E +++L 
Sbjct  96   TSNA----EDPMLSIAPKKANWDLRRDATKKLEKLEKRTTRAIIELMAGEKENRKKLG  149



>ref|XP_010239286.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Brachypodium distachyon]
Length=189

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 67/96 (70%), Gaps = 7/96 (7%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN--EDPFL  331
            D+ E++    +KFRNYLP D+ L+ GK+AP  LPKF+DP+A      D  E    E+PF 
Sbjct  77   DELEDNGEIPLKFRNYLPHDERLRGGKVAPLSLPKFEDPIA-----ADAAEPKQLENPFG  131

Query  332  NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEE  439
            NIAPK PNWDL+RDVQKR+DKLEKR  KAL ++  E
Sbjct  132  NIAPKNPNWDLKRDVQKRVDKLEKRMQKALAEIACE  167



>ref|XP_001780929.1| predicted protein [Physcomitrella patens]
 gb|EDQ54267.1| predicted protein, partial [Physcomitrella patens]
Length=81

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            +KFRNY P+D  LQ+ K APPV+PKF+DP+A   P Q      EDP ++IAPKKPNWDLR
Sbjct  1    IKFRNYFPRDSDLQKAKHAPPVIPKFEDPVAT-DPLQ--VAGGEDPIVSIAPKKPNWDLR  57

Query  368  RDVQKRLDKLEKRSLKALHQL  430
            RDV K+L+KLE+R+ +A+ +L
Sbjct  58   RDVAKKLEKLERRTHRAIVEL  78



>ref|XP_002972762.1| hypothetical protein SELMODRAFT_413348 [Selaginella moellendorffii]
 gb|EFJ25983.1| hypothetical protein SELMODRAFT_413348 [Selaginella moellendorffii]
Length=142

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 13/106 (12%)
 Frame = +2

Query  140  DKDASQDQQEND-ENFQ--------MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTP  292
            D D  Q+   N  EN Q        ++FRNYLP+D+ LQ+ K  PPVLPKF+DP+A  T 
Sbjct  36   DGDGEQEVDANGKENLQEEKADLPPIRFRNYLPRDEELQKLKREPPVLPKFEDPVAVPTD  95

Query  293  PQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
              +     EDP L+IAPKK NWDLRRD  K+L+KLEKR+ +A+ +L
Sbjct  96   TSNA----EDPMLSIAPKKANWDLRRDATKKLEKLEKRTTRAIIEL  137



>ref|XP_011461976.1| PREDICTED: coiled-coil domain-containing protein 12-like [Fragaria 
vesca subsp. vesca]
Length=147

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 65/98 (66%), Gaps = 5/98 (5%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHL---QEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPF  328
            D+     N  +KFRNY P+DK L   QEGKL      KFDDP+  + P     EK +D F
Sbjct  48   DEVSEGTNTSVKFRNYFPRDKKLIKEQEGKLESGPTSKFDDPIGAVVP--SPLEKKKDSF  105

Query  329  LNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEE  442
             ++ P+ P+++L+RDVQKRLDKLE+R+LKAL ++ E+E
Sbjct  106  KDLVPRPPHFELQRDVQKRLDKLERRTLKALCKIMEQE  143



>emb|CDX74154.1| BnaA03g28930D [Brassica napus]
Length=115

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +2

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
            K EDPF+NIAPKKPNWDLRRDVQK+LDKLE+R+ KA+++L EE EK R
Sbjct  56   KKEDPFVNIAPKKPNWDLRRDVQKKLDKLERRTQKAMYKLMEEHEKER  103



>ref|XP_005647392.1| hypothetical protein COCSUDRAFT_16114 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22848.1| hypothetical protein COCSUDRAFT_16114 [Coccomyxa subellipsoidea 
C-169]
Length=131

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 67/112 (60%), Gaps = 6/112 (5%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKN  316
            D  + S    + DE   +KFRNY  +D  ++   +     P++ +P+     P+    + 
Sbjct  23   DATEPSTSAAQGDEPV-LKFRNYAVKDNRIEHQTIEAAQAPEYQEPV-----PEPSIVQE  76

Query  317  EDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLG  472
             D  LN+ PKK NWDLRRDV+K+L KLE+R+ +AL QL +E+++ +LA+D G
Sbjct  77   GDVLLNVVPKKANWDLRRDVEKKLAKLERRTQRALVQLMQEQQREQLAQDGG  128



>gb|KIZ00598.1| Coiled-coil domain-containing protein 12 [Monoraphidium neglectum]
Length=141

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 64/91 (70%), Gaps = 4/91 (4%)
 Frame = +2

Query  161  QQENDENFQMKFRNYLPQD-KHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNI  337
            +Q+  E   +KFRNY+ +D KH++  ++AP  +PK ++P+    P +D  E  E+   ++
Sbjct  37   EQQEPEKPVLKFRNYVVKDSKHIEHEQVAPAQVPKAEEPVVEQRP-EDAGE--EELLASV  93

Query  338  APKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            APKK NWDL+R+VQ +LDKLE+R+L+AL ++
Sbjct  94   APKKANWDLKREVQPKLDKLERRTLRALVEI  124



>ref|XP_004365664.1| hypothetical protein CAOG_00793 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89293.1| hypothetical protein CAOG_000793 [Capsaspora owczarzaki ATCC 
30864]
Length=197

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = +2

Query  140  DKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNE  319
            D+ ++ D   ND +  ++FRNY P D  L   ++  P LP+ +  +A +    D +  + 
Sbjct  83   DESSAMDDGSNDADTTLRFRNYTPNDAKLANAQIEHPDLPEPEKDVAEIAKA-DARIHDI  141

Query  320  DPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            D  +N+AP+K NWDL+RDV K+L+KLE+R+ +A+ +L
Sbjct  142  D-LVNLAPRKQNWDLKRDVTKKLEKLERRTNRAIAEL  177



>ref|XP_002947930.1| hypothetical protein VOLCADRAFT_116633 [Volvox carteri f. nagariensis]
 gb|EFJ50918.1| hypothetical protein VOLCADRAFT_116633 [Volvox carteri f. nagariensis]
Length=139

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 64/102 (63%), Gaps = 7/102 (7%)
 Frame = +2

Query  137  DDKDASQDQQEND---ENFQMKFRNYLPQD-KHLQEGKLAPPVLPKFDDPMANLTPPQDK  304
            D+ DASQ     +   E   +KFRNY  QD K +   ++A    PKF +P+   T P+D 
Sbjct  24   DEADASQQHDTAEPEPEKPVLKFRNYAVQDTKRIDHERVAAAQPPKFQEPVVE-TKPEDL  82

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +  E+  +NIAPKK NWDL+RDVQ +LDKLE+R+ +A+ ++
Sbjct  83   PQ--EELLVNIAPKKANWDLKRDVQPKLDKLERRTQRAILEM  122



>ref|XP_009067757.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Acanthisitta chloris]
Length=133

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 72/114 (63%), Gaps = 10/114 (9%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFL  331
            QD++E  ++ ++K RNY P+D+ L++ KL P      +D + + L   + +   +E    
Sbjct  14   QDEEEPIKHKEIKLRNYEPEDEELKKRKLPPAKPASVEDTVKDQLEAAKPEPIIDEVDLA  73

Query  332  NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  74   NLAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LAAAVGS  124



>ref|XP_004342218.1| cwf18 pre-mRNA splicing factor protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20108.1| cwf18 pre-mRNA splicing factor protein [Acanthamoeba castellanii 
str. Neff]
Length=184

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = +2

Query  170  NDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKK  349
            N    ++KFRNY+P+D  L+E ++ P  LP     + N      +  + ED  L +APKK
Sbjct  69   NPHEGRLKFRNYVPRDNLLRELRIEPAPLPSMVGEI-NRKLIMMEGRRGED-LLALAPKK  126

Query  350  PNWDLRRDVQKRLDKLEKRSLKAL  421
            PNWDL+RD++++LD LEKR+ +A+
Sbjct  127  PNWDLKRDIERKLDALEKRTQRAI  150



>ref|XP_001422700.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01017.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=126

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 53/99 (54%), Gaps = 7/99 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN------LTPPQDK  304
            + A    +E     ++ FRNY+P+D  L   KL     P  D   A       +T   + 
Sbjct  13   RAADATSREGRATREIAFRNYVPRDGALAAAKLPATTAPALDVAAARDGDEGAVTLGLEP  72

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKAL  421
               + DP + +AP++ NWDL+RDV+ RL+KLE+R+ +AL
Sbjct  73   NVGDVDPGM-VAPRRANWDLKRDVEARLEKLERRTRRAL  110



>ref|XP_011418659.1| PREDICTED: coiled-coil domain-containing protein 12-like [Crassostrea 
gigas]
 gb|EKC22753.1| Coiled-coil domain-containing protein 12 [Crassostrea gigas]
Length=155

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +2

Query  194  FRNYLPQDKHLQEGKLAPPVLPK--FDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            FR+Y P+D+ LQE KL P V P    D   ++L    ++    E   +N+AP+KP+WDL+
Sbjct  44   FRSYKPKDESLQESKL-PQVKPSDVTDKIKSHLEAATEEMSIEEVDLINLAPRKPDWDLK  102

Query  368  RDVQKRLDKLEKRSLKALHQLGEE  439
            RDV K+L+KLE+R+ +A+ +L  E
Sbjct  103  RDVAKKLEKLERRTQRAIAELIRE  126



>ref|XP_010020082.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Nestor notabilis]
Length=134

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 71/117 (61%), Gaps = 18/117 (15%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKKEKNED  322
            D++E  ++ ++K RNY P+D+ L++ K+ PP  P     K  D +    P    +E +  
Sbjct  16   DEEETVKHKELKLRNYDPEDEELKKRKM-PPAKPASVEDKVKDQLEAAKPEPIIEEVD--  72

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  73   -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125



>ref|XP_009878822.1| PREDICTED: coiled-coil domain-containing protein 12 [Charadrius 
vociferus]
Length=164

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 70/116 (60%), Gaps = 16/116 (14%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLA----PPVLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+      PV  K  D +    P    +E +   
Sbjct  46   DEEETAKHKELKLRNYEPEDEELKKRKVPQAKPAPVEDKVKDQLEAAKPEPIIEEVD---  102

Query  326  FLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
              N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  103  LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  155



>ref|XP_008120605.1| PREDICTED: coiled-coil domain-containing protein 12 [Anolis carolinensis]
Length=195

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 61/96 (64%), Gaps = 9/96 (9%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKKEKNED  322
            +++E  ++ ++K RNY P+D+ L+ G++ PP  P     K  D +    P    +E +  
Sbjct  77   EEEEAPKHKELKLRNYTPEDEELK-GRIVPPAKPASVEDKVKDQLEAAKPEPIIEEVD--  133

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  134  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  168



>gb|KFP75017.1| Coiled-coil domain-containing protein 12, partial [Acanthisitta 
chloris]
Length=111

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (63%), Gaps = 10/104 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ KL P      +D + + L   + +   +E    N+AP+KP+WD
Sbjct  2    EIKLRNYEPEDEELKKRKLPPAKPASVEDTVKDQLEAAKPEPIIDEVDLANLAPRKPDWD  61

Query  362  LRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            L+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  62   LKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LAAAVGS  102



>ref|XP_010171939.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Caprimulgus carolinensis]
Length=110

