BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN041H06

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009599766.1|  PREDICTED: PRA1 family protein F2-like             240   1e-76   Nicotiana tomentosiformis
ref|XP_009758614.1|  PREDICTED: PRA1 family protein F2-like             231   7e-73   Nicotiana sylvestris
ref|XP_007024460.1|  PRA1 family protein                                225   7e-70   
ref|XP_002279772.1|  PREDICTED: PRA1 family protein F2-like             215   1e-66   Vitis vinifera
ref|XP_006342996.1|  PREDICTED: PRA1 family protein F3-like             214   3e-66   Solanum tuberosum [potatoes]
ref|XP_008228312.1|  PREDICTED: PRA1 family protein F3-like             211   2e-65   Prunus mume [ume]
gb|EYU21385.1|  hypothetical protein MIMGU_mgv1a021099mg                211   3e-65   Erythranthe guttata [common monkey flower]
emb|CDO97926.1|  unnamed protein product                                209   2e-64   Coffea canephora [robusta coffee]
ref|XP_004235608.1|  PREDICTED: PRA1 family protein F3-like             208   3e-64   Solanum lycopersicum
ref|XP_009342076.1|  PREDICTED: PRA1 family protein F3-like             208   5e-64   Pyrus x bretschneideri [bai li]
gb|KJB18536.1|  hypothetical protein B456_003G059900                    207   1e-63   Gossypium raimondii
ref|XP_010062605.1|  PREDICTED: PRA1 family protein F2-like             206   2e-63   Eucalyptus grandis [rose gum]
ref|XP_011072497.1|  PREDICTED: PRA1 family protein F2-like             206   2e-63   Sesamum indicum [beniseed]
ref|NP_001235529.1|  uncharacterized protein LOC100526887               206   4e-63   Glycine max [soybeans]
gb|KDP40791.1|  hypothetical protein JCGZ_24790                         206   4e-63   Jatropha curcas
ref|XP_003543600.1|  PREDICTED: PRA1 family protein F3-like             205   6e-63   Glycine max [soybeans]
gb|KJB70275.1|  hypothetical protein B456_011G066300                    205   7e-63   Gossypium raimondii
ref|XP_004486817.1|  PREDICTED: PRA1 family protein F3-like             204   1e-62   Cicer arietinum [garbanzo]
ref|XP_008462362.1|  PREDICTED: PRA1 family protein F3                  204   3e-62   Cucumis melo [Oriental melon]
ref|XP_006426510.1|  hypothetical protein CICLE_v10027379mg             201   2e-61   Citrus clementina [clementine]
ref|XP_010242191.1|  PREDICTED: PRA1 family protein F3-like             200   8e-61   Nelumbo nucifera [Indian lotus]
gb|KGN45534.1|  hypothetical protein Csa_7G451400                       199   2e-60   
ref|XP_006466052.1|  PREDICTED: PRA1 family protein F2-like             194   1e-58   Citrus sinensis [apfelsine]
ref|XP_010251988.1|  PREDICTED: PRA1 family protein F2-like             195   1e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008447601.1|  PREDICTED: PRA1 family protein F2-like             193   4e-58   Cucumis melo [Oriental melon]
ref|XP_006300164.1|  hypothetical protein CARUB_v10016395mg             192   1e-57   Capsella rubella
gb|ADN34104.1|  cytochrome p450                                         202   3e-57   Cucumis melo subsp. melo
ref|XP_003633114.1|  PREDICTED: PRA1 family protein F3                  189   8e-57   Vitis vinifera
ref|XP_007150535.1|  hypothetical protein PHAVU_005G160500g             189   2e-56   Phaseolus vulgaris [French bean]
ref|XP_003597623.1|  PRA1 family protein F2                             188   2e-56   Medicago truncatula
ref|XP_002527418.1|  conserved hypothetical protein                     188   4e-56   Ricinus communis
ref|XP_004298557.1|  PREDICTED: PRA1 family protein F2                  187   6e-56   Fragaria vesca subsp. vesca
ref|XP_011007090.1|  PREDICTED: PRA1 family protein F3-like             186   2e-55   Populus euphratica
ref|NP_564679.1|  protein PRA7                                          184   8e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501126.1|  PREDICTED: PRA1 family protein F2-like             183   3e-54   Camelina sativa [gold-of-pleasure]
emb|CDY26125.1|  BnaC06g10710D                                          182   6e-54   Brassica napus [oilseed rape]
ref|XP_006305837.1|  hypothetical protein CARUB_v10010880mg             182   7e-54   Capsella rubella
ref|XP_002891819.1|  prenylated rab acceptor family protein             182   1e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_006392675.1|  hypothetical protein EUTSA_v10011807mg             181   1e-53   Eutrema salsugineum [saltwater cress]
ref|XP_010440813.1|  PREDICTED: PRA1 family protein F2                  179   9e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010480042.1|  PREDICTED: PRA1 family protein F2-like             179   1e-52   Camelina sativa [gold-of-pleasure]
gb|KEH18334.1|  PRA1 family protein                                     178   2e-52   Medicago truncatula
ref|XP_010501087.1|  PREDICTED: PRA1 family protein F3-like             177   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_003529735.1|  PREDICTED: PRA1 family protein F2-like isofo...    176   1e-51   Glycine max [soybeans]
ref|XP_010487141.1|  PREDICTED: PRA1 family protein F3-like             175   3e-51   Camelina sativa [gold-of-pleasure]
gb|KGN59828.1|  hypothetical protein Csa_3G848860                       175   4e-51   
ref|XP_010552207.1|  PREDICTED: PRA1 family protein F3-like             174   8e-51   Tarenaya hassleriana [spider flower]
ref|XP_006299764.1|  hypothetical protein CARUB_v10015960mg             172   3e-50   Capsella rubella
ref|XP_008782551.1|  PREDICTED: PRA1 family protein F3-like             172   4e-50   Phoenix dactylifera
emb|CDY23634.1|  BnaC05g39600D                                          172   5e-50   Brassica napus [oilseed rape]
gb|KJB83061.1|  hypothetical protein B456_013G227900                    172   6e-50   Gossypium raimondii
ref|XP_010465233.1|  PREDICTED: PRA1 family protein F3-like             171   2e-49   Camelina sativa [gold-of-pleasure]
emb|CDX97509.1|  BnaA05g25700D                                          170   2e-49   
ref|XP_010465232.1|  PREDICTED: PRA1 family protein F3-like             170   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010535226.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...    180   6e-49   
ref|NP_187984.1|  RNA-binding family protein                            169   6e-49   Arabidopsis thaliana [mouse-ear cress]
gb|EPS63055.1|  hypothetical protein M569_11731                         169   8e-49   Genlisea aurea
ref|XP_010487142.1|  PREDICTED: PRA1 family protein F3                  169   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002884984.1|  hypothetical protein ARALYDRAFT_897614             169   1e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_010501099.1|  PREDICTED: PRA1 family protein F3-like             168   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_009107086.1|  PREDICTED: PRA1 family protein F2-like             168   3e-48   Brassica rapa
emb|CDY08228.1|  BnaA05g13910D                                          167   3e-48   Brassica napus [oilseed rape]
emb|CDY33064.1|  BnaC06g07150D                                          167   5e-48   Brassica napus [oilseed rape]
ref|XP_009147522.1|  PREDICTED: LOW QUALITY PROTEIN: PRA1 family ...    167   7e-48   Brassica rapa
ref|XP_006385351.1|  hypothetical protein POPTR_0003s02980g             167   8e-48   Populus trichocarpa [western balsam poplar]
ref|XP_007135562.1|  hypothetical protein PHAVU_010G139900g             166   1e-47   Phaseolus vulgaris [French bean]
ref|XP_003533013.1|  PREDICTED: PRA1 family protein F2-like             165   2e-47   Glycine max [soybeans]
ref|XP_002455006.1|  hypothetical protein SORBIDRAFT_03g002890          165   3e-47   Sorghum bicolor [broomcorn]
ref|XP_004146852.1|  PREDICTED: LOW QUALITY PROTEIN: 3-epi-6-deox...    176   3e-47   
ref|XP_004154871.1|  PREDICTED: 3-epi-6-deoxocathasterone 23-mono...    176   4e-47   
ref|XP_010915238.1|  PREDICTED: PRA1 family protein F3                  165   5e-47   Elaeis guineensis
ref|XP_009146459.1|  PREDICTED: PRA1 family protein F3                  164   5e-47   Brassica rapa
gb|KFK38692.1|  hypothetical protein AALP_AA3G147800                    164   9e-47   Arabis alpina [alpine rockcress]
ref|XP_010501077.1|  PREDICTED: PRA1 family protein F3-like             164   1e-46   
emb|CDY24050.1|  BnaA06g00480D                                          164   1e-46   Brassica napus [oilseed rape]
ref|XP_010487140.1|  PREDICTED: PRA1 family protein F3-like             163   2e-46   
ref|XP_009371229.1|  PREDICTED: PRA1 family protein F3-like             163   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_010686079.1|  PREDICTED: PRA1 family protein F3-like             163   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004968524.1|  PREDICTED: PRA1 family protein F3-like isofo...    162   3e-46   Setaria italica
ref|NP_566461.1|  prenylated RAB acceptor 1.F3                          162   5e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66945.1|  unknown                                                 162   5e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDM81515.1|  unnamed protein product                                162   7e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010465226.1|  PREDICTED: PRA1 family protein F3-like             161   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004510362.1|  PREDICTED: PRA1 family protein F3-like             160   2e-45   Cicer arietinum [garbanzo]
gb|AAY18432.1|  prenylated rab acceptor family protein                  159   4e-45   Noccaea caerulescens
ref|XP_008390975.1|  PREDICTED: PRA1 family protein F2-like             160   4e-45   
emb|CDY37483.1|  BnaC01g37490D                                          159   7e-45   Brassica napus [oilseed rape]
ref|XP_007203351.1|  hypothetical protein PRUPE_ppa020384mg             158   3e-44   
ref|XP_008242408.1|  PREDICTED: PRA1 family protein F2-like             158   3e-44   