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 65/109 (60%), Gaps = 20/109 (18%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLA----PPVLPKFDDPM--ANLTPPQDKKEKNEDPFLNIAPK  346
            ++K RNY P+D+ L++ K+      PV  K  D +  A L P  D     E    N+AP+
Sbjct  1    ELKLRNYEPEDEELKKRKMPKAKPAPVEDKVKDQLEAAKLEPIID-----EVDLANLAPR  55

Query  347  KPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  56   KPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  101



>ref|XP_006171088.1| PREDICTED: coiled-coil domain-containing protein 86 isoform X3 
[Tupaia chinensis]
Length=158

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 64/100 (64%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   ++QQE +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E
Sbjct  42   KQLREEQQEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEE  101

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  102  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>gb|KFU93677.1| Coiled-coil domain-containing protein 12, partial [Chaetura pelagica]
Length=135

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 70/117 (60%), Gaps = 18/117 (15%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKKEKNED  322
            D++E  ++ ++K RNY P+D+ L++ K+ PP  P        D +    P    +E +  
Sbjct  17   DEEETVKHKELKLRNYDPEDEELKKRKV-PPAKPVSVEEAVKDQLEAAKPQPIIEEVD--  73

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  74   -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  126



>ref|XP_007509692.1| unknown protein [Bathycoccus prasinos]
 emb|CCO18807.1| unknown protein [Bathycoccus prasinos]
Length=143

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 61/106 (58%), Gaps = 18/106 (17%)
 Frame = +2

Query  170  NDE--NFQMKFRNYLPQD-KHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNE-------  319
            NDE  N  +K RNY+P+D   L+   +   +LP       N   P+ K++K E       
Sbjct  43   NDEETNVTIKLRNYVPKDISALKSTSVGVQILP-------NAVAPEFKRKKEEENGNTPD  95

Query  320  DPFLNI-APKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
            D  L+    KK NWDL+RDV ++ +KLE+R+++A+ +L  EEE++R
Sbjct  96   DTILHSNGTKKQNWDLKRDVARKTEKLERRTIRAIAELAREEEEKR  141



>ref|XP_010001356.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Chaetura pelagica]
Length=134

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 70/117 (60%), Gaps = 18/117 (15%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKKEKNED  322
            D++E  ++ ++K RNY P+D+ L++ K+ PP  P        D +    P    +E +  
Sbjct  16   DEEETVKHKELKLRNYDPEDEELKKRKV-PPAKPVSVEEAVKDQLEAAKPQPIIEEVD--  72

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  73   -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125



>ref|XP_005934857.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X2 [Haplochromis burtoni]
Length=163

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 73/123 (59%), Gaps = 16/123 (13%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  304
            + K A+ ++   +++ ++K RNY P+D+ L+E ++  A P  V  K  D +    P    
Sbjct  38   ESKKATLEEATQEKHRELKLRNYAPEDEELKERQVPKAKPASVEDKVKDQLEAANPEPII  97

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAED  466
            +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE   LAE 
Sbjct  98   EEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGHEEE---LAEA  151

Query  467  LGT  475
            +G 
Sbjct  152  VGA  154



>ref|NP_001158518.1| Coiled-coil domain-containing protein 12 [Oncorhynchus mykiss]
 gb|ACO07622.1| Coiled-coil domain-containing protein 12 [Oncorhynchus mykiss]
Length=165

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 74/127 (58%), Gaps = 13/127 (10%)
 Frame = +2

Query  131  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQ  298
            PD  +D ++++ E + + ++K RNY P+D+ L+E ++  A PV    K  + +    P  
Sbjct  37   PDRKRDRAEEEAEEERHRELKLRNYTPEDEELKERQVPKAKPVSVEEKVKEQLDAAKPES  96

Query  299  DKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLA  460
              KE +     N+AP+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE   + 
Sbjct  97   VIKEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRDRLKGSEEELAGVV  153

Query  461  EDLGTNS  481
              +G  +
Sbjct  154  GAIGVTA  160



>emb|CDJ44745.1| hypothetical protein, conserved [Eimeria tenella]
Length=162

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 61/99 (62%), Gaps = 1/99 (1%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDL  364
            +++FRNY+P+D  L++  L  P + + +  +A       +  K ED    + P++PNWDL
Sbjct  19   EIRFRNYVPKDPKLRQFCLPRPSVEELEKQIAKEAQEAVQAAKEEDILSQVVPRRPNWDL  78

Query  365  RRDVQKRLDKLEKRSLKALHQLGEEE-EKRRLAEDLGTN  478
            +RDV++++  L +R+ KA+ QL  E+ E+ + A++L + 
Sbjct  79   KRDVERKITILSRRTDKAIVQLIREKIEQNKKAKELAST  117



>ref|XP_003206961.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Meleagris gallopavo]
Length=175

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 70/113 (62%), Gaps = 10/113 (9%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLN  334
            +++EN  + ++  RNY P+D+ L++ KL P      +D + + L   + +   +E    N
Sbjct  57   EEEENVRHREIILRNYDPEDEELKKRKLPPAKPASVEDKVKDQLEAAKPETIIDEVDLTN  116

Query  335  IAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            +AP+KP+WDL+RDV K+++KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  117  LAPRKPDWDLKRDVAKKMEKLEKRTQRAIAELIRERLKGQEEE---LAAAVGS  166



>ref|NP_001003589.1| coiled-coil domain-containing protein 12 [Danio rerio]
 gb|AAH78268.1| Coiled-coil domain containing 12 [Danio rerio]
Length=163

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 10/118 (8%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNE  319
            K A +D +  D + ++K RNY P+D  L+E ++        DD + + L     +    E
Sbjct  40   KRALEDTETEDRHRELKLRNYTPEDVELKERQVPKAKPASVDDKVKDQLEAANPEPVIEE  99

Query  320  DPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
                N+AP+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE   LA  +G 
Sbjct  100  VDLANLAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRERLKGSEEE---LAGAVGA  154



>gb|ELV09682.1| Coiled-coil domain-containing protein 12 [Tupaia chinensis]
Length=184

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 64/100 (64%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   ++QQE +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E
Sbjct  42   KQLREEQQEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEE  101

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  102  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_009705483.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Cariama cristata]
Length=134

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 71/116 (61%), Gaps = 16/116 (14%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P    +E +   
Sbjct  16   DEEETVKHKELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKPEPIIEEVD---  72

Query  326  FLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
              N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  73   LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125



>ref|XP_010393056.1| PREDICTED: coiled-coil domain-containing protein 12 [Corvus cornix 
cornix]
Length=139

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMA-NLTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ KL P      +D +   L   + +   +E    N+AP+KP+WD
Sbjct  30   EIKLRNYDPEDEELKKRKLPPGKPASVEDTVKEQLEAAKPEPIIDEVDLANLAPRKPDWD  89

Query  362  LRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            L+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  90   LKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  130



>emb|CDI84055.1| hypothetical protein, conserved [Eimeria acervulina]
Length=159

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +2

Query  191  KFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLRR  370
            +FRNY+P+D+ L++  L  P + + +  +A       +  K+ED    + P++PNWDL+R
Sbjct  18   RFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDILSQVVPRRPNWDLKR  77

Query  371  DVQKRLDKLEKRSLKALHQLGEE  439
            DV++++  L +R+ KA+ QL  E
Sbjct  78   DVERKIAILSRRTDKAIIQLIRE  100



>ref|XP_008921036.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Manacus vitellinus]
Length=175

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 70/116 (60%), Gaps = 14/116 (12%)
 Frame = +2

Query  161  QQENDE----NFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMA-NLTPPQDKKEKNEDP  325
            +QE DE    + ++K RNY P+D+ L++ KL P      +D +   L   + +   +E  
Sbjct  54   RQEEDEEPVKHKEIKLRNYEPEDEELKKRKLPPGKPASVEDTVKEQLEAAKPEPIIDEVD  113

Query  326  FLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
              N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  114  LANLAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  166



>ref|XP_008641363.1| PREDICTED: coiled-coil domain-containing protein 12 [Corvus brachyrhynchos]
Length=163

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMA-NLTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ KL P      +D +   L   + +   +E    N+AP+KP+WD
Sbjct  54   EIKLRNYDPEDEELKKRKLPPGKPASVEDTVKEQLEAAKPEPIIDEVDLANLAPRKPDWD  113

Query  362  LRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            L+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  114  LKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  154



>ref|XP_005023364.1| PREDICTED: coiled-coil domain-containing protein 12 [Anas platyrhynchos]
Length=139

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 69/113 (61%), Gaps = 10/113 (9%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMA-NLTPPQDKKEKNEDPFLN  334
            D++E   + ++K RNY P+D+ L++ K+ P      +D +   L   + +   +E    N
Sbjct  21   DEEETVRHKEIKLRNYDPEDEELKKRKVPPAKPASVEDVVKEQLEAAKPEPIIDEVDLAN  80

Query  335  IAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            +AP+KP+WDL+RDV K+L+KL+KR+ +A+ +L      G+EEE   LA  +G+
Sbjct  81   LAPRKPDWDLKRDVAKKLEKLDKRTQRAIAELIRERLKGQEEE---LASAVGS  130



>ref|XP_009936630.1| PREDICTED: coiled-coil domain-containing protein 12 [Opisthocomus 
hoazin]
Length=148

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLN  334
            D++E  ++ +++ RNY P+D+ L++ K+    L   +D + + L   + +   +E    N
Sbjct  30   DEEETVKHKELRLRNYEPEDEELKKRKVPQARLASVEDTVKDQLEAAKPEPIIDEVDLAN  89

Query  335  IAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            +AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  90   LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAEL  121



>ref|XP_005144041.1| PREDICTED: coiled-coil domain-containing protein 12 [Melopsittacus 
undulatus]
Length=214

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 66/105 (63%), Gaps = 10/105 (10%)
 Frame = +2

Query  182  FQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKKPNW  358
            +++K RNY P+D+ L++ K+ P      +D + + L   + +   +E    N+AP+KP+W
Sbjct  104  WELKLRNYDPEDEELKKRKMPPAKPASVEDKVKDQLEAAKPEPIIDEVDLANLAPRKPDW  163

Query  359  DLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            DL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  164  DLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  205



>ref|XP_008321553.1| PREDICTED: coiled-coil domain-containing protein 12 [Cynoglossus 
semilaevis]
Length=163

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 71/123 (58%), Gaps = 16/123 (13%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  304
            + K AS ++     + ++K RNY P+D+ L+E ++  A P  V  K  D +  + P    
Sbjct  38   ESKKASLEEASEGRHRELKLRNYTPEDEELKERQVPKAKPASVEDKVKDQLEAVNPEPII  97

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAED  466
            +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE   LA  
Sbjct  98   EEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEEE---LAGA  151

Query  467  LGT  475
            +G 
Sbjct  152  VGA  154



>ref|XP_001697076.1| hypothetical protein CHLREDRAFT_184951 [Chlamydomonas reinhardtii]
 gb|EDP00768.1| hypothetical protein CHLREDRAFT_184951 [Chlamydomonas reinhardtii]
Length=134

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = +2

Query  188  MKFRNYLPQD-KHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDL  364
            +KFRNY  QD K +   ++     PKF+ P  + T P+D  +  E+  +NIAPKK NWDL
Sbjct  39   LKFRNYAVQDTKRIDYEQVEAAQPPKFEAPKVD-TKPEDLPQ--EELLVNIAPKKANWDL  95

Query  365  RRDVQKRLDKLEKRSLKAL  421
            +RDVQ +LDKLE+R+ +A+
Sbjct  96   KRDVQPKLDKLERRTQRAM  114



>ref|XP_009279299.1| PREDICTED: coiled-coil domain-containing protein 12 [Aptenodytes 
forsteri]
 ref|XP_009331541.1| PREDICTED: coiled-coil domain-containing protein 12 [Pygoscelis 
adeliae]
Length=135

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%), Gaps = 28/122 (23%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P         +P
Sbjct  17   DEEETVKHKELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKP---------EP  67

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDL  469
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +
Sbjct  68   IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAV  124

Query  470  GT  475
            G+
Sbjct  125  GS  126



>ref|XP_009926465.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Haliaeetus albicilla]
 ref|XP_010560173.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Haliaeetus leucocephalus]
Length=135

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%), Gaps = 28/122 (23%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P         +P
Sbjct  17   DEEETVKHKELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKP---------EP  67

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDL  469
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +
Sbjct  68   IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAV  124

Query  470  GT  475
            G+
Sbjct  125  GS  126



>ref|XP_009573010.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Fulmarus glacialis]
Length=134

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%), Gaps = 28/122 (23%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P         +P
Sbjct  16   DEEETVKHKELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKP---------EP  66

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDL  469
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +
Sbjct  67   IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAV  123

Query  470  GT  475
            G+
Sbjct  124  GS  125



>gb|EPB87798.1| hypothetical protein HMPREF1544_05458 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=159

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 63/103 (61%), Gaps = 8/103 (8%)
 Frame = +2

Query  146  DASQDQQENDENFQ-MKFRNYLPQDKHLQE-------GKLAPPVLPKFDDPMANLTPPQD  301
            +A+Q+ + +DE  + +KFR+Y P D+ LQ+         +   +  +  D          
Sbjct  22   NAAQNDRTSDEAEKALKFRSYTPNDEKLQQHVDIAKPTDIGNTLETETKDFTKEALAQAA  81

Query  302  KKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            +K+K E    N+APKKPNWDL+RDV+K+L++L++R+ +A++++
Sbjct  82   EKQKEEVDLFNLAPKKPNWDLKRDVEKKLERLDRRTQRAIYEI  124



>ref|XP_003059754.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55706.1| predicted protein [Micromonas pusilla CCMP1545]
Length=148

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 59/91 (65%), Gaps = 3/91 (3%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFL--NIAPKKPNWD  361
            +KFRNY+P+D+ LQEG +A   + +F  P+     P    E+ +D      + P+K N D
Sbjct  51   LKFRNYMPRDEELQEGVMAAVQVEEFA-PVEVAPHPLIASEEVDDEVGVDALLPQKLNAD  109

Query  362  LRRDVQKRLDKLEKRSLKALHQLGEEEEKRR  454
            LRRDV ++++KLE+R+ +A+  L +EEE+RR
Sbjct  110  LRRDVAQKMEKLERRTQRAMLVLMQEEEERR  140



>gb|KGL89593.1| Coiled-coil domain-containing protein 12, partial [Charadrius 
vociferus]
Length=111

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 64/107 (60%), Gaps = 16/107 (15%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLA----PPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            ++K RNY P+D+ L++ K+      PV  K  D +    P    +E +     N+AP+KP
Sbjct  2    ELKLRNYEPEDEELKKRKVPQAKPAPVEDKVKDQLEAAKPEPIIEEVD---LANLAPRKP  58

Query  353  NWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            +WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  59   DWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  102



>ref|XP_629550.1| mRNA splicing factor, Cwf18 family protein [Dictyostelium discoideum 
AX4]
 gb|EAL61127.1| mRNA splicing factor, Cwf18 family protein [Dictyostelium discoideum 
AX4]
Length=325

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 7/102 (7%)
 Frame = +2

Query  134  DDDKDASQDQQENDENFQ--MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDK  304
            +D+K   +   EN++N    +KFRNY+P+D+   + ++   V+P    P+A  L      
Sbjct  200  NDEKKEIEMDNENEKNSHTGLKFRNYIPKDQTFLKYRIEKAVVP----PIAQELMSRLKV  255

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             E+N+D  ++  PKK NWDL+RD  K+L KLEK++ KA++QL
Sbjct  256  LEENQDIQISFVPKKVNWDLKRDCSKKLLKLEKQTEKAIYQL  297



>ref|XP_009638389.1| PREDICTED: coiled-coil domain-containing protein 12 [Egretta 
garzetta]
Length=139

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%), Gaps = 28/122 (23%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P         +P
Sbjct  21   DEEETVKHKELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKP---------EP  71

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDL  469
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +
Sbjct  72   IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAV  128

Query  470  GT  475
            G+
Sbjct  129  GS  130



>ref|XP_009473636.1| PREDICTED: coiled-coil domain-containing protein 12 [Nipponia 
nippon]
Length=182

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%), Gaps = 28/122 (23%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P         +P
Sbjct  64   DEEETVKHKELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKP---------EP  114

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDL  469
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +
Sbjct  115  IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAV  171

Query  470  GT  475
            G+
Sbjct  172  GS  173



>gb|ACI66181.1| Coiled-coil domain-containing protein 12 [Salmo salar]
Length=165

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 74/125 (59%), Gaps = 16/125 (13%)
 Frame = +2

Query  131  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQ  298
            PD  +D ++++ E + + ++K RNY P+D+ L+E ++  A P  V  K  D +    P  
Sbjct  37   PDRKRDRAEEEAEEERHRELKLRNYTPEDEELKERQVPKAKPASVEEKVKDQLDAAKPGS  96

Query  299  DKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLA  460
              +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE   LA
Sbjct  97   VIEEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRDRLKGSEEE---LA  150

Query  461  EDLGT  475
              +G 
Sbjct  151  GAVGA  155



>ref|XP_009015858.1| hypothetical protein HELRODRAFT_160665 [Helobdella robusta]
 gb|ESO06490.1| hypothetical protein HELRODRAFT_160665 [Helobdella robusta]
Length=152

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +2

Query  194  FRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKKPNWDLRR  370
            FR+Y P D+ L+EG L P    +  + + + L   Q      E   LN+AP+KP+WDL+R
Sbjct  50   FRSYQPTDEKLKEGVLEPAKPLEIKEQVKDQLIDAQQTNIVEEVDLLNLAPRKPDWDLKR  109

Query  371  DVQKRLDKLEKRSLKALHQL  430
            DV K+L+KLE+R+ +A+ +L
Sbjct  110  DVAKKLEKLERRTQRAMGEL  129



>ref|XP_009554414.1| PREDICTED: coiled-coil domain-containing protein 12 [Cuculus 
canorus]
Length=144

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 67/108 (62%), Gaps = 17/108 (16%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPM--ANLTPPQDKKEKNE  319
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  + +  A L P  D     E
Sbjct  26   DEEETVKHKELKLRNYEPEDEELKKRKVPQAKPASVEEKVKEQLEAAKLEPIID-----E  80

Query  320  DPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  445
                N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  81   VDLTNLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLRGQEEE  128



>ref|NP_001134087.1| Coiled-coil domain-containing protein 12 [Salmo salar]
 gb|ACI66188.1| Coiled-coil domain-containing protein 12 [Salmo salar]
Length=165

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 74/125 (59%), Gaps = 16/125 (13%)
 Frame = +2

Query  131  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQ  298
            PD  +D ++++ E + + ++K RNY P+D+ L+E ++  A P  V  K  D +    P  
Sbjct  37   PDRKRDRAEEEAEEERHRELKLRNYTPEDEELKERQVPKAKPASVEEKVKDQLDAAKPES  96

Query  299  DKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLA  460
              +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE   LA
Sbjct  97   VIEEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRDRLKGSEEE---LA  150

Query  461  EDLGT  475
              +G 
Sbjct  151  GAVGA  155



>ref|XP_001521551.2| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Ornithorhynchus anatinus]
Length=177

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 61/97 (63%), Gaps = 9/97 (9%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKKEKNE  319
            +++ E + + ++K RNY+PQD+ L++ K+ P   P     +  D +    P    +E + 
Sbjct  58   EEEGEPERHRELKLRNYVPQDEELKKRKV-PQARPASVEERVKDQLEAAKPEPIIEEVD-  115

Query  320  DPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
                N+AP+KP+WDL+RDV K+LDKLEKR+ +A+ +L
Sbjct  116  --LANLAPRKPDWDLKRDVAKKLDKLEKRTQRAIAEL  150



>ref|XP_010133771.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Buceros rhinoceros silvestris]
Length=134

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 66/112 (59%), Gaps = 25/112 (22%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P         +P
Sbjct  16   DEEETVKHRELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKP---------EP  66

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  445
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  67   IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  118



>gb|AAI29787.1| LOC100037234 protein [Xenopus laevis]
Length=156

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (63%), Gaps = 13/104 (13%)
 Frame = +2

Query  164  QENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDPFL  331
            +E +++ ++K RNY PQD  L+E ++  A P  V  K  + +    P    +E +    +
Sbjct  40   EEEEQHRELKLRNYTPQDDVLKERQVPQAKPISVEEKVKEQLEAAKPEPIIEEVD---LV  96

Query  332  NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  445
            N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  97   NLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  140



>gb|ACI66996.1| Coiled-coil domain-containing protein 12 [Salmo salar]
 gb|ACI68802.1| Coiled-coil domain-containing protein 12 [Salmo salar]
 gb|ACI69732.1| Coiled-coil domain-containing protein 12 [Salmo salar]
Length=165

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 74/125 (59%), Gaps = 16/125 (13%)
 Frame = +2

Query  131  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQ  298
            PD  +D ++++ E + + ++K RNY P+D+ L+E ++  A P  V  K  D +    P  
Sbjct  37   PDRKRDRAEEEAEEERHRELKLRNYTPEDEELKERQVPKAKPASVEEKVKDQLDAAKPES  96

Query  299  DKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLA  460
              +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE   LA
Sbjct  97   VIEEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRDRLKGSEEE---LA  150

Query  461  EDLGT  475
              +G 
Sbjct  151  GAVGA  155



>emb|CDJ64512.1| hypothetical protein, conserved [Eimeria necatrix]
Length=162

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 60/107 (56%), Gaps = 5/107 (5%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDL  364
            +++FRNY+P+D  L++  L  P + + +  +A       +  K ED    + P++PNWDL
Sbjct  19   EIRFRNYVPKDPKLRQFCLPRPSVEELEKQIAKEAQEAVQAAKEEDILSQVVPRRPNWDL  78

Query  365  RRDVQKRLDKLEKRSLKALHQLGEE-----EEKRRLAEDLGTNS*DF  490
            +RDV++++  L +R+ KA+ QL  E     ++ + LA   G    DF
Sbjct  79   KRDVERKITILSRRTDKAIVQLIREKIEQNKKAKELAGAEGVGKKDF  125



>ref|XP_009812719.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Gavia stellata]
Length=134

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%), Gaps = 28/122 (23%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P         +P
Sbjct  16   DEEEAVKHKELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKP---------EP  66

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDL  469
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +
Sbjct  67   IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAV  123

Query  470  GT  475
            G+
Sbjct  124  GS  125



>ref|XP_004316573.1| PREDICTED: coiled-coil domain-containing protein 12 [Tursiops 
truncatus]
Length=167

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 65/100 (65%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            KD  + ++E +++ +++ RNY+P+D+ L++ ++  A P+    K  + +    P    +E
Sbjct  42   KDLRRGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPIAVEEKVKEQLEAAKPEPIIEE  101

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  102  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_004077894.1| PREDICTED: coiled-coil domain-containing protein 12 [Oryzias 
latipes]
Length=163

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 70/121 (58%), Gaps = 16/121 (13%)
 Frame = +2