ref|XP_003597622.1|  PRA1 family protein F2                             157   4e-44   Medicago truncatula
gb|KFK38720.1|  hypothetical protein AALP_AA3G151200                    157   4e-44   Arabis alpina [alpine rockcress]
ref|XP_006838852.1|  hypothetical protein AMTR_s00002p00265420          157   6e-44   
ref|XP_002514139.1|  conserved hypothetical protein                     157   8e-44   Ricinus communis
ref|XP_010274188.1|  PREDICTED: PRA1 family protein F3-like             155   4e-43   Nelumbo nucifera [Indian lotus]
ref|XP_009353727.1|  PREDICTED: PRA1 family protein F2-like             154   4e-43   Pyrus x bretschneideri [bai li]
ref|XP_008786098.1|  PREDICTED: PRA1 family protein F3-like             154   6e-43   
ref|XP_008337698.1|  PREDICTED: PRA1 family protein F2-like             153   2e-42   
emb|CDY51735.1|  BnaA01g37180D                                          152   3e-42   Brassica napus [oilseed rape]
ref|XP_010923472.1|  PREDICTED: PRA1 family protein F3-like             151   1e-41   Elaeis guineensis
ref|XP_009388477.1|  PREDICTED: PRA1 family protein F2-like             150   5e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936306.1|  PREDICTED: PRA1 family protein F3-like             149   5e-41   Elaeis guineensis
emb|CAN73850.1|  hypothetical protein VITISV_021777                     148   2e-40   Vitis vinifera
ref|XP_009352640.1|  PREDICTED: PRA1 family protein F2-like             148   2e-40   
ref|XP_009407747.1|  PREDICTED: PRA1 family protein F2-like             148   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009117519.1|  PREDICTED: PRA1 family protein F3-like             147   3e-40   Brassica rapa
ref|XP_008805952.1|  PREDICTED: PRA1 family protein F3-like             147   4e-40   Phoenix dactylifera
ref|XP_010660142.1|  PREDICTED: PRA1 family protein E                   147   4e-40   Vitis vinifera
ref|NP_001148484.1|  prenylated rab acceptor family protein             146   7e-40   Zea mays [maize]
ref|XP_011032390.1|  PREDICTED: PRA1 family protein E-like              146   1e-39   Populus euphratica
ref|XP_004135817.1|  PREDICTED: PRA1 family protein F2-like             145   1e-39   Cucumis sativus [cucumbers]
ref|XP_009408855.1|  PREDICTED: PRA1 family protein F3-like             145   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010278145.1|  PREDICTED: PRA1 family protein F3-like             144   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_008450846.1|  PREDICTED: PRA1 family protein C                   144   7e-39   Cucumis melo [Oriental melon]
ref|XP_006382806.1|  prenylated rab acceptor family protein             144   8e-39   
ref|XP_010667330.1|  PREDICTED: PRA1 family protein F3-like             144   1e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006407177.1|  hypothetical protein EUTSA_v10021584mg             142   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_009785504.1|  PREDICTED: PRA1 family protein F3                  142   2e-38   Nicotiana sylvestris
dbj|BAJ94157.1|  predicted protein                                      142   3e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002300800.1|  hypothetical protein POPTR_0002s04490g             141   6e-38   Populus trichocarpa [western balsam poplar]
gb|KFK43954.1|  hypothetical protein AALP_AA1G196100                    140   1e-37   Arabis alpina [alpine rockcress]
ref|XP_011028734.1|  PREDICTED: PRA1 family protein F2-like             140   1e-37   Populus euphratica
emb|CDP03174.1|  unnamed protein product                                139   3e-37   Coffea canephora [robusta coffee]
ref|XP_011026037.1|  PREDICTED: PRA1 family protein F2-like             139   3e-37   Populus euphratica
ref|XP_010519211.1|  PREDICTED: PRA1 family protein F1                  139   4e-37   Tarenaya hassleriana [spider flower]
ref|XP_007200543.1|  hypothetical protein PRUPE_ppa011712mg             139   4e-37   
ref|XP_009385403.1|  PREDICTED: PRA1 family protein F2-like             140   5e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008235318.1|  PREDICTED: PRA1 family protein F2-like             139   6e-37   Prunus mume [ume]
ref|XP_011038559.1|  PREDICTED: PRA1 family protein E-like              139   6e-37   Populus euphratica
ref|XP_006854893.1|  hypothetical protein AMTR_s00052p00041770          138   9e-37   Amborella trichopoda
ref|XP_004288927.1|  PREDICTED: PRA1 family protein F3-like             137   2e-36   Fragaria vesca subsp. vesca
gb|ACN40786.1|  unknown                                                 137   2e-36   Picea sitchensis
ref|XP_007152983.1|  hypothetical protein PHAVU_004G176600g             137   2e-36   Phaseolus vulgaris [French bean]
ref|XP_006416675.1|  hypothetical protein EUTSA_v10009485mg             136   3e-36   Eutrema salsugineum [saltwater cress]
ref|XP_010106674.1|  hypothetical protein L484_004546                   134   6e-36   
ref|XP_003530196.1|  PREDICTED: PRA1 family protein F2-like isofo...    136   6e-36   Glycine max [soybeans]
ref|XP_003620939.1|  PRA1 family protein F2                             136   7e-36   Medicago truncatula
ref|XP_008372317.1|  PREDICTED: PRA1 family protein E-like              136   7e-36   
ref|XP_009385825.1|  PREDICTED: PRA1 family protein F3-like             135   8e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO68524.1|  hypothetical protein CISIN_1g028921mg                   136   9e-36   Citrus sinensis [apfelsine]
ref|XP_004156493.1|  PREDICTED: PRA1 family protein E-like              135   2e-35   
ref|XP_006451445.1|  hypothetical protein CICLE_v10010325mg             135   2e-35   
ref|XP_010553757.1|  PREDICTED: PRA1 family protein E-like              135   2e-35   Tarenaya hassleriana [spider flower]
gb|KDO57741.1|  hypothetical protein CISIN_1g043789mg                   134   2e-35   Citrus sinensis [apfelsine]
ref|XP_008802843.1|  PREDICTED: PRA1 family protein F3-like             135   3e-35   Phoenix dactylifera
ref|XP_008456115.1|  PREDICTED: PRA1 family protein E                   134   3e-35   Cucumis melo [Oriental melon]
ref|XP_003517620.1|  PREDICTED: PRA1 family protein F2-like             134   4e-35   Glycine max [soybeans]
ref|XP_010043255.1|  PREDICTED: PRA1 family protein E-like              134   4e-35   Eucalyptus grandis [rose gum]
ref|XP_004139244.1|  PREDICTED: PRA1 family protein E-like              134   4e-35   Cucumis sativus [cucumbers]
ref|XP_004513103.1|  PREDICTED: PRA1 family protein F2-like             134   4e-35   Cicer arietinum [garbanzo]
ref|XP_002307629.1|  hypothetical protein POPTR_0005s24060g             133   9e-35   Populus trichocarpa [western balsam poplar]
gb|KHN40329.1|  PRA1 family protein F2                                  135   1e-34   Glycine soja [wild soybean]
ref|XP_002531279.1|  Prenylated Rab acceptor protein, putative          133   1e-34   Ricinus communis
ref|XP_003564938.1|  PREDICTED: PRA1 family protein F3-like             131   4e-34   Brachypodium distachyon [annual false brome]
ref|XP_011026036.1|  PREDICTED: PRA1 family protein F2-like             131   6e-34   Populus euphratica
gb|KDP21357.1|  hypothetical protein JCGZ_21828                         130   1e-33   Jatropha curcas
ref|XP_006443903.1|  hypothetical protein CICLE_v10022315mg             130   1e-33   
emb|CDP06825.1|  unnamed protein product                                131   2e-33   Coffea canephora [robusta coffee]
ref|XP_002284210.1|  PREDICTED: PRA1 family protein E-like              129   3e-33   Vitis vinifera
ref|XP_011028739.1|  PREDICTED: PRA1 family protein F2-like             129   3e-33   Populus euphratica
ref|XP_010917587.1|  PREDICTED: PRA1 family protein F2-like             129   3e-33   Elaeis guineensis
gb|KDO54396.1|  hypothetical protein CISIN_1g029094mg                   127   1e-32   Citrus sinensis [apfelsine]
ref|XP_006487784.1|  PREDICTED: PRA1 family protein E-like              127   1e-32   Citrus sinensis [apfelsine]
ref|XP_011457975.1|  PREDICTED: PRA1 family protein F2-like             127   1e-32   Fragaria vesca subsp. vesca
ref|XP_002890244.1|  prenylated rab acceptor family protein             127   1e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_009117647.1|  PREDICTED: PRA1 family protein F1-like             127   2e-32   Brassica rapa
gb|KJB27196.1|  hypothetical protein B456_004G284100                    126   2e-32   Gossypium raimondii
gb|KJB80571.1|  hypothetical protein B456_013G104700                    126   2e-32   Gossypium raimondii
ref|XP_006424007.1|  hypothetical protein CICLE_v10029308mg             127   3e-32   Citrus clementina [clementine]
ref|XP_009364486.1|  PREDICTED: PRA1 family protein E-like              127   4e-32   Pyrus x bretschneideri [bai li]
ref|XP_007050406.1|  PRA1 family protein                                125   4e-32   
ref|XP_009354891.1|  PREDICTED: PRA1 family protein F2-like             126   5e-32   Pyrus x bretschneideri [bai li]
gb|KFK43188.1|  hypothetical protein AALP_AA1G091300                    125   8e-32   Arabis alpina [alpine rockcress]
emb|CDX81845.1|  BnaC08g37560D                                          124   1e-31   
ref|XP_010475691.1|  PREDICTED: PRA1 family protein E                   125   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010102283.1|  hypothetical protein L484_024565                   125   1e-31   Morus notabilis
ref|XP_009793326.1|  PREDICTED: PRA1 family protein F3-like             124   1e-31   Nicotiana sylvestris
ref|XP_006305929.1|  hypothetical protein CARUB_v10011150mg             125   1e-31   
ref|XP_011042410.1|  PREDICTED: PRA1 family protein F2-like             125   1e-31   Populus euphratica
emb|CDY06788.1|  BnaC01g08870D                                          124   2e-31   
dbj|BAK01798.1|  predicted protein                                      124   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006304207.1|  hypothetical protein CARUB_v10010304mg             125   2e-31   Capsella rubella