Query  122  HETPD---DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMA  280
            HE  D   ++K A+ ++   D++ ++K RNY P+D  L+  K+  A P  V  K  D + 
Sbjct  30   HEQEDGEPENKKAALEETAEDKHRELKLRNYTPEDDELKVRKVPTAKPASVEEKVKDQLE  89

Query  281  NLTPPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEE  442
               P    +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EE
Sbjct  90   AANPEPIIEEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEE  146

Query  443  E  445
            E
Sbjct  147  E  147



>ref|XP_005308836.1| PREDICTED: coiled-coil domain-containing protein 12 [Chrysemys 
picta bellii]
 ref|XP_005308837.1| PREDICTED: coiled-coil domain-containing protein 12 [Chrysemys 
picta bellii]
Length=179

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 75/124 (60%), Gaps = 23/124 (19%)
 Frame = +2

Query  134  DDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQD  301
            DD++DA++ ++       +K RNY+P+D+ L++ K+  A P  V  K  D +    P   
Sbjct  60   DDEEDAAKHKE-------LKLRNYVPEDEDLKKRKVPQAKPASVEDKVKDQLEAAKPEPI  112

Query  302  KKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAE  463
             +E +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA 
Sbjct  113  IEEVD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLRGQEEE---LAS  166

Query  464  DLGT  475
             +G+
Sbjct  167  AVGS  170



>ref|XP_007070347.1| PREDICTED: coiled-coil domain-containing protein 12-like [Chelonia 
mydas]
Length=139

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (62%), Gaps = 16/107 (15%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            ++K RNY+P+D+ L++ K+  A P  V  K  D +    P    +E +     N+AP+KP
Sbjct  30   ELKLRNYIPEDEDLKKRKVPQAKPASVEDKVKDQLEAAKPEPIIEEVD---LANLAPRKP  86

Query  353  NWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            +WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  87   DWDLKRDVAKKLEKLEKRTQRAIAELIRERLRGQEEE---LASAVGS  130



>ref|XP_004760838.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Mustela putorius furo]
 ref|XP_004760839.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Mustela putorius furo]
 ref|XP_004814162.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Mustela putorius furo]
 ref|XP_004814163.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Mustela putorius furo]
Length=166

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 62/97 (64%), Gaps = 9/97 (9%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKKEKNE  319
            + ++E +++ +++ RNY+P+D+ L+  ++ PP  P     K  + +    P    +E + 
Sbjct  46   EGEEEGEKHRELRLRNYVPEDEDLKRRRV-PPAKPVAVEEKVKEQLEAAKPEPIIEEVD-  103

Query  320  DPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
                N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  --LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|NP_001091259.1| uncharacterized protein LOC100037064 [Xenopus laevis]
 gb|AAI28981.1| LOC100037064 protein [Xenopus laevis]
Length=157

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (63%), Gaps = 13/104 (13%)
 Frame = +2

Query  164  QENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDPFL  331
            +E +++ ++K RNY PQD+ L+E ++  A P  V  K  + +    P    +E +     
Sbjct  41   EEEEQHRELKLRNYTPQDEVLKERQVPQAKPISVEEKVQEQLEAAKPEPIIEEVD---LA  97

Query  332  NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  445
            N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  98   NLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  141



>ref|XP_005804720.1| PREDICTED: coiled-coil domain-containing protein 12-like [Xiphophorus 
maculatus]
Length=177

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 76/131 (58%), Gaps = 19/131 (15%)
 Frame = +2

Query  122  HETPDDD---KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMA  280
            HE  D++   K A+ ++   +++ ++K RNY P+D+ L+E ++  A P  V  K  D + 
Sbjct  44   HEQEDEEPESKKATLEETPEEKHRELKLRNYTPEDEELKERQVPKAKPASVEDKVKDQLE  103

Query  281  NLTPPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEE  442
               P    +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EE
Sbjct  104  AANPEPIIEEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEE  160

Query  443  EKRRLAEDLGT  475
            E   LA  +G 
Sbjct  161  E---LAAAVGA  168



>ref|XP_005532203.1| PREDICTED: coiled-coil domain-containing protein 12 [Pseudopodoces 
humilis]
Length=191

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 69/114 (61%), Gaps = 12/114 (11%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEK--NEDPFL  331
            +++E  ++ ++K RNY P+D+ L++ KL PP  P   +          K E   +E    
Sbjct  73   EEEEPVKHREIKLRNYDPEDEELKKRKL-PPAKPASVEETVKEQLEAAKPEPIIDEVDLA  131

Query  332  NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  132  NLAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  182



>gb|KFO89314.1| Coiled-coil domain-containing protein 12, partial [Buceros rhinoceros 
silvestris]
Length=130

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 66/112 (59%), Gaps = 25/112 (22%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P         +P
Sbjct  17   DEEETVKHRELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKP---------EP  67

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  445
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  68   IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  119



>ref|XP_008490404.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Calypte anna]
Length=134

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 73/118 (62%), Gaps = 20/118 (17%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFL--  331
            D++E  ++ ++K RNY P+D+ L++ K+ P   P    P+ ++   Q +  K E P +  
Sbjct  16   DEEEPIKHKELKLRNYEPEDEELKKRKV-PKAKPA---PVEDMVKDQLEAAKPE-PIIEE  70

Query  332  ----NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
                N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  71   VDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125



>ref|XP_005428072.1| PREDICTED: coiled-coil domain-containing protein 12 [Geospiza 
fortis]
Length=138

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMA-NLTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ KL P      +D +   L   + +   +E    N+AP+KP+WD
Sbjct  29   EIKLRNYDPEDEELKKRKLPPAKPASVEDTVKEQLEAAKPEPIIDEVDLANLAPRKPDWD  88

Query  362  LRRDVQKRLDKLEKRSLKALHQL  430
            L+RDV K+L+KLEKR+ +A+ +L
Sbjct  89   LKRDVSKKLEKLEKRTQRAIAEL  111



>ref|XP_005040505.1| PREDICTED: coiled-coil domain-containing protein 12 [Ficedula 
albicollis]
Length=268

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 69/113 (61%), Gaps = 10/113 (9%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMA-NLTPPQDKKEKNEDPFLN  334
            +++E  ++ ++K RNY P+D  L++ KL P      +D +   L   + +   +E    N
Sbjct  150  EEEEPVKHREIKLRNYDPEDAELKKRKLPPAKPASVEDTVKEQLEAAKPEPIIDEVDLAN  209

Query  335  IAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            +AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  210  LAPRKPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  259



>gb|KFD48500.1| hypothetical protein M513_10634 [Trichuris suis]
Length=163

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 7/110 (6%)
 Frame = +2

Query  122  HETPDDDKDASQDQQENDE------NFQMKFRNYLPQDKHLQEGKL-APPVLPKFDDPMA  280
            H+  + D   SQ  +++ E      N  +KFRNY P D  L    +   P L   D+   
Sbjct  21   HQNDNTDSAESQTAKDDSERSNAVSNAVLKFRNYKPLDSELARFSVDLSPALDIADELRE  80

Query  281  NLTPPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             L   +  +E  E    ++APKK +WDL+RD QK+LDKLE+R+ KA+ +L
Sbjct  81   VLEEAKKFQEVEEIDLASLAPKKVDWDLKRDAQKKLDKLERRTQKAIIEL  130



>ref|XP_002109500.1| hypothetical protein TRIADDRAFT_53602 [Trichoplax adhaerens]
 gb|EDV27666.1| hypothetical protein TRIADDRAFT_53602 [Trichoplax adhaerens]
Length=162

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDP-FLNIAPKKPNWD  361
            ++KFRNYLPQD  L++ K+  P  P   + +  +    +   K E    +N+AP+KP+WD
Sbjct  52   RVKFRNYLPQDDSLKDQKMEKPSAPTAQEDVEEILSSTNANTKYEGVDLVNLAPRKPDWD  111

Query  362  LRRDVQKRLDKLEKRSLKAL  421
            L+R ++ ++ KLE+++ +++
Sbjct  112  LKRTIEDKMQKLERKTQRSI  131



>ref|XP_009945692.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Leptosomus discolor]
Length=98

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 61/99 (62%), Gaps = 17/99 (17%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPM--ANLTPPQDKKEKNEDPFLNIAPK  346
            ++K RNY P+D+ L++ K+  A P  V  K  D +  A L P  D     E    N+AP+
Sbjct  1    ELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKLEPIID-----EVDLANLAPR  55

Query  347  KPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  445
            KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  56   KPDWDLKRDVSKKLEKLEKRTQRAIAELIRERLKGQEEE  94



>ref|XP_007436316.1| PREDICTED: coiled-coil domain-containing protein 12 [Python bivittatus]
Length=167

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 9/87 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKKEKNEDPFLNIAPKK  349
            ++K RNY+P+D+ L+E ++ P   P     K  D +    P    +E +     N+AP+K
Sbjct  58   ELKLRNYVPEDEELKE-RVVPKAKPASVEDKVKDQLEAAKPELIIEEVD---LANLAPRK  113

Query  350  PNWDLRRDVQKRLDKLEKRSLKALHQL  430
            P+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  114  PDWDLKRDVAKKLEKLEKRTQRAIAEL  140



>ref|XP_003454446.1| PREDICTED: coiled-coil domain-containing protein 12-like [Oreochromis 
niloticus]
 ref|XP_004541492.1| PREDICTED: coiled-coil domain-containing protein 12-like [Maylandia 
zebra]
 ref|XP_005738568.1| PREDICTED: coiled-coil domain-containing protein 12-like [Pundamilia 
nyererei]
Length=163

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 68/113 (60%), Gaps = 13/113 (12%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  304
            + K A+ ++   +++ ++K RNY P+D+ L+E ++  A P  V  K  D +    P    
Sbjct  38   ESKKATLEEATQEKHRELKLRNYAPEDEELKERQVPKAKPASVEDKVKDQLEAANPEPII  97

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  445
            +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE
Sbjct  98   EEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGHEEE  147



>ref|XP_006277376.1| PREDICTED: coiled-coil domain-containing protein 12 [Alligator 
mississippiensis]
Length=177

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 67/110 (61%), Gaps = 12/110 (11%)
 Frame = +2

Query  128  TPDDDKDASQDQQENDE-----NFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMA  280
            T D  + AS+  +E+DE     + +++ RNY P+D+ L++ K+  A P  V  K  D + 
Sbjct  44   TKDSGEPASKQLREDDEESAVKHMELRLRNYNPEDEELKKRKVPQAKPASVEEKVKDQLE  103

Query  281  NLTPPQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               P    +E +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  AAKPEPIIEEVD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  150



>gb|EMC81123.1| Coiled-coil domain-containing protein 12, partial [Columba livia]
Length=135

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 61/101 (60%), Gaps = 19/101 (19%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APPVLP--KFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A PV    K  D +    P         +P
Sbjct  17   DEEETVKHKELKLRNYEPEDEELKKRKMPKAKPVSVEDKVKDQLEAAKP---------EP  67

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  68   IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  108



>ref|NP_001106902.1| coiled-coil domain containing 12 [Xenopus laevis]
 gb|AAI57392.1| LOC100037234 protein [Xenopus laevis]
Length=157

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 64/104 (62%), Gaps = 13/104 (13%)
 Frame = +2

Query  164  QENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDPFL  331
            +E +++ ++K RNY PQD  L+E ++  A P  V  K  + +    P    +E +     
Sbjct  41   EEQEQHRELKLRNYTPQDDVLKERQVPQAKPISVEEKVKEQLEAAKPEPIIEEVD---LA  97