ref|XP_009149225.1|  PREDICTED: PRA1 family protein F1                  124   2e-31   Brassica rapa
ref|XP_003568763.2|  PREDICTED: PRA1 family protein F3-like             125   2e-31   Brachypodium distachyon [annual false brome]
emb|CDY59501.1|  BnaC05g50010D                                          124   2e-31   Brassica napus [oilseed rape]
ref|XP_011078199.1|  PREDICTED: PRA1 family protein F2-like             124   3e-31   Sesamum indicum [beniseed]
emb|CDY26225.1|  BnaA06g11920D                                          124   3e-31   Brassica napus [oilseed rape]
ref|XP_010458140.1|  PREDICTED: PRA1 family protein E-like              124   3e-31   Camelina sativa [gold-of-pleasure]
gb|KEH23866.1|  PRA1 family protein                                     123   5e-31   Medicago truncatula
ref|XP_007215981.1|  hypothetical protein PRUPE_ppa011673mg             123   7e-31   
ref|XP_008388683.1|  PREDICTED: PRA1 family protein E-like              123   9e-31   Malus domestica [apple tree]
ref|XP_010489355.1|  PREDICTED: PRA1 family protein E-like              122   1e-30   Camelina sativa [gold-of-pleasure]
gb|AAT44309.1|  hypothetical protein                                    122   2e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010523568.1|  PREDICTED: PRA1 family protein C                   121   3e-30   
ref|XP_009128592.1|  PREDICTED: PRA1 family protein C                   121   3e-30   Brassica rapa
ref|XP_002300798.1|  hypothetical protein POPTR_0002s04470g             121   3e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006417650.1|  hypothetical protein EUTSA_v10008786mg             121   3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010025011.1|  PREDICTED: PRA1 family protein F2-like             121   4e-30   Eucalyptus grandis [rose gum]
ref|XP_002520992.1|  conserved hypothetical protein                     119   1e-29   Ricinus communis
ref|XP_009148131.1|  PREDICTED: PRA1 family protein E                   120   1e-29   Brassica rapa
ref|XP_004495611.1|  PREDICTED: PRA1 family protein E-like              119   1e-29   Cicer arietinum [garbanzo]
ref|XP_010100086.1|  hypothetical protein L484_005760                   119   2e-29   Morus notabilis
ref|XP_003556473.1|  PREDICTED: PRA1 family protein E-like              119   2e-29   Glycine max [soybeans]
ref|XP_004960927.1|  PREDICTED: PRA1 family protein F2-like             119   2e-29   Setaria italica
gb|EYU46500.1|  hypothetical protein MIMGU_mgv1a014374mg                119   3e-29   Erythranthe guttata [common monkey flower]
emb|CAN60779.1|  hypothetical protein VITISV_032147                     117   6e-29   Vitis vinifera
emb|CDX93539.1|  BnaA06g05090D                                          118   7e-29   
gb|EPS62668.1|  hypothetical protein M569_12125                         116   9e-29   Genlisea aurea
ref|XP_008382944.1|  PREDICTED: PRA1 family protein F2-like             117   9e-29   
ref|XP_006589185.1|  PREDICTED: PRA1 family protein E-like              116   2e-28   Glycine max [soybeans]
ref|XP_007144698.1|  hypothetical protein PHAVU_007G177600g             116   2e-28   Phaseolus vulgaris [French bean]
ref|XP_011459633.1|  PREDICTED: PRA1 family protein F3-like             115   2e-28   Fragaria vesca subsp. vesca
ref|XP_009381867.1|  PREDICTED: PRA1 family protein F3-like             117   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007144834.1|  hypothetical protein PHAVU_007G188100g             115   3e-28   Phaseolus vulgaris [French bean]
ref|XP_003559867.1|  PREDICTED: PRA1 family protein B6-like             117   3e-28   Brachypodium distachyon [annual false brome]
ref|NP_173212.1|  prenylated RAB acceptor 1.F1                          115   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003632302.1|  PREDICTED: PRA1 family protein E                   115   6e-28   Vitis vinifera
ref|XP_010476929.1|  PREDICTED: PRA1 family protein F1 isoform X1       114   8e-28   Camelina sativa [gold-of-pleasure]
dbj|BAD73317.1|  hypothetical protein                                   114   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042294.2|  Os01g0196500                                       114   1e-27   
gb|EAY96881.1|  hypothetical protein OsI_18804                          115   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_010528804.1|  PREDICTED: PRA1 family protein E-like              115   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_011471000.1|  PREDICTED: PRA1 family protein F3-like             112   3e-27   Fragaria vesca subsp. vesca
ref|XP_004495288.1|  PREDICTED: PRA1 family protein D-like              112   4e-27   Cicer arietinum [garbanzo]
gb|KEH42613.1|  PRA1 family protein                                     112   7e-27   Medicago truncatula
ref|XP_010459377.1|  PREDICTED: PRA1 family protein F1-like             112   8e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010433077.1|  PREDICTED: PRA1 family protein C-like              112   9e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010447827.1|  PREDICTED: PRA1 family protein C-like              111   1e-26   Camelina sativa [gold-of-pleasure]
emb|CDX95035.1|  BnaC05g06360D                                          112   1e-26   
gb|EPS67895.1|  hypothetical protein M569_06879                         110   2e-26   Genlisea aurea
ref|XP_010038888.1|  PREDICTED: PRA1 family protein E-like              110   2e-26   Eucalyptus grandis [rose gum]
ref|XP_009367738.1|  PREDICTED: PRA1 family protein F2-like             110   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_004230088.1|  PREDICTED: PRA1 family protein F3                  111   3e-26   Solanum lycopersicum
ref|XP_006351632.1|  PREDICTED: PRA1 family protein F3-like             110   3e-26   Solanum tuberosum [potatoes]
ref|XP_011079997.1|  PREDICTED: PRA1 family protein E-like              110   4e-26   Sesamum indicum [beniseed]
ref|XP_007223565.1|  hypothetical protein PRUPE_ppa012254mg             110   4e-26   Prunus persica
ref|XP_011076644.1|  PREDICTED: PRA1 family protein B1                  110   7e-26   Sesamum indicum [beniseed]
gb|KJB38282.1|  hypothetical protein B456_006G246200                    109   7e-26   Gossypium raimondii
ref|XP_009348289.1|  PREDICTED: PRA1 family protein D                   109   9e-26   Pyrus x bretschneideri [bai li]
ref|XP_004288430.1|  PREDICTED: PRA1 family protein D-like              108   1e-25   Fragaria vesca subsp. vesca
ref|XP_010543179.1|  PREDICTED: PRA1 family protein B5                  109   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_006347739.1|  PREDICTED: PRA1 family protein E-like              109   1e-25   
ref|XP_011087386.1|  PREDICTED: PRA1 family protein E                   108   1e-25   Sesamum indicum [beniseed]
ref|XP_008218278.1|  PREDICTED: PRA1 family protein E                   109   1e-25   Prunus mume [ume]
ref|XP_009614805.1|  PREDICTED: PRA1 family protein E-like              109   1e-25   Nicotiana tomentosiformis
ref|XP_006489511.1|  PREDICTED: PRA1 family protein D-like              108   2e-25   Citrus sinensis [apfelsine]
gb|KJB44891.1|  hypothetical protein B456_007G278100                    108   2e-25   Gossypium raimondii
ref|XP_006828134.1|  hypothetical protein AMTR_s00023p00056460          108   3e-25   Amborella trichopoda
ref|XP_007205894.1|  hypothetical protein PRUPE_ppa011351mg             108   3e-25   Prunus persica
ref|XP_008369306.1|  PREDICTED: PRA1 family protein B1-like             108   3e-25   Malus domestica [apple tree]
ref|XP_004249063.1|  PREDICTED: PRA1 family protein B4-like             108   3e-25   Solanum lycopersicum
ref|XP_006363615.1|  PREDICTED: PRA1 family protein B4-like             108   3e-25   Solanum tuberosum [potatoes]
ref|XP_007034966.1|  CAMV movement protein interacting protein 7,...    107   4e-25   
gb|ABK22744.1|  unknown                                                 107   6e-25   Picea sitchensis
gb|KDO53910.1|  hypothetical protein CISIN_1g029745mg                   107   7e-25   Citrus sinensis [apfelsine]
ref|XP_009369228.1|  PREDICTED: PRA1 family protein B1-like             107   9e-25   Pyrus x bretschneideri [bai li]
ref|XP_009350692.1|  PREDICTED: PRA1 family protein B1-like             107   9e-25   Pyrus x bretschneideri [bai li]
ref|XP_004247221.1|  PREDICTED: PRA1 family protein F3-like             106   1e-24   Solanum lycopersicum
ref|XP_011095073.1|  PREDICTED: PRA1 family protein B4                  107   1e-24   Sesamum indicum [beniseed]
ref|XP_003520584.1|  PREDICTED: PRA1 family protein F2-like             106   1e-24   
ref|XP_006420100.1|  hypothetical protein CICLE_v10005568mg             108   1e-24   
ref|XP_010534630.1|  PREDICTED: PRA1 family protein B1-like             106   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_006411049.1|  hypothetical protein EUTSA_v10017219mg             107   2e-24   
gb|KEH43008.1|  PRA1 (prenylated RAB acceptor) family protein           106   2e-24   Medicago truncatula
ref|XP_009763688.1|  PREDICTED: PRA1 family protein E-like              106   2e-24   Nicotiana sylvestris
ref|XP_010257015.1|  PREDICTED: PRA1 family protein B1-like             106   2e-24   Nelumbo nucifera [Indian lotus]
emb|CDX72173.1|  BnaC08g27010D                                          105   3e-24   
ref|XP_009116308.1|  PREDICTED: PRA1 family protein B1                  105   3e-24   Brassica rapa
gb|EYU22670.1|  hypothetical protein MIMGU_mgv1a014766mg                105   3e-24   Erythranthe guttata [common monkey flower]
ref|NP_563826.1|  prenylated RAB acceptor 1.E                           105   3e-24   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ84996.1|  predicted protein                                      106   3e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006575043.1|  PREDICTED: PRA1 family protein F3-like isofo...    104   5e-24   Glycine max [soybeans]
ref|XP_004493866.1|  PREDICTED: PRA1 family protein E-like              105   5e-24   
ref|XP_010674849.1|  PREDICTED: PRA1 family protein E                   104   9e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM66031.1|  unknown                                                 104   9e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150209.1|  prenylated rab acceptor family protein             103   1e-23   
emb|CDX80758.1|  BnaC03g00120D                                          104   1e-23   
ref|XP_002889714.1|  prenylated rab acceptor family protein             104   1e-23   Arabidopsis lyrata subsp. lyrata
gb|EAY76346.1|  hypothetical protein OsI_04281                          104   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_006575042.1|  PREDICTED: PRA1 family protein F3-like isofo...    103   2e-23   
gb|AFW77446.1|  prenylated rab acceptor family protein                  103   2e-23   
ref|XP_008370709.1|  PREDICTED: PRA1 family protein E-like              103   2e-23   
ref|XP_010505459.1|  PREDICTED: PRA1 family protein B4                  103   2e-23   
ref|XP_006575041.1|  PREDICTED: PRA1 family protein F3-like isofo...    103   2e-23   
ref|XP_003518889.2|  PREDICTED: PRA1 family protein F3-like isofo...    102   2e-23   
emb|CDY43514.1|  BnaA01g07300D                                          102   2e-23   
gb|KCW82492.1|  hypothetical protein EUGRSUZ_C03888                     101   2e-23   
ref|XP_006575044.1|  PREDICTED: PRA1 family protein F3-like isofo...    102   2e-23   
ref|XP_010517128.1|  PREDICTED: PRA1 family protein B4-like             103   2e-23   
ref|XP_001761817.1|  predicted protein                                  102   3e-23   
emb|CDY55133.1|  BnaC01g44750D                                          103   3e-23   
ref|XP_009597143.1|  PREDICTED: PRA1 family protein B4-like             103   4e-23   
ref|NP_001278575.1|  prenylated Rab receptor 2                          104   4e-23   
ref|XP_008792185.1|  PREDICTED: PRA1 family protein B3-like             103   4e-23   
gb|ACG42493.1|  prenylated Rab receptor 2                               104   4e-23   
ref|XP_004981823.1|  PREDICTED: PRA1 family protein E-like              103   4e-23   
ref|XP_006369925.1|  hypothetical protein POPTR_0001s35110g             100   4e-23   
ref|XP_002466479.1|  hypothetical protein SORBIDRAFT_01g008530          104   5e-23   
ref|XP_004961768.1|  PREDICTED: PRA1 family protein B2-like             102   6e-23   
ref|XP_009133249.1|  PREDICTED: PRA1 family protein B4                  102   6e-23   
ref|XP_006285006.1|  hypothetical protein CARUB_v10006313mg             101   7e-23   
ref|XP_003564517.1|  PREDICTED: PRA1 family protein B2                  102   7e-23   
emb|CDY07736.1|  BnaA03g17750D                                          102   8e-23   
ref|XP_004240888.1|  PREDICTED: PRA1 family protein B3-like             102   8e-23   
ref|XP_011468905.1|  PREDICTED: PRA1 family protein F3-like             100   9e-23   
ref|XP_002881589.1|  prenylated rab acceptor family protein             102   9e-23   
ref|XP_009595327.1|  PREDICTED: PRA1 family protein F3-like             101   9e-23   
gb|KFK36733.1|  hypothetical protein AALP_AA4G162600                    102   1e-22   
ref|XP_006353416.1|  PREDICTED: PRA1 family protein B3-like             101   1e-22   
ref|XP_010504496.1|  PREDICTED: PRA1 family protein B1-like             101   1e-22   
ref|XP_010516213.1|  PREDICTED: PRA1 family protein B1-like             101   1e-22   
ref|XP_010509184.1|  PREDICTED: PRA1 family protein B4-like             101   2e-22   
ref|XP_002440768.1|  hypothetical protein SORBIDRAFT_09g006240          100   2e-22   
gb|ACG26194.1|  prenylated Rab receptor 2                               101   2e-22   
ref|NP_181370.1|  prenylated RAB acceptor 1.B4                          101   2e-22   
ref|XP_009103980.1|  PREDICTED: PRA1 family protein B1                  101   2e-22   
gb|KHN32915.1|  PRA1 family protein F2                                99.8    2e-22   
gb|EPS71420.1|  hypothetical protein M569_03332                         101   2e-22   
emb|CDY31997.1|  BnaC06g15750D                                          100   2e-22   
ref|XP_010427419.1|  PREDICTED: PRA1 family protein B1                  100   2e-22   
ref|XP_007141724.1|  hypothetical protein PHAVU_008G219900g             100   2e-22   
ref|NP_001131454.1|  uncharacterized LOC100192789                       100   2e-22   
ref|NP_191170.1|  PRA1 family protein B1                                100   3e-22   
ref|XP_006583576.1|  PREDICTED: PRA1 family protein F2-like isofo...  99.4    3e-22   
emb|CDX67633.1|  BnaA07g16730D                                          100   3e-22   
gb|AAK96760.1|  putative protein                                        100   4e-22   
gb|KFK24670.1|  hypothetical protein AALP_AA8G009700                    100   4e-22   
ref|XP_009130635.1|  PREDICTED: PRA1 family protein B5                  100   5e-22   
ref|XP_002878068.1|  prenylated rab acceptor family protein             100   5e-22   
emb|CDP13961.1|  unnamed protein product                                100   5e-22   
ref|XP_006293512.1|  hypothetical protein CARUB_v10024028mg             100   5e-22   
ref|NP_001141134.1|  uncharacterized protein LOC100273220               100   6e-22   
ref|XP_006414416.1|  hypothetical protein EUTSA_v10026292mg           99.4    6e-22   
emb|CDY63156.1|  BnaCnng41520D                                        99.8    6e-22   
ref|XP_010556885.1|  PREDICTED: PRA1 family protein D-like            99.0    7e-22   
gb|EPS63119.1|  hypothetical protein M569_11668                       99.8    7e-22   
gb|EYU41963.1|  hypothetical protein MIMGU_mgv1a013549mg              99.8    7e-22   
ref|XP_008442368.1|  PREDICTED: PRA1 family protein B4                99.8    8e-22   
ref|XP_011077517.1|  PREDICTED: PRA1 family protein B2-like           99.4    8e-22   
emb|CDP13637.1|  unnamed protein product                              99.4    8e-22   
ref|XP_006292268.1|  hypothetical protein CARUB_v10018477mg           99.4    9e-22   
ref|XP_006414585.1|  hypothetical protein EUTSA_v10027277mg           98.6    1e-21   
ref|XP_004970426.1|  PREDICTED: PRA1 family protein B2-like           99.0    1e-21   
ref|XP_003604521.1|  PRA1 family protein B4                           99.0    1e-21   
ref|XP_003568255.1|  PREDICTED: PRA1 family protein B2                99.0    2e-21   
ref|XP_011084858.1|  PREDICTED: PRA1 family protein B3                98.6    2e-21   
ref|XP_008456893.1|  PREDICTED: PRA1 family protein B1                98.6    2e-21   
ref|XP_009618776.1|  PREDICTED: PRA1 family protein B1-like           98.6    2e-21   
ref|XP_009785829.1|  PREDICTED: PRA1 family protein B1                98.6    2e-21   
gb|KDP40277.1|  hypothetical protein JCGZ_02275                       97.8    2e-21   
ref|XP_008776288.1|  PREDICTED: PRA1 family protein B3-like           98.2    2e-21   
ref|XP_004145378.1|  PREDICTED: PRA1 family protein F2-like           97.8    2e-21   
ref|XP_004146458.1|  PREDICTED: PRA1 family protein B4-like           98.2    2e-21   
ref|XP_003519415.1|  PREDICTED: PRA1 family protein B3-like           98.2    2e-21   
ref|XP_011461445.1|  PREDICTED: PRA1 family protein B1-like           98.2    2e-21   
gb|EYU20069.1|  hypothetical protein MIMGU_mgv1a013751mg              98.2    2e-21   
ref|XP_004166118.1|  PREDICTED: PRA1 family protein B1-like           98.2    2e-21   
ref|XP_003545676.1|  PREDICTED: PRA1 family protein B3-like           98.2    2e-21   
ref|NP_001149099.1|  prenylated Rab receptor 2                        98.2    2e-21   
ref|XP_006399002.1|  hypothetical protein EUTSA_v10014647mg           98.2    3e-21   
ref|XP_008449347.1|  PREDICTED: PRA1 family protein E-like            97.4    3e-21   
ref|XP_002985528.1|  hypothetical protein SELMODRAFT_271785           97.8    3e-21   
ref|XP_004304751.1|  PREDICTED: PRA1 family protein E                 97.4    3e-21   
ref|XP_008378859.1|  PREDICTED: PRA1 family protein D-like            97.1    3e-21   
ref|XP_010522500.1|  PREDICTED: PRA1 family protein D-like            97.1    3e-21   
ref|XP_003516984.1|  PREDICTED: PRA1 family protein B4-like           97.8    4e-21   
ref|XP_009776314.1|  PREDICTED: PRA1 family protein B4-like           97.4    4e-21   
ref|XP_002316187.2|  hypothetical protein POPTR_0010s19060g           97.4    5e-21   
ref|XP_009394448.1|  PREDICTED: PRA1 family protein E-like            97.4    5e-21   
ref|XP_004506814.1|  PREDICTED: PRA1 family protein B4-like           97.4    5e-21   
emb|CDY51733.1|  BnaA01g37160D                                        97.1    6e-21   
ref|XP_006857574.1|  hypothetical protein AMTR_s00061p00074170        96.3    6e-21   
gb|KJB17122.1|  hypothetical protein B456_002G266500                  97.1    7e-21   
ref|XP_004171358.1|  PREDICTED: LOW QUALITY PROTEIN: PRA1 family ...  96.3    8e-21   
gb|AAV65110.1|  prenylated Rab acceptor protein 1                     97.1    8e-21   
ref|XP_006398598.1|  hypothetical protein EUTSA_v10014660mg           96.7    8e-21   
ref|XP_011015289.1|  PREDICTED: PRA1 family protein B3-like           96.7    8e-21   
ref|NP_001055824.1|  Os05g0474400                                     96.7    9e-21   
ref|XP_009117530.1|  PREDICTED: PRA1 family protein F3-like           96.7    9e-21   
ref|XP_002871155.1|  prenylated rab receptor 2                        96.7    9e-21   
ref|XP_010064658.1|  PREDICTED: PRA1 family protein G2                96.7    9e-21   
ref|XP_010087030.1|  hypothetical protein L484_012274                 96.7    1e-20   
ref|NP_196157.1|  prenylated RAB acceptor 1.B3                        96.7    1e-20   
ref|XP_007205873.1|  hypothetical protein PRUPE_ppa011227mg           96.3    1e-20   
ref|XP_002520799.1|  Prenylated Rab acceptor protein, putative        96.3    1e-20   
ref|XP_002870908.1|  hypothetical protein ARALYDRAFT_907986           96.3    1e-20   