Query  332  NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  445
            N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  98   NLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE  141



>ref|XP_006801430.1| PREDICTED: coiled-coil domain-containing protein 12-like [Neolamprologus 
brichardi]
Length=163

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 16/123 (13%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  304
            + K A+ ++   +++ ++K RNY P+D+ L+E ++  A P  V  K  D +    P    
Sbjct  38   ESKKATLEEATQEKHRELKLRNYAPEDEELKERQVPKAKPASVEDKVKDQLEAANPEPII  97

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAED  466
            +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE   LA  
Sbjct  98   EEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGHEEE---LAGA  151

Query  467  LGT  475
            +G 
Sbjct  152  VGA  154



>ref|XP_005229622.1| PREDICTED: coiled-coil domain-containing protein 12 [Falco peregrinus]
 ref|XP_005442463.1| PREDICTED: coiled-coil domain-containing protein 12 [Falco cherrug]
Length=137

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 28/122 (23%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P         +P
Sbjct  19   DEEETVKHKELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKP---------EP  69

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDL  469
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EE+   LA  +
Sbjct  70   IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEED---LASAV  126

Query  470  GT  475
            G+
Sbjct  127  GS  128



>ref|XP_009084497.1| PREDICTED: coiled-coil domain-containing protein 12 [Serinus 
canaria]
Length=167

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMA-NLTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ KL P      +D +   L   + +   +E    N+AP+KP+WD
Sbjct  58   EIKLRNYDPEDEELKKRKLPPAKPASVEDTVKEQLEAAKPEPIIDEVDLANLAPRKPDWD  117

Query  362  LRRDVQKRLDKLEKRSLKALHQL  430
            L+RDV K+L+KLEKR+ +A+ +L
Sbjct  118  LKRDVSKKLEKLEKRTQRAIAEL  140



>gb|KFP61285.1| Coiled-coil domain-containing protein 12, partial [Cariama cristata]
 gb|KFV12292.1| Coiled-coil domain-containing protein 12, partial [Tauraco erythrolophus]
Length=111

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (61%), Gaps = 16/107 (15%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            ++K RNY P+D+ L++ K+  A P  V  K  D +    P    +E +     N+AP+KP
Sbjct  2    ELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKPEPIIEEVD---LANLAPRKP  58

Query  353  NWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            +WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  59   DWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  102



>dbj|GAN07616.1| coiled-coil domain-containing protein 12 [Mucor ambiguus]
Length=159

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 56/88 (64%), Gaps = 7/88 (8%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEG-KLAPP------VLPKFDDPMANLTPPQDKKEKNEDPFLNIAPK  346
            +KFR+Y P D+ LQ+  ++A P      +  +  D          +K+K E    N+APK
Sbjct  37   LKFRSYTPNDEKLQQHVEIAQPTDIGNTLETETKDFTKEALAQAAEKQKEEVDLFNLAPK  96

Query  347  KPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            KPNWDL+RDV+K+L++L++++ +A++++
Sbjct  97   KPNWDLKRDVEKKLERLDRKTQRAIYEI  124



>ref|XP_005934856.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
X1 [Haplochromis burtoni]
Length=167

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 64/102 (63%), Gaps = 7/102 (7%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  304
            + K A+ ++   +++ ++K RNY P+D+ L+E ++  A P  V  K  D +    P    
Sbjct  38   ESKKATLEEATQEKHRELKLRNYAPEDEELKERQVPKAKPASVEDKVKDQLEAANPEPII  97

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L
Sbjct  98   EEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAEL  136



>ref|XP_010710593.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Meleagris gallopavo]
Length=166

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++  RNY P+D+ L++ KL P      +D + + L   + +   +E    N+AP+KP+WD
Sbjct  57   EIILRNYDPEDEELKKRKLPPAKPASVEDKVKDQLEAAKPETIIDEVDLTNLAPRKPDWD  116

Query  362  LRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            L+RDV K+++KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  117  LKRDVAKKMEKLEKRTQRAIAELIRERLKGQEEE---LAAAVGS  157



>ref|XP_010882732.1| PREDICTED: coiled-coil domain-containing protein 12 [Esox lucius]
Length=165

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 74/127 (58%), Gaps = 13/127 (10%)
 Frame = +2

Query  131  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQ  298
            PD  KD ++++ E + + ++K RNY P+D+ L+  ++  A P  V  K  D +    P  
Sbjct  37   PDCKKDRAEEEAEEERHRELKLRNYTPEDEELRVRQVPKAKPASVEEKVKDQLEAANPEP  96

Query  299  DKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLA  460
              +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ KA+ +L      G EEE   + 
Sbjct  97   VIEEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRDRLKGSEEELAGVV  153

Query  461  EDLGTNS  481
              +G ++
Sbjct  154  GAIGVSA  160



>ref|XP_005600803.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X3 
[Equus caballus]
Length=207

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 63/101 (62%), Gaps = 9/101 (9%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKK  307
            K   + ++E +++ +++ RNY+P+D+ L+  ++ PP  P     K  + +    P    +
Sbjct  83   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRV-PPAKPVAVEEKVKEQLEAAKPEPVIE  141

Query  308  EKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            E +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  142  EVD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  179



>gb|KFO72623.1| Coiled-coil domain-containing protein 12, partial [Cuculus canorus]
Length=111

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 61/99 (62%), Gaps = 17/99 (17%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPM--ANLTPPQDKKEKNEDPFLNIAPK  346
            ++K RNY P+D+ L++ K+  A P  V  K  + +  A L P  D     E    N+AP+
Sbjct  2    ELKLRNYEPEDEELKKRKVPQAKPASVEEKVKEQLEAAKLEPIID-----EVDLTNLAPR  56

Query  347  KPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEE  445
            KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE
Sbjct  57   KPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLRGQEEE  95



>ref|NP_001006353.1| coiled-coil domain-containing protein 12 [Gallus gallus]
 emb|CAG31909.1| hypothetical protein RCJMB04_13h18 [Gallus gallus]
Length=175

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 69/113 (61%), Gaps = 10/113 (9%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLN  334
            +++E   + ++  RNY P+D+ L++ KL P      +D + + L   + +   +E    N
Sbjct  57   EEEETVRHRELILRNYDPEDEELKKRKLPPAKPASVEDKVKDQLEAAKPEPIIDEVDLTN  116

Query  335  IAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            +AP+KP+WDL+RDV K+++KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  117  LAPRKPDWDLKRDVAKKMEKLEKRTQRAIAELIRERLKGQEEE---LAAAVGS  166



>gb|EHJ70025.1| coiled-coil domain containing 12-like protein [Danaus plexippus]
Length=153

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = +2

Query  191  KFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED-PFLNIAPKKPNWDLR  367
            KFR+Y PQD++LQ+ KL      + ++ + +L     +K   +D    ++AP+KP+WDL+
Sbjct  45   KFRSYKPQDENLQKEKLQDAQPAQVEEEVKDLVEAGKEKVVLQDLDISSLAPRKPDWDLK  104

Query  368  RDVQKRLDKLEKRSLKALHQL  430
            RDV K+L+KLE+R+ KA+ +L
Sbjct  105  RDVAKKLEKLERRTQKAIAEL  125



>ref|XP_006200792.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Vicugna pacos]
 ref|XP_006200793.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Vicugna pacos]
Length=166

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPIIEE  101

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  102  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>gb|KFO12662.1| Coiled-coil domain-containing protein 12, partial [Balearica 
regulorum gibbericeps]
Length=111

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ K+        +D + + L   + +   +E    N+AP+KP+WD
Sbjct  2    ELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKPEPIIDEVDLTNLAPRKPDWD  61

Query  362  LRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            L+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  62   LKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  102



>gb|KIJ69082.1| hypothetical protein HYDPIDRAFT_123148 [Hydnomerulius pinastri 
MD-312]
Length=156

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 59/99 (60%), Gaps = 9/99 (9%)
 Frame = +2

Query  197  RNYLPQD----KHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED-PFLNIAPKKPNWD  361
            RN+ P+     KH Q   +    + K  + MA +   +D++ + ++    NIAPK+PNWD
Sbjct  37   RNFDPETRTLRKHTQNAAITEDTVEKNVEGMAEMIIAEDEQRRAQELDVFNIAPKRPNWD  96

Query  362  LRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLGTN  478
            L+R+++K+L KLE+++ +++H L     ++RLA   G N
Sbjct  97   LKREMEKKLAKLERKTQESIHTLI----RQRLATQKGQN  131



>ref|XP_002912813.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Ailuropoda melanoleuca]
 gb|EFB19184.1| hypothetical protein PANDA_000626 [Ailuropoda melanoleuca]
Length=166

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            + ++E++++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +  
Sbjct  46   EGEEESEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPIIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_005512181.1| PREDICTED: coiled-coil domain-containing protein 12 [Columba 
livia]
Length=174

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 61/101 (60%), Gaps = 19/101 (19%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKL--APPVLP--KFDDPMANLTPPQDKKEKNEDP  325
            D++E  ++ ++K RNY P+D+ L++ K+  A PV    K  D +    P         +P
Sbjct  56   DEEETVKHKELKLRNYEPEDEELKKRKMPKAKPVSVEDKVKDQLEAAKP---------EP  106

Query  326  FL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  IIDEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  147



>ref|XP_002406102.1| coiled-coil domain-containing protein, putative [Ixodes scapularis]
 gb|EEC10255.1| coiled-coil domain-containing protein, putative [Ixodes scapularis]
Length=164

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 9/84 (11%)
 Frame = +2

Query  194  FRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNW  358
            FR+Y P+D+ L+E  L P V P     +  + +A  TP    KE +     ++AP+KP+W
Sbjct  53   FRSYKPEDETLREATL-PEVSPVSIEGEIKERIAVATPEDLVKEVD---LSSLAPRKPDW  108

Query  359  DLRRDVQKRLDKLEKRSLKALHQL  430
            DL+RDV K+LDKL+KR+ +A+ +L
Sbjct  109  DLKRDVSKKLDKLDKRTKRAIAEL  132



>ref|XP_009487206.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Pelecanus crispus]
 ref|XP_009869852.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Apaloderma vittatum]
Length=110

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ K+        +D + + L   + +   +E    N+AP+KP+WD
Sbjct  1    ELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKPEPIIDEVDLANLAPRKPDWD  60

Query  362  LRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            L+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  61   LKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  101



>ref|XP_008283900.1| PREDICTED: coiled-coil domain-containing protein 12 [Stegastes 
partitus]
Length=191

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 16/123 (13%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  304
            ++K A+ ++    ++ ++K RNY P+D+ L+E ++  A P  V  K  D +    P    
Sbjct  66   ENKKATLEETTEQKHRELKLRNYTPEDEELKERQVPKAKPASVEDKVKDQLEAANPEPII  125

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAED  466
            +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE   LA  
Sbjct  126  EEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEEE---LAGA  179

Query  467  LGT  475
            +G 
Sbjct  180  VGA  182



>ref|XP_008430786.1| PREDICTED: coiled-coil domain-containing protein 12 [Poecilia 
reticulata]
Length=202

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 74/127 (58%), Gaps = 17/127 (13%)
 Frame = +2

Query  125  ETPDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTP  292
            E P+  K A ++  E +++ ++K RNY P+D+ L+E ++  A P  V  K  D +    P
Sbjct  74   EEPESKKAALEETLE-EKHRELKLRNYTPEDEELKERQVPKAKPASVEDKVKDQLEAANP  132

Query  293  PQDKKEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRR  454
                +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE   
Sbjct  133  EPIIEEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEEE---  186

Query  455  LAEDLGT  475
            LA  +G 
Sbjct  187  LAAAVGA  193



>ref|XP_005669523.1| PREDICTED: coiled-coil domain-containing protein 12 [Sus scrofa]
Length=165

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 62/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +  
Sbjct  46   EGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_006928752.1| PREDICTED: coiled-coil domain-containing protein 12 [Felis catus]
 ref|XP_007088491.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Panthera tigris altaica]
Length=166

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 62/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +  
Sbjct  46   EGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_003762982.1| PREDICTED: coiled-coil domain-containing protein 12-like [Sarcophilus 
harrisii]
Length=160

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNED  322
            ++++  +++ ++K RNY+P+D+ L++ K+  A P  V  K  D +    P    +E +  
Sbjct  45   KEEEGGEKHRELKLRNYVPEDEELKKRKVPQAKPASVEEKVKDQLEAAKPEPIIEEVD--  102

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  103  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  137



>gb|KFM08706.1| Coiled-coil domain-containing protein 12, partial [Aptenodytes 
forsteri]
 gb|KFP17041.1| Coiled-coil domain-containing protein 12, partial [Egretta garzetta]
 gb|KFP54079.1| Coiled-coil domain-containing protein 12, partial [Cathartes 
aura]
 gb|KFQ64380.1| Coiled-coil domain-containing protein 12, partial [Pelecanus 
crispus]
 gb|KFQ71939.1| Coiled-coil domain-containing protein 12, partial [Phaethon lepturus]
 gb|KFQ77282.1| Coiled-coil domain-containing protein 12, partial [Phoenicopterus 
ruber ruber]
 gb|KFV55386.1| Coiled-coil domain-containing protein 12, partial [Gavia stellata]
 gb|KFW73643.1| Coiled-coil domain-containing protein 12, partial [Pygoscelis 
adeliae]
Length=111

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ K+        +D + + L   + +   +E    N+AP+KP+WD
Sbjct  2    ELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKPEPIIDEVDLANLAPRKPDWD  61

Query  362  LRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            L+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  62   LKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  102



>ref|XP_007126145.1| PREDICTED: coiled-coil domain-containing protein 12 [Physeter 
catodon]
Length=167

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            + ++E +++ +++ RNY+P+D+ L++ ++  A PV    K  + +    P    +E +  
Sbjct  46   EGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPIIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_006173541.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Camelus ferus]
 ref|XP_006173542.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Camelus ferus]
 ref|XP_010958315.1| PREDICTED: coiled-coil domain-containing protein 12 [Camelus 
bactrianus]
 ref|XP_010995515.1| PREDICTED: coiled-coil domain-containing protein 12 [Camelus 
dromedarius]
 ref|XP_010995521.1| PREDICTED: coiled-coil domain-containing protein 12 [Camelus 
dromedarius]
 ref|XP_010995528.1| PREDICTED: coiled-coil domain-containing protein 12 [Camelus 
dromedarius]
Length=166

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPIIEE  101

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  102  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_004399222.1| PREDICTED: coiled-coil domain-containing protein 12 [Odobenus 
rosmarus divergens]
Length=166

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 62/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +  
Sbjct  46   EGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPIIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_541901.2| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Canis lupus familiaris]
 ref|XP_006737340.1| PREDICTED: coiled-coil domain-containing protein 12 [Leptonychotes 
weddellii]
 ref|XP_008702082.1| PREDICTED: coiled-coil domain-containing protein 12 [Ursus maritimus]
Length=166

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 62/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +  
Sbjct  46   EGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPIIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_006129858.1| PREDICTED: coiled-coil domain-containing protein 12 [Pelodiscus 
sinensis]
Length=160

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 67/109 (61%), Gaps = 16/109 (15%)
 Frame = +2

Query  179  NFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDPFLNIAPK  346
            + ++K RNY+P+D+ L++ K+  A P  V  K  D +    P    +E +     N+AP+
Sbjct  49   SRELKLRNYVPEDEELKKRKVPQAKPASVEDKVKDQLQAAKPEPIIEEVD---LANLAPR  105

Query  347  KPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  106  KPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLRGQEEE---LASAVGS  151



>ref|XP_010304384.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Balearica regulorum gibbericeps]
Length=134

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (58%), Gaps = 28/113 (25%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDPFL------N  334
            ++K RNY P+D+ L++ K+  A P  V  K  D +    P         +P +      N
Sbjct  25   ELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKP---------EPIIDEVDLTN  75

Query  335  IAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            +AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  76   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  125



>ref|XP_007088492.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Panthera tigris altaica]
Length=138

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 61/94 (65%), Gaps = 7/94 (7%)
 Frame = +2

Query  161  QQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNEDPF  328
            ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +    
Sbjct  20   EEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVD---L  76

Query  329  LNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  77   ANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  110



>ref|XP_005600802.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Equus caballus]
 ref|XP_008518536.1| PREDICTED: coiled-coil domain-containing protein 12 [Equus przewalskii]
Length=252

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 62/97 (64%), Gaps = 9/97 (9%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKKEKNE  319
            + ++E +++ +++ RNY+P+D+ L+  ++ PP  P     K  + +    P    +E + 
Sbjct  132  EGEEEGEKHRELRLRNYVPEDEDLKRRRV-PPAKPVAVEEKVKEQLEAAKPEPVIEEVD-  189

Query  320  DPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
                N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  190  --LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  224



>ref|XP_004419680.1| PREDICTED: coiled-coil domain-containing protein 12 [Ceratotherium 
simum simum]
Length=166

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEE  101

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  102  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_006914932.1| PREDICTED: coiled-coil domain-containing protein 12 [Pteropus 
alecto]
Length=166

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 61/94 (65%), Gaps = 7/94 (7%)
 Frame = +2

Query  161  QQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNEDPF  328
            ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +    
Sbjct  48   EEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVD---L  104

Query  329  LNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  105  ANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>dbj|GAA51052.1| coiled-coil domain-containing protein 12 [Clonorchis sinensis]
Length=173

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = +2

Query  194  FRNYLPQDKHLQEGKL--APPV--LPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWD  361
            FRNY PQ   L+ G+L  APPV   P     +     P   +E N    +++AP+KP+WD
Sbjct  70   FRNYKPQSGDLKSGELPAAPPVDLTPYVTSQLEAANAPVIMEEVN---LMSLAPRKPDWD  126

Query  362  LRRDVQKRLDKLEKRSLKALHQLGEE  439
            L+R V K+L KLE+R+ +A+ +L  E
Sbjct  127  LKRGVDKKLQKLERRTQRAIAELIRE  152



>ref|XP_010755218.1| PREDICTED: coiled-coil domain-containing protein 12 [Larimichthys 
crocea]
Length=162

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKE  310
            K AS ++  ++ + ++K RNY P+D+ L+E ++  A P  V  K  D +    P    +E
Sbjct  39   KKASLEETSHERHRELKLRNYTPEDEELKERQVPKAKPASVEDKVRDQLEAANPEPIIEE  98

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     ++AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L
Sbjct  99   VD---LASLAPRKPDWDLKRDVAKKLEKLERRTQRAIAEL  135



>ref|XP_005496692.1| PREDICTED: uncharacterized protein LOC102063747 [Zonotrichia 
albicollis]
Length=224

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +2

Query  173  DENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMA-NLTPPQDKKEKNEDPFLNIAPKK  349
            ++  ++K RNY P+D+ L++ KL P      +D +   L   + +   +E    N+AP+K
Sbjct  120  NQGMEIKLRNYDPEDEELKKRKLPPAKPASVEDTVKEQLEAAKPEPIIDEVDLANLAPRK  179

Query  350  PNWDLRRDVQKRLDKLEKRSLKALHQL  430
            P+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  180  PDWDLKRDVSKKLEKLEKRTQRAIAEL  206



>ref|XP_009176425.1| hypothetical protein T265_11492 [Opisthorchis viverrini]
 gb|KER19826.1| hypothetical protein T265_11492 [Opisthorchis viverrini]
Length=173

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 7/86 (8%)
 Frame = +2

Query  194  FRNYLPQDKHLQEGKL--APPV--LPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWD  361
            FRNY PQ   L+ G+L  APPV   P     +     P   +E N    +++AP+KP+WD
Sbjct  70   FRNYKPQSGDLKSGELPAAPPVDLTPYVTSQLEAANAPVIMEEVN---LMSLAPRKPDWD  126

Query  362  LRRDVQKRLDKLEKRSLKALHQLGEE  439
            L+R V K+L KLE+R+ +A+ +L  E
Sbjct  127  LKRGVDKKLQKLERRTQRAIAELIRE  152



>ref|XP_005696078.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Capra hircus]
Length=168

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 64/100 (64%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV    K  + +    P    +E
Sbjct  42   KQLREGEEEGEKHRELRLRNYIPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEE  101

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  102  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_004676293.1| PREDICTED: coiled-coil domain-containing protein 12 [Condylura 
cristata]
Length=166

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEE  101

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  102  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_004614568.1| PREDICTED: coiled-coil domain-containing protein 12 [Sorex araneus]
Length=166

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 62/94 (66%), Gaps = 7/94 (7%)
 Frame = +2

Query  161  QQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNEDPF  328
            ++E +++ +++ RNY+P+D+ L++ ++  A PV    K  + +    P    +E +    
Sbjct  48   EEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVD---L  104

Query  329  LNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  105  ANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_010083497.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Pterocles gutturalis]
Length=110

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ K+        +D + + L   + +   +E    N+AP+KP+WD
Sbjct  1    ELKLRNYDPEDEELKKRKVPQAKPASVEDKVKDQLEAAKPEPIIDEVDLANLAPRKPDWD  60

Query  362  LRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            L+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  61   LKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  101



>ref|XP_005600801.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Equus caballus]
Length=262

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 62/97 (64%), Gaps = 9/97 (9%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLP-----KFDDPMANLTPPQDKKEKNE  319
            + ++E +++ +++ RNY+P+D+ L+  ++ PP  P     K  + +    P    +E + 
Sbjct  142  EGEEEGEKHRELRLRNYVPEDEDLKRRRV-PPAKPVAVEEKVKEQLEAAKPEPVIEEVD-  199

Query  320  DPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
                N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  200  --LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  234



>ref|XP_009906078.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Picoides pubescens]
Length=146

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 70/121 (58%), Gaps = 25/121 (21%)
 Frame = +2

Query  131  PDDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQ  298
            P+  K    +++E+ ++ ++K RNY P+D+ L++ K+  A P  V  K  D +    P  
Sbjct  19   PESKKLREDEEEESIKHKEIKLRNYDPEDEELKKRKVPQAKPASVEEKVKDQLEAAKP--  76

Query  299  DKKEKNEDPFL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEE  442
                   +P +      N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L      G+EE
Sbjct  77   -------EPIIDEVDLTNLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEE  129

Query  443  E  445
            E
Sbjct  130  E  130



>emb|CDS10767.1| hypothetical protein LRAMOSA11253 [Absidia idahoensis var. thermophila]
Length=149

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 54/95 (57%), Gaps = 7/95 (7%)
 Frame = +2

Query  167  ENDENFQMKFRNYLPQDKHL-QEGKLAPP--VLPKFDDPMANLT----PPQDKKEKNEDP  325
            EN     + FR+Y P D++L Q   +A P  V    +    + T         KEK E  
Sbjct  23   ENSSERTLAFRSYTPNDENLKQHVNIATPDDVGETVESETKSYTKDALAEAAVKEKEEVD  82