emb|CAC80645.1|  prenylated Rab receptor 2                            96.3    1e-20   
gb|KHN18062.1|  PRA1 family protein F2                                94.4    1e-20   
ref|XP_008231866.1|  PREDICTED: PRA1 family protein B1-like           96.3    1e-20   
ref|XP_002517019.1|  conserved hypothetical protein                   95.5    1e-20   
ref|XP_007139499.1|  hypothetical protein PHAVU_008G034800g           96.3    1e-20   
ref|XP_004246300.1|  PREDICTED: PRA1 family protein B4-like           95.9    2e-20   
ref|XP_009625141.1|  PREDICTED: PRA1 family protein B4-like           95.9    2e-20   
gb|KJB39866.1|  hypothetical protein B456_007G034500                  95.9    2e-20   
ref|XP_010539358.1|  PREDICTED: PRA1 family protein G2                95.1    2e-20   
ref|XP_010937957.1|  PREDICTED: PRA1 family protein B3-like           95.5    2e-20   
ref|XP_002458702.1|  hypothetical protein SORBIDRAFT_03g038560        95.9    2e-20   
ref|XP_008799810.1|  PREDICTED: LOW QUALITY PROTEIN: PRA1 family ...  95.9    2e-20   
ref|XP_001779406.1|  predicted protein                                95.5    2e-20   
ref|XP_006360827.1|  PREDICTED: PRA1 family protein B4-like           95.5    2e-20   
ref|XP_006403022.1|  hypothetical protein EUTSA_v10006389mg           99.8    3e-20   
ref|XP_003522195.1|  PREDICTED: PRA1 family protein B4-like isofo...  95.5    3e-20   
ref|XP_002466127.1|  hypothetical protein SORBIDRAFT_01g001896        95.5    3e-20   
ref|XP_006303636.1|  hypothetical protein CARUB_v10011583mg           94.4    3e-20   
gb|AFW67670.1|  prenylated Rab receptor 2                             97.1    3e-20   
ref|XP_010508872.1|  PREDICTED: PRA1 family protein B2-like           95.1    4e-20   
ref|XP_003536921.1|  PREDICTED: PRA1 family protein F4-like           94.4    4e-20   
ref|XP_007134641.1|  hypothetical protein PHAVU_010G064200g           95.1    4e-20   
emb|CDX74794.1|  BnaA05g05400D                                        94.7    4e-20   
ref|XP_010087768.1|  hypothetical protein L484_016338                 94.0    5e-20   
ref|XP_004134100.1|  PREDICTED: PRA1 family protein D-like isoform 2  93.6    5e-20   
ref|XP_010475076.1|  PREDICTED: PRA1 family protein D-like            94.0    5e-20   
ref|XP_009143219.1|  PREDICTED: PRA1 family protein B2                94.4    5e-20   
ref|XP_004134099.1|  PREDICTED: PRA1 family protein D-like isoform 1  93.6    7e-20   
ref|XP_010457464.1|  PREDICTED: PRA1 family protein D-like            93.6    7e-20   
ref|XP_009122148.1|  PREDICTED: PRA1 family protein B3                94.4    7e-20   
ref|XP_004491001.1|  PREDICTED: PRA1 family protein B3-like           94.4    7e-20   
gb|KFK24961.1|  hypothetical protein AALP_AA8G048000                  94.4    8e-20   
ref|XP_006286631.1|  hypothetical protein CARUB_v10002469mg           94.4    8e-20   
ref|XP_010091875.1|  hypothetical protein L484_009490                 94.4    8e-20   
ref|XP_010931302.1|  PREDICTED: PRA1 family protein B1-like           94.4    9e-20   
gb|AES99672.2|  PRA1 (prenylated RAB acceptor) family protein         94.0    9e-20   
ref|XP_010921045.1|  PREDICTED: PRA1 family protein B3                94.0    1e-19   
ref|XP_010490534.1|  PREDICTED: PRA1 family protein B5                94.0    1e-19   
gb|KDO63269.1|  hypothetical protein CISIN_1g027328mg                 94.0    1e-19   
ref|XP_006429493.1|  hypothetical protein CICLE_v10012679mg           94.0    1e-19   
emb|CDY37482.1|  BnaC01g37500D                                        93.6    1e-19   
ref|XP_010483331.1|  PREDICTED: PRA1 family protein D                 92.8    1e-19   
ref|XP_010505766.1|  PREDICTED: PRA1 family protein B2                93.6    1e-19   
gb|EPS71008.1|  hypothetical protein M569_03754                       92.8    1e-19   
ref|NP_175960.1|  prenylated RAB acceptor 1.G1                        92.8    1e-19   
gb|EEE64069.1|  hypothetical protein OsJ_18899                        93.2    2e-19   
ref|XP_009354542.1|  PREDICTED: PRA1 family protein B2-like           93.2    2e-19   
ref|XP_004307693.1|  PREDICTED: PRA1 family protein B3                92.8    2e-19   
ref|XP_003616714.1|  PRA1 family protein B1                           93.6    2e-19   
ref|XP_002867398.1|  hypothetical protein ARALYDRAFT_328749           93.6    2e-19   
ref|XP_002892203.1|  hypothetical protein ARALYDRAFT_470402           91.7    3e-19   
ref|XP_001770471.1|  predicted protein                                92.4    3e-19   
ref|XP_010451960.1|  PREDICTED: PRA1 family protein B5-like           92.4    3e-19   
gb|KFK31706.1|  hypothetical protein AALP_AA6G148400                  91.7    3e-19   
gb|AAM63905.1|  unknown                                               91.7    3e-19   
ref|NP_195784.1|  prenylated RAB acceptor 1.B5                        92.4    3e-19   
ref|XP_002950258.1|  hypothetical protein VOLCADRAFT_109754           92.0    4e-19   
ref|NP_563704.1|  CAMV movement protein interacting protein 7         91.7    4e-19   
ref|XP_010423975.1|  PREDICTED: PRA1 family protein B5-like           92.0    4e-19   
ref|XP_011080754.1|  PREDICTED: PRA1 family protein B3-like           91.7    5e-19   
ref|XP_006295924.1|  hypothetical protein CARUB_v10025061mg           91.7    5e-19   
ref|XP_006435830.1|  hypothetical protein CICLE_v10032726mg           91.7    6e-19   
gb|EMT06364.1|  hypothetical protein F775_18081                       91.7    6e-19   
ref|XP_010685880.1|  PREDICTED: PRA1 family protein B1-like           91.3    6e-19   
ref|XP_006604485.1|  PREDICTED: PRA1 family protein F2-like           91.3    7e-19   
emb|CAB45326.1|  putative protein                                     92.0    7e-19   
ref|XP_010517458.1|  PREDICTED: PRA1 family protein B2-like           91.3    8e-19   
gb|KFK25105.1|  hypothetical protein AALP_AA8G066700                  91.3    8e-19   
ref|XP_010676826.1|  PREDICTED: PRA1 family protein B4-like           91.3    8e-19   
emb|CDM84823.1|  unnamed protein product                              90.9    1e-18   
ref|XP_006418148.1|  hypothetical protein EUTSA_v10008893mg           90.1    1e-18   
gb|EPS65964.1|  hypothetical protein M569_08816                       90.5    1e-18   
ref|XP_002265177.2|  PREDICTED: PRA1 family protein G2                90.1    1e-18   
ref|XP_009117509.1|  PREDICTED: PRA1 family protein F3-like           90.5    1e-18   
ref|XP_008804151.1|  PREDICTED: PRA1 family protein B3                90.5    2e-18   
gb|EYU26695.1|  hypothetical protein MIMGU_mgv1a023436mg              90.1    2e-18   
ref|XP_009397086.1|  PREDICTED: PRA1 family protein B4-like           90.1    2e-18   
gb|KJB36978.1|  hypothetical protein B456_006G185300                  90.1    2e-18   
gb|KJB67504.1|  hypothetical protein B456_010G193900                  90.1    2e-18   
ref|XP_006407178.1|  hypothetical protein EUTSA_v10022079mg           88.2    3e-18   
ref|XP_007162504.1|  hypothetical protein PHAVU_001G157500g           89.4    3e-18   
ref|XP_006411294.1|  hypothetical protein EUTSA_v10017233mg           89.4    4e-18   
ref|XP_011004639.1|  PREDICTED: PRA1 family protein B1                89.0    4e-18   
ref|XP_001757970.1|  predicted protein                                88.6    6e-18   
emb|CAN71154.1|  hypothetical protein VITISV_022651                   88.2    6e-18   
ref|XP_010529079.1|  PREDICTED: PRA1 family protein B4                89.0    6e-18   
gb|ABA91101.1|  PRA1 family protein, expressed                        88.6    7e-18   
gb|KJB22192.1|  hypothetical protein B456_004G034400                  88.2    7e-18   
gb|EAY79659.1|  hypothetical protein OsI_34804                        88.6    7e-18   
ref|XP_004137695.1|  PREDICTED: PRA1 family protein B4-like           88.6    9e-18   
ref|XP_008464234.1|  PREDICTED: PRA1 family protein B2                88.2    9e-18   
ref|XP_010543701.1|  PREDICTED: PRA1 family protein B3                88.6    1e-17   
ref|XP_002463733.1|  hypothetical protein SORBIDRAFT_01g005080        88.2    1e-17   
ref|NP_001065546.2|  Os11g0107600                                     88.2    1e-17   
ref|XP_009121289.1|  PREDICTED: PRA1 family protein G2                87.4    1e-17   
ref|NP_200434.1|  PRA1 family protein G2                              87.0    1e-17   
ref|XP_006654537.1|  PREDICTED: PRA1 family protein B1-like           87.8    1e-17   
ref|XP_006644938.1|  PREDICTED: PRA1 family protein B2-like           87.8    1e-17   
ref|XP_002311249.1|  prenylated rab acceptor family protein           87.8    1e-17   
gb|KDP36310.1|  hypothetical protein JCGZ_09525                       87.8    2e-17   
dbj|BAD43491.1|  unknown protein                                      87.0    2e-17   
emb|CDY32804.1|  BnaA10g10450D                                        87.0    2e-17   
ref|XP_003061635.1|  predicted protein                                87.0    2e-17   
ref|XP_010480106.1|  PREDICTED: PRA1 family protein G1-like           86.7    2e-17   
ref|XP_010692914.1|  PREDICTED: PRA1 family protein B3-like           87.0    2e-17   
ref|NP_181569.1|  prenylated RAB acceptor 1.B2                        87.0    3e-17   
ref|XP_002881719.1|  prenylated rab acceptor family protein           86.7    3e-17   
ref|XP_010501183.1|  PREDICTED: PRA1 family protein G1                86.3    3e-17   
gb|ABK92549.1|  unknown                                               86.7    4e-17   
ref|XP_004302605.1|  PREDICTED: PRA1 family protein B4                86.3    5e-17   
emb|CDX86646.1|  BnaC08g00570D                                        85.5    5e-17   
ref|XP_005848060.1|  hypothetical protein CHLNCDRAFT_145270           86.3    5e-17   
ref|XP_002891847.1|  prenylated rab acceptor family protein           85.5    5e-17   
emb|CDY18870.1|  BnaC04g04800D                                        85.9    6e-17   
gb|EYU43446.1|  hypothetical protein MIMGU_mgv1a013754mg              85.9    6e-17   



>ref|XP_009599766.1| PREDICTED: PRA1 family protein F2-like [Nicotiana tomentosiformis]
Length=182

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 158/186 (85%), Gaps = 4/186 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT YGTIPTSSS  A++EYISR KERIKEGLG RRPW+EMFNFHS+ LPS  +DA+SRIK
Sbjct  1    MTNYGTIPTSSSGPANVEYISRAKERIKEGLGTRRPWKEMFNFHSLNLPSGVNDAISRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN++YF+MNYA++VL I+FLSLLWH ISLIVF+ LMA WLFLYFLRDEPL+I GRLI+DR
Sbjct  61   TNISYFQMNYAIIVLGIVFLSLLWHTISLIVFIVLMAIWLFLYFLRDEPLVIFGRLISDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
            VVLIVLSV TI +LLFTNAT+NILISL V  VVVL+H + RKTDDLF DEE+  FL   A
Sbjct  121  VVLIVLSVFTIAMLLFTNATSNILISLAVAVVVVLIHASIRKTDDLFMDEEAAGFL--RA  178

Query  581  PSAPSS  598
            P  PSS
Sbjct  179  P--PSS  182



>ref|XP_009758614.1| PREDICTED: PRA1 family protein F2-like [Nicotiana sylvestris]
Length=182

 Score =   231 bits (588),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 154/186 (83%), Gaps = 4/186 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT YGTIPTSSS  A++EYISR K+RIKEGLG RRPW+EMFNFHS+ LPS  +DA+SRIK
Sbjct  1    MTNYGTIPTSSSGPANVEYISRAKDRIKEGLGTRRPWKEMFNFHSLNLPSGVNDAISRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN++YF+MNYA+V L I+FLSLLWH ISLIVF+ LMA WLFLYFLRDEPL++ GRLI+DR
Sbjct  61   TNISYFQMNYAIVALGIVFLSLLWHAISLIVFLVLMALWLFLYFLRDEPLVVFGRLISDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
            VVLIVL V TI +LL TNAT+NILISL V  VVVL+H + RKTDDLF DEE   FL   A
Sbjct  121  VVLIVLFVFTIGMLLLTNATSNILISLAVAVVVVLIHASIRKTDDLFMDEEDAGFL--RA  178

Query  581  PSAPSS  598
            P  PSS
Sbjct  179  P--PSS  182



>ref|XP_007024460.1| PRA1 family protein [Theobroma cacao]
 gb|EOY27082.1| PRA1 family protein [Theobroma cacao]
Length=244

 Score =   225 bits (573),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = +2

Query  29   SPENMTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHD  202
             P+NM +YGTIPTSSS G   +LEY+SR KERIKEGLG RRPW+ MFN  SI  P N  +
Sbjct  55   QPKNMASYGTIPTSSSPGPATNLEYLSRAKERIKEGLGTRRPWKLMFNIRSINFPGNLSE  114

Query  203  AVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVG  382
            A+SR++TN+AYFRMNYA++VL +LFLSLLWHPISLIVF+ +MAAWLFLYFLRDEP+++  
Sbjct  115  AISRVRTNVAYFRMNYAIIVLFVLFLSLLWHPISLIVFIVMMAAWLFLYFLRDEPIVVFS  174

Query  383  RLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            R I+DRVVLIVL V TIV LL T+AT NIL+S+L+G V++LVH   R+TDDL+ DEES A
Sbjct  175  RTIDDRVVLIVLGVLTIVFLLLTHATLNILVSVLIGVVIILVHATLRRTDDLY-DEESAA  233

Query  563  FLAGHAPSAPS  595
             + G  PS+ S
Sbjct  234  LMTGTGPSSSS  244



>ref|XP_002279772.1| PREDICTED: PRA1 family protein F2-like [Vitis vinifera]
Length=193

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA-SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            MTTYGTIPTSS+  + SLE++SR KER++ GL  RRPW+EMFN  SIGLP NF DAV+R+
Sbjct  1    MTTYGTIPTSSAGDSPSLEFVSRAKERLRSGLATRRPWKEMFNIRSIGLPINFPDAVNRV  60

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            KTN+++FRMNY ++VL+ILFLSLLWHPISLIVF+ +MA WLFLYFLRDEPL++  R I+D
Sbjct  61   KTNISFFRMNYVIIVLLILFLSLLWHPISLIVFIVMMAVWLFLYFLRDEPLVVFHRTIDD  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGH  577
            RVVLIVL + TIV LL T+AT NIL+SLL+G  VV++H AFRKTDDLF DEE+ +  AG 
Sbjct  121  RVVLIVLLILTIVFLLLTHATLNILVSLLIGVAVVVLHAAFRKTDDLFLDEEAAS--AGG  178

Query  578  APSAPSS  598
              + P S
Sbjct  179  LLTTPGS  185



>ref|XP_006342996.1| PREDICTED: PRA1 family protein F3-like [Solanum tuberosum]
Length=182

 Score =   214 bits (544),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 151/186 (81%), Gaps = 4/186 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT YGTIPTSSS   ++E+ISR K+ +KEGL  RRPW+EMFNFHS  LPS   DA+SRIK
Sbjct  1    MTNYGTIPTSSSGPVNVEFISRAKDVLKEGLAARRPWKEMFNFHSFNLPSGVSDAISRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN ++F+ NYA+VVLVI+FLSLLWHPISLIVF+ LMA WLFLYFLRDEPL+I GRLI+DR
Sbjct  61   TNFSFFQTNYAIVVLVIVFLSLLWHPISLIVFIVLMAVWLFLYFLRDEPLVIFGRLISDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
            VVLIVLSV T+ LLLFT AT+NILI+L VG  VVL+H   RKTDDLF DEES  FL    
Sbjct  121  VVLIVLSVLTLALLLFTGATSNILIALAVGVFVVLIHALIRKTDDLFLDEESAGFLR---  177

Query  581  PSAPSS  598
             SAPSS
Sbjct  178  -SAPSS  182



>ref|XP_008228312.1| PREDICTED: PRA1 family protein F3-like [Prunus mume]
Length=187

 Score =   211 bits (538),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 150/187 (80%), Gaps = 1/187 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSA-GASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            MTTYGTIPTSSS  G S EYISR KERIK GLG RRPW+ MFNF S   PS F +   RI
Sbjct  1    MTTYGTIPTSSSTQGPSGEYISRAKERIKAGLGARRPWKLMFNFRSFNFPSPFREVFGRI  60

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            ++N+AYFRMNYA+V+L+ILFLSLLWHPISLIVF+ +MAAWLFLYFLRDEPL++ G+ ++D
Sbjct  61   RSNVAYFRMNYAIVMLLILFLSLLWHPISLIVFIIMMAAWLFLYFLRDEPLVLFGKTVDD  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGH  577
            RVVLIVL+V TIVLL  T+AT NIL++LL+G V+V+VH   RKTDDLF DEE+   L   
Sbjct  121  RVVLIVLAVVTIVLLFLTHATVNILVALLIGVVLVVVHAGLRKTDDLFVDEENSGLLTTP  180

Query  578  APSAPSS  598
            A S+ S+
Sbjct  181  AASSSST  187



>gb|EYU21385.1| hypothetical protein MIMGU_mgv1a021099mg [Erythranthe guttata]
Length=184

 Score =   211 bits (537),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 146/180 (81%), Gaps = 3/180 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG---ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MTTYGTIPTSSS     A+LEYISR KERI+EGLG RRPWREMF+ H + LP +F +AV+
Sbjct  1    MTTYGTIPTSSSPSGTPANLEYISRAKERIREGLGDRRPWREMFDVHCLSLPRSFREAVA  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            R+KTN  YF MNYA+V LVI+F SL+WHPISLIVF A++A WLFLYFLRDEPL++ GRLI
Sbjct  61   RVKTNFGYFTMNYAIVFLVIMFFSLIWHPISLIVFAAMVAVWLFLYFLRDEPLVVFGRLI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLA  571
            +D+VVLIVLS+ TI +LLFT A ANIL +LL G VVVL+H A RKTD L  DEE+ A L+
Sbjct  121  SDKVVLIVLSILTIGVLLFTGAIANILGALLGGVVVVLIHAAVRKTDSLGGDEEAAAGLS  180



>emb|CDO97926.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 155/174 (89%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS-LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            MTTYGTIPTSS  G++ LEYI+R KERIKEGLG RRPWREMFNFHSI LP +F DA++RI
Sbjct  1    MTTYGTIPTSSGGGSTRLEYITRAKERIKEGLGTRRPWREMFNFHSIRLPPSFRDALARI  60

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            KTN++YF MNYA+VVLVILFLSLLWHPISLIVF+ +MAAWLFLYFLRDEPL+I GRLIND
Sbjct  61   KTNVSYFSMNYAIVVLVILFLSLLWHPISLIVFIVMMAAWLFLYFLRDEPLVIFGRLIND  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            RVVLIVLSV TIVLLL T+AT NIL+SLL+GAVVVL+H A RKT+DL  DEE+ 
Sbjct  121  RVVLIVLSVLTIVLLLLTHATVNILVSLLIGAVVVLIHAALRKTEDLM-DEEAA  173



>ref|XP_004235608.1| PREDICTED: PRA1 family protein F3-like [Solanum lycopersicum]
Length=182