Query  326  FLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
              N+ PKKPNWDL+RDV+K+L++L++R+ KA+ +L
Sbjct  83   LFNLQPKKPNWDLKRDVEKKLERLDRRTQKAVLEL  117



>ref|XP_007168907.1| PREDICTED: coiled-coil domain-containing protein 12 [Balaenoptera 
acutorostrata scammoni]
Length=172

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E
Sbjct  47   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPIIEE  106

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  107  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  143



>ref|XP_005696079.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Capra hircus]
Length=143

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 64/100 (64%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV    K  + +    P    +E
Sbjct  17   KQLREGEEEGEKHRELRLRNYIPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEE  76

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  77   VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  113



>gb|KIJ10497.1| hypothetical protein PAXINDRAFT_177458 [Paxillus involutus ATCC 
200175]
Length=155

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 9/97 (9%)
 Frame = +2

Query  197  RNYLPQD----KHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED-PFLNIAPKKPNWD  361
            RN+ P+     KH Q G L    + K  + MA     +D++ + ++    NIAPK+PNWD
Sbjct  37   RNFDPETRTLRKHTQNGALTEDTIEKDVEGMAEQIIVEDEQRRAQELDVFNIAPKRPNWD  96

Query  362  LRRDVQKRLDKLEKRSLKALHQLGEEEEKRRLAEDLG  472
            L+R+++K+L  LE+++ +A+H L     +RRLA   G
Sbjct  97   LKREMEKKLAGLERKTQEAIHTLI----RRRLAAQKG  129



>gb|ELK24973.1| Coiled-coil domain-containing protein 12 [Myotis davidii]
Length=166

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 62/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +  
Sbjct  46   EGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVREQLEAAKPEPVIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_010860802.1| PREDICTED: coiled-coil domain-containing protein 12 [Bison bison 
bison]
Length=178

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 65/102 (64%), Gaps = 7/102 (7%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDK  304
            + K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV    K  + +    P    
Sbjct  40   NTKQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVI  99

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            +E +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  100  EEVD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_004368774.1| PREDICTED: coiled-coil domain-containing protein 12 [Trichechus 
manatus latirostris]
Length=125

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 5/89 (6%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKL--APPVLP--KFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            +++ RNY+P+D+ L++ ++  A PV    K  + +    P    +E   D   N+AP+KP
Sbjct  13   ELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVVSD-LANLAPRKP  71

Query  353  NWDLRRDVQKRLDKLEKRSLKALHQLGEE  439
            +WDL+RDV K+L+KLEKR+ +A+ +L  E
Sbjct  72   DWDLKRDVAKKLEKLEKRTQRAIAELIRE  100



>emb|CDH48230.1| hypothetical protein RO3G_10424 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=151

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 55/94 (59%), Gaps = 7/94 (7%)
 Frame = +2

Query  170  NDENFQMKFRNYLPQDKHL-QEGKLAPP--VLPKFDDPMANLT----PPQDKKEKNEDPF  328
            ++ N  + FR+Y P D++L Q   +A P  V    +    + T         KEK E   
Sbjct  26   SERNRTLAFRSYTPNDENLKQHVNIATPNDVGETVESETKSFTKDVLAEAAVKEKEEVDL  85

Query  329  LNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             N+ PKKPNWDL+RDV+K+L++L++R+ KA+ +L
Sbjct  86   FNLQPKKPNWDLKRDVEKKLERLDRRTQKAILEL  119



>gb|EOA98534.1| Coiled-coil domain-containing protein 12 [Anas platyrhynchos]
Length=157

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMA-NLTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ K+ P      +D +   L   + +   +E    N+AP+KP+WD
Sbjct  48   EIKLRNYDPEDEELKKRKVPPAKPASVEDVVKEQLEAAKPEPIIDEVDLANLAPRKPDWD  107

Query  362  LRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            L+RDV K+L+KL+KR+ +A+ +L      G+EEE   LA  +G+
Sbjct  108  LKRDVAKKLEKLDKRTQRAIAELIRERLKGQEEE---LASAVGS  148



>ref|XP_007470325.1| PREDICTED: coiled-coil domain-containing protein 12 [Lipotes 
vexillifer]
Length=172

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            + ++E +++ +++ RNY+P+D+ L++ ++  A P+    K  + +    P    +E +  
Sbjct  51   EGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPIAVEEKVKEQLEAAKPEPIIEEVD--  108

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  109  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  143



>ref|XP_004211306.1| PREDICTED: coiled-coil domain-containing protein 12-like, partial 
[Hydra vulgaris]
Length=102

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 56/103 (54%), Gaps = 5/103 (5%)
 Frame = +2

Query  134  DDDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEK  313
            DD+ DAS    +      +KFRNY PQD  L+E K+      K  + +         +  
Sbjct  1    DDENDASSGPPKK----VIKFRNYTPQDPLLKEKKIEKAKPAKVLENIGEHLEKGKLQTA  56

Query  314  NEDP-FLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEE  439
             ED     +AP+KP+WDL+RDV  R+DKLEKR+ KA+ +L  E
Sbjct  57   VEDVDLTTLAPRKPDWDLKRDVTNRMDKLEKRTQKAIVELIRE  99



>ref|NP_001069934.1| coiled-coil domain-containing protein 12 [Bos taurus]
 ref|XP_004018552.1| PREDICTED: coiled-coil domain-containing protein 12 [Ovis aries]
 ref|XP_005910803.1| PREDICTED: coiled-coil domain-containing protein 12 [Bos mutus]
 ref|XP_006065279.1| PREDICTED: coiled-coil domain-containing protein 12 [Bubalus 
bubalis]
 gb|AAI18454.1| Coiled-coil domain containing 12 [Bos taurus]
 tpg|DAA16848.1| TPA: coiled-coil domain containing 12 [Bos taurus]
 gb|ELR45268.1| Coiled-coil domain-containing protein 12 [Bos mutus]
Length=168

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 64/100 (64%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV    K  + +    P    +E
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEE  101

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  102  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_009926464.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Haliaeetus albicilla]
 ref|XP_010560164.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Haliaeetus leucocephalus]
Length=163

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 60/92 (65%), Gaps = 1/92 (1%)
 Frame = +2

Query  158  DQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLN  334
            D++E  ++ ++K RNY P+D+ L++ K+        +D + + L   + +   +E    N
Sbjct  17   DEEETVKHKELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKPEPIIDEVDLAN  76

Query  335  IAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
            +AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  77   LAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  108



>ref|XP_004283914.1| PREDICTED: coiled-coil domain-containing protein 12 [Orcinus 
orca]
Length=172

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 63/96 (66%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            + ++E +++ +++ RNY+P+D+ L++ ++  A P+    K  + +    P    +E +  
Sbjct  51   EGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPIAVEEKVKEQLEAAKPEPIIEEVD--  108

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  109  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  143



>gb|ELK10175.1| Coiled-coil domain-containing protein 12 [Pteropus alecto]
Length=148

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 62/97 (64%), Gaps = 7/97 (7%)
 Frame = +2

Query  161  QQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNEDPF  328
            ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +    
Sbjct  30   EEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVD---L  86

Query  329  LNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEE  439
             N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L  E
Sbjct  87   ANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRE  123



>ref|XP_008154223.1| PREDICTED: coiled-coil domain-containing protein 12 [Eptesicus 
fuscus]
Length=166

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 62/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +  
Sbjct  46   EGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVREQLEAAKPEPVIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_005223151.2| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Bos taurus]
Length=169

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 64/100 (64%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV    K  + +    P    +E
Sbjct  43   KQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEE  102

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  103  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  139



>ref|XP_003966144.1| PREDICTED: coiled-coil domain-containing protein 12-like [Takifugu 
rubripes]
Length=161

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 68/123 (55%), Gaps = 16/123 (13%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  304
            + K AS D      + ++K RNY P+D  L++ K+  A P  V  K  D +    P    
Sbjct  36   ESKKASIDGGVEVRHRELKLRNYTPEDDELKQRKVPNAKPASVEDKLKDQLEAANPEPII  95

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAED  466
            +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L      G EEE   LA  
Sbjct  96   EEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAELIRDRLRGSEEE---LAGA  149

Query  467  LGT  475
            +G 
Sbjct  150  VGA  152



>ref|XP_001641486.1| predicted protein [Nematostella vectensis]
 gb|EDO49423.1| predicted protein, partial [Nematostella vectensis]
Length=157

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 54/83 (65%), Gaps = 3/83 (4%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKL--APPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWD  361
            +KFRNY+P+D  L++ K+  A P L   ++   +L   +  K   E    N+AP+KP+WD
Sbjct  47   IKFRNYVPKDDELKDKKVPDAKP-LSVEEEVKDHLEKAKSDKVIEEVDLTNLAPRKPDWD  105

Query  362  LRRDVQKRLDKLEKRSLKALHQL  430
            L+RDV K+L+KLE+R+  A+ ++
Sbjct  106  LKRDVAKKLEKLERRTQSAIVEI  128



>ref|XP_007256563.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X1 
[Astyanax mexicanus]
 ref|XP_007256564.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Astyanax mexicanus]
Length=162

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 7/105 (7%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  304
            D K A  + +    +  +K RNY P+D+ L+E ++  A P  V  K  D +    P    
Sbjct  38   DSKRALDETEAEQRHRDLKLRNYTPEDEELKERQVPKAKPASVEDKVKDQLEAANPEPVI  97

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEE  439
            +E +     N+AP+KP+WDL+RDV K+L+KLEKR+ KA+ +L  E
Sbjct  98   EEVD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQKAIAELIRE  139



>ref|XP_005955215.1| PREDICTED: coiled-coil domain-containing protein 12 [Pantholops 
hodgsonii]
Length=168

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 62/94 (66%), Gaps = 7/94 (7%)
 Frame = +2

Query  161  QQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNEDPF  328
            ++E +++ +++ RNY+P+D+ L++ ++  A PV    K  + +    P    +E +    
Sbjct  48   EEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVD---L  104

Query  329  LNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  105  ANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>gb|EFA75691.1| mRNA splicing factor [Polysphondylium pallidum PN500]
Length=314

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKL----APPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPN  355
            +KFRNY+P+D  L + +L     PPV+ +  + +  L    + ++  E   ++  PKK N
Sbjct  209  LKFRNYVPRDISLTQYRLPKSKVPPVVEELLEKLKILESSAESQQSEES--ISFLPKKAN  266

Query  356  WDLRRDVQKRLDKLEKRSLKALHQL  430
            WDL+RDV+K+L KL+K++ +A++ L
Sbjct  267  WDLKRDVEKKLSKLDKKTNRAIYDL  291



>ref|XP_010816234.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X3 
[Bos taurus]
Length=164

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 64/100 (64%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L++ ++  A PV    K  + +    P    +E
Sbjct  38   KQLREGEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEE  97

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  98   VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  134



>ref|XP_007499795.1| PREDICTED: coiled-coil domain-containing protein 12 [Monodelphis 
domestica]
Length=120

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 7/89 (8%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            ++K RNY+P+D+ L++ K+  A P  V  K  D +    P    +E +     N+AP+KP
Sbjct  15   ELKLRNYVPEDEELKKRKVPQAKPASVEEKVKDQLEAAKPEPIIEEVD---LANLAPRKP  71

Query  353  NWDLRRDVQKRLDKLEKRSLKALHQLGEE  439
            +WDL+RDV K+L+KLEKR+ +A+ +L  E
Sbjct  72   DWDLKRDVAKKLEKLEKRTQRAIAELIRE  100