 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 149/186 (80%), Gaps = 4/186 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT YGTIPTSSS   ++E+ISR K+ +KEGL  RRPW+EMFNFHS  LPS   DA+SRIK
Sbjct  1    MTNYGTIPTSSSGPVNVEFISRAKDVLKEGLAARRPWKEMFNFHSFNLPSGVSDAISRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN ++F+ NYA++VLVI+FLSLLWHPISLIVF+ LMA WLFLYFLRDEPL+I GRLI+D 
Sbjct  61   TNFSFFQTNYAIIVLVIVFLSLLWHPISLIVFIVLMAIWLFLYFLRDEPLVIFGRLISDS  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
             VLIVLSV T+ LLLFT AT+NILISL VG  VVL+H + RKTDDLF DEE   FL    
Sbjct  121  TVLIVLSVLTLALLLFTGATSNILISLAVGVFVVLIHASIRKTDDLFLDEEGAGFLR---  177

Query  581  PSAPSS  598
             SAPSS
Sbjct  178  -SAPSS  182



>ref|XP_009342076.1| PREDICTED: PRA1 family protein F3-like [Pyrus x bretschneideri]
Length=186

 Score =   208 bits (529),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 150/185 (81%), Gaps = 2/185 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSS--AGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MTTYGTIPTSSS   G S EYISR K+RI+ GLG RRPW+ MFNF S   PS+F DA  +
Sbjct  1    MTTYGTIPTSSSSSQGPSGEYISRAKDRIRAGLGARRPWKLMFNFRSFNFPSSFSDAFGQ  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            +++N+AYFRMNYA+VVL+ILFLSLLWHPISLIVFV +MAAWLFLYFLRDEPL++ G+ ++
Sbjct  61   VRSNVAYFRMNYAIVVLLILFLSLLWHPISLIVFVVMMAAWLFLYFLRDEPLVLFGKTVD  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            DRVVLIVL+V TIVLL  T+AT NIL++LL+G V+V+ H A RKTDDL  DEE+ A L  
Sbjct  121  DRVVLIVLAVVTIVLLFLTHATVNILVALLIGVVLVIAHAALRKTDDLPVDEENSALLTT  180

Query  575  HAPSA  589
             A S+
Sbjct  181  PASSS  185



>gb|KJB18536.1| hypothetical protein B456_003G059900 [Gossypium raimondii]
Length=185

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 158/188 (84%), Gaps = 7/188 (4%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YGTIPTSS+ G  A++EY+SR KERIKEGLG RRPW+ MFNFHSI  P N  +A++R
Sbjct  1    MTNYGTIPTSSTPGPSANIEYLSRAKERIKEGLGARRPWKLMFNFHSINFPGNLSEAITR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            ++TN+AYFRMNYA++VL+ILFLSLLWHPISL+VFVA+MAAWLFLYFLRDEPL++  R I+
Sbjct  61   VRTNVAYFRMNYAMIVLLILFLSLLWHPISLLVFVAMMAAWLFLYFLRDEPLVVFRRTID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            DRVVL+VL V TI+ LL T+AT NIL+SLL+GAVVVLVH +FR+TDDL+ DEESG  L  
Sbjct  121  DRVVLVVLGVLTILFLLLTDATTNILVSLLIGAVVVLVHASFRRTDDLY-DEESGEGLI-  178

Query  575  HAPSAPSS  598
               S PSS
Sbjct  179  ---SGPSS  183



>ref|XP_010062605.1| PREDICTED: PRA1 family protein F2-like [Eucalyptus grandis]
 gb|KCW69742.1| hypothetical protein EUGRSUZ_F03124 [Eucalyptus grandis]
Length=189

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 148/176 (84%), Gaps = 2/176 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSA--GASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MTTYGTIP SSS+   A+LEYI+R KERI+ GL  RRPW+ MF+F ++ LP+NF DA+SR
Sbjct  1    MTTYGTIPASSSSTPAANLEYIARAKERIRSGLAERRPWKLMFDFRALRLPANFPDALSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            ++TNL++FR NYA+V L+ILFLSLLWHPISLIVF+ +MAAWLFLYFLRDEPL++ GR I+
Sbjct  61   VRTNLSFFRTNYAMVFLLILFLSLLWHPISLIVFIVMMAAWLFLYFLRDEPLVVFGRTID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DRV+L V+SV TIV LL T+AT NIL+++L+GAVVV++H A RKTDDL  DEE+  
Sbjct  121  DRVILAVMSVLTIVFLLLTHATVNILVAILIGAVVVVLHAAMRKTDDLSGDEEAAG  176



>ref|XP_011072497.1| PREDICTED: PRA1 family protein F2-like [Sesamum indicum]
Length=189

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 150/179 (84%), Gaps = 3/179 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG---ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MT YGTIPTSSS      +LEYISR KER+K GLG RRPWREMF+ H   LP +FH+AV+
Sbjct  1    MTNYGTIPTSSSPSGPPVNLEYISRAKERLKAGLGTRRPWREMFDIHCFNLPKSFHEAVA  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            R++TN+AYFRMNYA+VVL+ILFLSLLWHPISLIVF+A+M  WLFLYFLRDEPL+I GRLI
Sbjct  61   RVRTNIAYFRMNYAIVVLLILFLSLLWHPISLIVFIAMMVVWLFLYFLRDEPLVIFGRLI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            +D+VVLIVL+V TI++LL T AT NIL SLLVG VVVL+H A RKTDDLFADEE+   L
Sbjct  121  SDQVVLIVLAVVTIIVLLLTRATTNILSSLLVGVVVVLIHAAIRKTDDLFADEEAAGGL  179



>ref|NP_001235529.1| uncharacterized protein LOC100526887 [Glycine max]
 gb|ACU15896.1| unknown [Glycine max]
Length=184

 Score =   206 bits (523),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT YGTIPTSS+   +LE+ISR K+R+KEGLG RRPW+ MFNF S  LP+   DAVSR++
Sbjct  1    MTNYGTIPTSSTPSTNLEFISRAKQRVKEGLGTRRPWKLMFNFRSFALPAGVGDAVSRVR  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N++YF+MNYA+VVL++LFLSLLWHPISLIVFV LMAAWLFLYFLRDEPLII GRLI+DR
Sbjct  61   ENISYFQMNYAIVVLIVLFLSLLWHPISLIVFVVLMAAWLFLYFLRDEPLIIFGRLISDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
            VVLIV++V T+VLLL T A  NIL++LL+GAV+V+ H A RKTDDLF DEE    L+   
Sbjct  121  VVLIVMAVLTVVLLLLTGAIGNILVALLIGAVLVVAHAALRKTDDLFFDEEEATRLS--P  178

Query  581  PSAPSS  598
            P AP S
Sbjct  179  PGAPLS  184



>gb|KDP40791.1| hypothetical protein JCGZ_24790 [Jatropha curcas]
Length=197

 Score =   206 bits (524),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS--LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MTTYGTIPTS+S GA+  LEYISR KERIKEGLG RRPW+ MFNF S+GLP++  +A+ R
Sbjct  1    MTTYGTIPTSTSPGATTKLEYISRAKERIKEGLGYRRPWKLMFNFRSLGLPASLAEAMVR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            +KTN+AYFRMNYA+++L+ILFLSLLWHPISLIVF+ +MAAWLFLYFLRDEPL++ GR I+
Sbjct  61   VKTNVAYFRMNYAIIILIILFLSLLWHPISLIVFIVMMAAWLFLYFLRDEPLVVFGRTID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            DRVV+I L V TIV LL T  T N+L+SLLVG VVV+VH   R+TDDLF DEE+   +
Sbjct  121  DRVVMIALGVLTIVFLLLTRVTLNVLVSLLVGVVVVVVHAIIRRTDDLFLDEEATGLM  178



>ref|XP_003543600.1| PREDICTED: PRA1 family protein F3-like [Glycine max]
Length=184

 Score =   205 bits (522),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT YGTIPTSSS   +L++ISR K+R+KEGLG RRPW+ MFNF S GLP+   DAV+R++
Sbjct  1    MTNYGTIPTSSSPSTNLDFISRAKQRVKEGLGTRRPWKLMFNFRSFGLPAGVGDAVARVR  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N++YF+MNYA+VVL++LFLSLLWHPISLIVFV LMAAWLFLYFLRDEPLII GRLI+DR
Sbjct  61   ENISYFQMNYAIVVLIVLFLSLLWHPISLIVFVVLMAAWLFLYFLRDEPLIIFGRLISDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
            VVLIV++V T+VLLL T A  NIL++LL+GAV+++ H A RKTDDLF DEE     +   
Sbjct  121  VVLIVMAVLTVVLLLLTGAIGNILVALLIGAVLIVAHAALRKTDDLFLDEEEATGFS--P  178

Query  581  PSAPSS  598
            P AP S
Sbjct  179  PGAPLS  184



>gb|KJB70275.1| hypothetical protein B456_011G066300 [Gossypium raimondii]
Length=182

 Score =   205 bits (521),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 148/183 (81%), Gaps = 1/183 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIP S+   A+LEY+SR KERIK+GLG R PW+ MFN HS+  P  F +A+SR +
Sbjct  1    MTTYGTIPASTLPSANLEYLSRAKERIKDGLGARHPWKLMFNIHSLNCPRTFSEAISRFR  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             NLAYFRMNYA++VL+ILFLSLLWHPISL+V + +MA WLFLYFLRDEPL I  R I+DR
Sbjct  61   ANLAYFRMNYAIIVLLILFLSLLWHPISLVVLIIMMALWLFLYFLRDEPLAIFNRTIDDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
            VVL+VL V+T V LL T+AT+NIL+S+++GAVVVLVH + R+TDDL+ DEES   ++G +
Sbjct  121  VVLVVLGVSTFVFLLLTDATSNILVSVMIGAVVVLVHASLRRTDDLY-DEESTGLVSGPS  179

Query  581  PSA  589
             S+
Sbjct  180  SSS  182



>ref|XP_004486817.1| PREDICTED: PRA1 family protein F3-like [Cicer arietinum]
Length=177

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIPTSSS   +LE+ISR KERIK GLG RRPW+ MFNF S  LP+ F DA+SR+K
Sbjct  1    MTTYGTIPTSSSTPTNLEFISRAKERIKTGLGTRRPWKIMFNFRSFNLPTGFSDAISRVK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+ YF+MNYA+V L+++FLSLLWHPISLIVFV L+AAWLFLYFLRDEPL+I GR+++DR
Sbjct  61   TNIGYFQMNYAIVFLIVIFLSLLWHPISLIVFVVLIAAWLFLYFLRDEPLVIFGRVVSDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            ++L+++++ TI LLL T A  NIL+++++G V+VLVH A R T DLF DEE  
Sbjct  121  IILVLMAIITIGLLLLTGAILNILLAVVIGVVLVLVHAAIRNTHDLFLDEEEA  173