>gb|EST07333.1| hypothetical protein PSEUBRA_SCAF20g03109 [Pseudozyma brasiliensis 
GHG001]
Length=181

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 4/80 (5%)
 Frame = +2

Query  194  FRNYLP---QDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFL-NIAPKKPNWD  361
            FRNY P   Q K     +  P  + K  D +   T  QD+  + ED  L NIAPK+PNWD
Sbjct  42   FRNYDPITGQMKRFTSARDLPDTVEKDVDGLQQQTIAQDELRRQEDLDLDNIAPKRPNWD  101

Query  362  LRRDVQKRLDKLEKRSLKAL  421
            L+RD++KRL KLE+R  +A+
Sbjct  102  LKRDLEKRLKKLERRDKEAV  121



>gb|EPQ08394.1| Coiled-coil domain-containing protein 12 [Myotis brandtii]
Length=166

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVLP--KFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E
Sbjct  42   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVREQLEAAKPEPVIEE  101

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  102  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>gb|KHJ46962.1| hypothetical protein D918_02502 [Trichuris suis]
Length=165

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKL-APPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDL  364
            +KFRNY P D  L    +   P L   D+    L   +  +E  E    ++APKK +WDL
Sbjct  51   LKFRNYKPLDSELARFSVDLSPALDIADELREVLEEAKKFQEVEEIDLASLAPKKVDWDL  110

Query  365  RRDVQKRLDKLEKRSLKALHQL  430
            +RD QK+LDKLE+R+ KA+ +L
Sbjct  111  KRDAQKKLDKLERRTQKAIIEL  132



>emb|CBQ71313.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
Length=185

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 50/80 (63%), Gaps = 4/80 (5%)
 Frame = +2

Query  194  FRNYLP---QDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLN-IAPKKPNWD  361
            FRNY P   Q +     +  P  + K  + +   T  +D++ +NED  LN IAPK+PNWD
Sbjct  45   FRNYDPITGQIRRFTSARDLPDTVEKDVEGLQQQTIAEDERRRNEDLDLNNIAPKRPNWD  104

Query  362  LRRDVQKRLDKLEKRSLKAL  421
            L+RD++KRL KLE+R  +A+
Sbjct  105  LKRDLEKRLKKLERRDKEAV  124



>ref|XP_010773265.1| PREDICTED: coiled-coil domain-containing protein 12 [Notothenia 
coriiceps]
Length=163

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 70/123 (57%), Gaps = 16/123 (13%)
 Frame = +2

Query  137  DDKDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDK  304
            ++K AS ++     + ++K RNY P+D+ L+E ++  A P  V  K  D +    P    
Sbjct  38   ENKKASLEELPETRHRELKLRNYTPEDEELKERQVPKAKPASVEEKVKDQLEAANPEPII  97

Query  305  KEKNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAED  466
            +E +     N+AP+KP+WDL+RDV K+L+KLE+R+ + + +L      G EEE   LA  
Sbjct  98   EEVD---LANLAPRKPDWDLKRDVAKKLEKLERRTQRGIAELIRDRLRGSEEE---LAAA  151

Query  467  LGT  475
            +G 
Sbjct  152  VGA  154



>ref|XP_007883027.1| PREDICTED: coiled-coil domain-containing protein 12 [Callorhinchus 
milii]
Length=165

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 53/85 (62%), Gaps = 7/85 (8%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAP----PVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPN  355
            +K RNY+P+D  L+E ++      PV  K  + +    P    +E +     N+AP+KP+
Sbjct  57   LKLRNYVPEDVELKERQVPKARPVPVEEKVKEQLEAAKPNSIIEEVD---LANLAPRKPD  113

Query  356  WDLRRDVQKRLDKLEKRSLKALHQL  430
            WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  114  WDLKRDVAKKLEKLEKRTERAIAEL  138



>emb|CAG11969.1| unnamed protein product [Tetraodon nigroviridis]
Length=162

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 63/107 (59%), Gaps = 21/107 (20%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKE----  310
            K AS + +   ++ ++K RNY P+D+ L++ ++          P A  T  +DK +    
Sbjct  39   KKASLEGENGQKHRELKLRNYTPEDEELKQRQV----------PNAKPTAVEDKVKDQLD  88

Query  311  -KNEDPFL------NIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
              N +P +      N+AP+KP+WDL+RDV K+L+KLE+R+ +A+ +L
Sbjct  89   AANPEPIIEEVDLANLAPRKPDWDLKRDVAKKLEKLERRTQRAIAEL  135



>ref|XP_005075048.1| PREDICTED: coiled-coil domain-containing protein 12 [Mesocricetus 
auratus]
Length=166

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 62/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            ++++E+ ++  ++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +  
Sbjct  46   EEEEEDGKHRGLRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_003384885.1| PREDICTED: coiled-coil domain-containing protein 12-like [Amphimedon 
queenslandica]
Length=133

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 51/93 (55%), Gaps = 4/93 (4%)
 Frame = +2

Query  188  MKFRNYLPQDKHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKPNWDLR  367
            +KFRNY P  + L+E KL   +    ++ ++         +  E    N+APKK NWDL+
Sbjct  22   LKFRNYNPHTEDLKEKKLKRTMPESIENQVSEQIEAGGHSQVEEVNLSNLAPKKANWDLK  81

Query  368  RDVQKRLDKLEKRSLKALHQLGEEEEKRRLAED  466
            RD   +L+ LE+R+ KA+ +L  E    RL ED
Sbjct  82   RDTASKLEILERRTQKAIIELIRE----RLKED  110



>ref|XP_010281762.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Phaethon lepturus]
Length=219

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 64/104 (62%), Gaps = 10/104 (10%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKKPNWD  361
            ++K RNY P+D+ L++ K+        +D + + L   + +   +E    N+AP+KP+WD
Sbjct  110  ELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKPEPIIDEVDLANLAPRKPDWD  169

Query  362  LRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            L+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  170  LKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  210



>ref|XP_009979166.1| PREDICTED: coiled-coil domain-containing protein 12, partial 
[Tauraco erythrolophus]
Length=176

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 65/107 (61%), Gaps = 16/107 (15%)
 Frame = +2

Query  185  QMKFRNYLPQDKHLQEGKL--APP--VLPKFDDPMANLTPPQDKKEKNEDPFLNIAPKKP  352
            ++K RNY P+D+ L++ K+  A P  V  K  D +    P    +E +     N+AP+KP
Sbjct  67   ELKLRNYEPEDEELKKRKVPQAKPASVEDKVKDQLEAAKPEPIIEEVD---LANLAPRKP  123

Query  353  NWDLRRDVQKRLDKLEKRSLKALHQL------GEEEEKRRLAEDLGT  475
            +WDL+RDV K+L+KLEKR+ +A+ +L      G+EEE   LA  +G+
Sbjct  124  DWDLKRDVAKKLEKLEKRTQRAIAELIRERLKGQEEE---LASAVGS  167



>gb|EPY89395.1| coiled-coil domain-containing protein 12-like protein [Camelus 
ferus]
Length=221

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E
Sbjct  97   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPIIEE  156

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  157  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  193



>ref|XP_005348055.1| PREDICTED: coiled-coil domain-containing protein 12 [Microtus 
ochrogaster]
Length=166

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 62/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            ++++E+ ++  ++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +  
Sbjct  46   EEEEEDGKHRGLRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>gb|KIL00934.1| hypothetical protein PAXRUDRAFT_821140 [Paxillus rubicundulus 
Ve08.2h10]
Length=155

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 5/83 (6%)
 Frame = +2

Query  197  RNYLPQD----KHLQEGKLAPPVLPKFDDPMANLTPPQDKKEKNED-PFLNIAPKKPNWD  361
            RN+ P+     KH Q G L    + K  D M      +D++ + ++    NIAPK+PNWD
Sbjct  37   RNFDPETRTLRKHTQNGALTEDTIEKDVDGMVERIIVEDEQRRAQELDVFNIAPKRPNWD  96

Query  362  LRRDVQKRLDKLEKRSLKALHQL  430
            L+R+++K+L  LE+++ +A+H L
Sbjct  97   LKREMEKKLAGLERKTQEAIHTL  119



>dbj|GAM18895.1| hypothetical protein SAMD00019534_020700 [Acytostelium subglobosum 
LB1]
Length=381

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 61/101 (60%), Gaps = 12/101 (12%)
 Frame = +2

Query  167  ENDENFQMKFRNYLPQDKHLQEGKL----APPVLPKFDDPMANLTPPQDKKEKNEDPFLN  334
            E   +  +KFRNY P++  L + +L     PPV+ +    +A L   +      +D  L+
Sbjct  268  EETNHVGLKFRNYAPREATLVKYRLPKSKVPPVVEEI---LAKLQLLESGAANAQDD-LS  323

Query  335  IAPKKPNWDLRRDVQKRLDKLEKRSLKALHQLGEEEEKRRL  457
            + P+K NWDL+RDV+K+L+KLEKR+ +A+++L     K+RL
Sbjct  324  LMPRKANWDLKRDVEKKLNKLEKRTNRAIYELT----KKRL  360



>ref|XP_003504302.1| PREDICTED: coiled-coil domain-containing protein 12 [Cricetulus 
griseus]
 gb|EGV92162.1| Coiled-coil domain-containing protein 12 [Cricetulus griseus]
Length=166

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 62/96 (65%), Gaps = 7/96 (7%)
 Frame = +2

Query  155  QDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKEKNED  322
            ++++E+ ++  ++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E +  
Sbjct  46   EEEEEDGKHRGLRLRNYVPEDEDLKRRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVD--  103

Query  323  PFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
               N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  104  -LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  138



>ref|XP_790871.3| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
2 [Strongylocentrotus purpuratus]
 ref|XP_003728696.1| PREDICTED: coiled-coil domain-containing protein 12-like isoform 
1 [Strongylocentrotus purpuratus]
Length=167

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 53/83 (64%), Gaps = 1/83 (1%)
 Frame = +2

Query  194  FRNYLPQDKHLQEGKLAPPVLPKFDDPMAN-LTPPQDKKEKNEDPFLNIAPKKPNWDLRR  370
            F+NY P+D+ LQ+  +    +PK ++ + + L     +    E    N+AP+KP+WDL+R
Sbjct  52   FKNYKPEDESLQQHLVPQTEVPKVEEQVQDQLKAAVAEPVVEEVDITNLAPRKPDWDLKR  111

Query  371  DVQKRLDKLEKRSLKALHQLGEE  439
            DV K+L+KLE+R+ +A+ +L  E
Sbjct  112  DVAKKLEKLERRTQRAIAELIRE  134



>ref|XP_006770487.1| PREDICTED: coiled-coil domain-containing protein 12 isoform X2 
[Myotis davidii]
Length=211

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 63/100 (63%), Gaps = 7/100 (7%)
 Frame = +2

Query  143  KDASQDQQENDENFQMKFRNYLPQDKHLQEGKL--APPVL--PKFDDPMANLTPPQDKKE  310
            K   + ++E +++ +++ RNY+P+D+ L+  ++  A PV    K  + +    P    +E
Sbjct  87   KQLREGEEEGEKHRELRLRNYVPEDEDLKRRRVPQAKPVAVEEKVREQLEAAKPEPVIEE  146

Query  311  KNEDPFLNIAPKKPNWDLRRDVQKRLDKLEKRSLKALHQL  430
             +     N+AP+KP+WDL+RDV K+L+KLEKR+ +A+ +L
Sbjct  147  VD---LANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAEL  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380