>ref|XP_008462362.1| PREDICTED: PRA1 family protein F3 [Cucumis melo]
Length=194

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 142/174 (82%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS--LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT+YGTIPTS++ G S  L+++SR K+R+K GL  R PWR MF+FHS  LP NFH+  SR
Sbjct  1    MTSYGTIPTSTAPGTSSDLDFVSRGKQRLKAGLATRVPWRLMFDFHSFTLPFNFHETFSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTN+ YFRMNY ++VL+ILF SL+WHPISLIVF A++A WLFLYFLRDEPLI+ GRLIN
Sbjct  61   IKTNIVYFRMNYVIIVLLILFFSLIWHPISLIVFTAMLAVWLFLYFLRDEPLILFGRLIN  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
            DR+V+ VLSV T+V L  T AT NIL+SLL+GAV+VL+H A RKTDDLF DE +
Sbjct  121  DRLVMAVLSVFTLVFLFLTKATLNILLSLLIGAVLVLIHAALRKTDDLFLDEGA  174



>ref|XP_006426510.1| hypothetical protein CICLE_v10027379mg [Citrus clementina]
 gb|ESR39750.1| hypothetical protein CICLE_v10027379mg [Citrus clementina]
Length=184

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 154/183 (84%), Gaps = 0/183 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT+YGTIPTSS A ++LEY+SR KERIK GLG R PW+ MF+ H++  P+NF +A++R+K
Sbjct  1    MTSYGTIPTSSGAASNLEYVSRAKERIKAGLGSRHPWKLMFDIHAVKFPANFKEAINRVK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N AYFRMNYA++VL++LFLSLLWHP+SLIVF+ +MAAWLFLYFLRD+PL++VGR I+DR
Sbjct  61   VNAAYFRMNYAIIVLLVLFLSLLWHPVSLIVFIVMMAAWLFLYFLRDQPLVVVGRTIDDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
            VVL+VLSV T+V L  T AT NIL++LL+GAVVVL+H A RKTDDLF DEES   ++  A
Sbjct  121  VVLLVLSVLTLVFLFLTRATENILLALLIGAVVVLLHAALRKTDDLFLDEESAHLMSTAA  180

Query  581  PSA  589
            PS+
Sbjct  181  PSS  183



>ref|XP_010242191.1| PREDICTED: PRA1 family protein F3-like [Nelumbo nucifera]
Length=199

 Score =   200 bits (509),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS--LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MTTYGTIPT+SS+  S  L YISR KERI  GLG RRPW+EM + H+IG+P +F +AV R
Sbjct  1    MTTYGTIPTASSSPGSSSLGYISRAKERIVSGLGTRRPWKEMVHRHAIGIPGSFPEAVGR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            ++TN+ YF MNY ++VLV+LFLSLLWHPISLIVFV +MAAWLFLYFLRDEPL+I+ R +N
Sbjct  61   VRTNVGYFLMNYVIIVLVVLFLSLLWHPISLIVFVVMMAAWLFLYFLRDEPLVILSRTVN  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            DRVVLIVLS+ TIVLLL T+AT NIL+SLL+G VVVLVHG  RKTDDLF DEES 
Sbjct  121  DRVVLIVLSIVTIVLLLLTHATLNILVSLLIGVVVVLVHGVLRKTDDLFGDEESA  175



>gb|KGN45534.1| hypothetical protein Csa_7G451400 [Cucumis sativus]
Length=194

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS--LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT+YGTIPTS++ G S  L+++SR K+R+K GL  R PWR MF+FHS  LP NFH+  SR
Sbjct  1    MTSYGTIPTSTAPGTSSDLDFVSRGKQRLKAGLATRVPWRLMFDFHSFTLPLNFHETFSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTN+ YFRMNY ++VL+ILF SL+WHPISLIV  A++A WLFLYFLRDEPLI++GRLIN
Sbjct  61   IKTNIVYFRMNYVIIVLLILFSSLIWHPISLIVLTAMLAVWLFLYFLRDEPLILLGRLIN  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
             R+V+ VLSV T+V L  T AT NIL+SLL+GAV+VL+H A RKTDDLF DE +
Sbjct  121  YRLVMAVLSVFTLVFLFLTKATLNILLSLLIGAVLVLIHAALRKTDDLFLDEGA  174



>ref|XP_006466052.1| PREDICTED: PRA1 family protein F2-like [Citrus sinensis]
Length=184

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT+YGTIPTSS   ++LEYISR KERIK GLG R PW+ MF+ H++  P+NF +A++R+K
Sbjct  1    MTSYGTIPTSSGPASNLEYISRAKERIKAGLGSRHPWKLMFDIHAVKFPANFKEAINRVK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N AYFRMNYA++VL++LFLSLLWHP+SLIVF+ +M AWLFLYFLRDEPL++VGR I+DR
Sbjct  61   VNAAYFRMNYAIIVLLVLFLSLLWHPVSLIVFIVMMVAWLFLYFLRDEPLVVVGRTIDDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
            VVL+VLSV T+V L  T AT NIL++LLVGAVVVL+H A RKTDDLF DEES   ++  A
Sbjct  121  VVLLVLSVLTLVFLFLTRATENILLALLVGAVVVLLHAALRKTDDLFLDEESAHLMSTAA  180

Query  581  PSA  589
            PS+
Sbjct  181  PSS  183



>ref|XP_010251988.1| PREDICTED: PRA1 family protein F2-like [Nelumbo nucifera]
Length=200

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 143/183 (78%), Gaps = 6/183 (3%)
 Frame = +2

Query  41   MTTYGTIPT-SSSAGAS--LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MTTYGTIPT SSS G S  LEYISR +ERI   LG RRPW+EM +  +I LP NF DA++
Sbjct  1    MTTYGTIPTVSSSLGGSTGLEYISRARERITSELGTRRPWKEMIHLQAIDLPVNFPDAIT  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            RIKTN+ YF MNYA++VL ILFLSLLWHPISLIVFV +MAAWLFLYF+RDEPL+I+   I
Sbjct  61   RIKTNVNYFLMNYAIIVLGILFLSLLWHPISLIVFVVMMAAWLFLYFMRDEPLVILHHTI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG---A  562
             D VVLIVLS+ TI LLL T AT NIL+SLL+G VVVLVH   R TDDLF DEESG    
Sbjct  121  TDGVVLIVLSIVTIGLLLLTRATLNILVSLLIGVVVVLVHAVLRNTDDLFEDEESGGSSG  180

Query  563  FLA  571
            FLA
Sbjct  181  FLA  183



>ref|XP_008447601.1| PREDICTED: PRA1 family protein F2-like [Cucumis melo]
Length=181

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 142/176 (81%), Gaps = 0/176 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT YGTIPTSS+A A+LEYISR K+R K+GLG RRPWR++ ++ S  LPSN HD +SRIK
Sbjct  1    MTNYGTIPTSSAAAANLEYISRAKQRFKDGLGHRRPWRQIADYRSFALPSNLHDTLSRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             NLAYFRMNYA+VVLVILFLSLLWHPISL+V   +++ WLFLYFLRD+PLI+ GR+I D 
Sbjct  61   FNLAYFRMNYAIVVLVILFLSLLWHPISLLVLFLMLSLWLFLYFLRDQPLILAGRVIEDW  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            ++L+VLS+ TI  L  TNAT NILI+LLVGA VVL H A RKTD+L+ DEE    L
Sbjct  121  IILLVLSLLTIGFLFLTNATPNILIALLVGAAVVLAHAAVRKTDNLYLDEEEATGL  176



>ref|XP_006300164.1| hypothetical protein CARUB_v10016395mg [Capsella rubella]
 gb|EOA33062.1| hypothetical protein CARUB_v10016395mg [Capsella rubella]
Length=188

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 138/188 (73%), Gaps = 2/188 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS A     LE ISR K RI  GL  RRPWR+MF+FHS+GLP    DA+SR
Sbjct  1    MTNYGAIPTSSHASPVVDLESISRAKHRIVAGLATRRPWRDMFDFHSMGLPHGVSDALSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            +KTNLAYFRMNYA+VVL+++F SL+WHP SLIVF  L+  W+FLYFLRDEPL +    I+
Sbjct  61   VKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVFVWIFLYFLRDEPLKVFRYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            DR VLIVL+V TIVLLL TNAT NI+ +L+ GAV+VL+H   RKT++LF DEE+      
Sbjct  121  DRTVLIVLAVITIVLLLLTNATFNIIGALVTGAVLVLIHAMVRKTENLFLDEEAATAETS  180

Query  575  HAPSAPSS  598
               S PSS
Sbjct  181  GLTSYPSS  188



>gb|ADN34104.1| cytochrome p450 [Cucumis melo subsp. melo]
Length=676

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = +2

Query  38   NMTTYGTIPTSSSAGAS--LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            +MT+YGTIPTS++ G S  L+++SR K+R+K GL  R PWR MF+FHS  LP NFH+  S
Sbjct  482  SMTSYGTIPTSTAPGTSSDLDFVSRGKQRLKAGLATRVPWRLMFDFHSFTLPFNFHETFS  541

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            RIKTN+ YFRMNY ++VL+ILF SL+WHPISLIVF A++A WLFLYFLRDEPLI+ GRLI
Sbjct  542  RIKTNIVYFRMNYVIIVLLILFFSLIWHPISLIVFTAMLAVWLFLYFLRDEPLILFGRLI  601

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADE  550
            NDR+V+ VLSV T+V L  T AT NIL+SLL+GAV+VL+H A RKTDDLF DE
Sbjct  602  NDRLVMAVLSVFTLVFLFLTKATLNILLSLLIGAVLVLIHAALRKTDDLFLDE  654



>ref|XP_003633114.1| PREDICTED: PRA1 family protein F3 [Vitis vinifera]
Length=189

 Score =   189 bits (481),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIP  +    SL YIS  +ERI+  LG RRPW+EM    S+ +P+N  +A  RIK
Sbjct  1    MTTYGTIPAGTPVSPSLGYISFARERIRSSLGTRRPWKEMVQLRSLSIPANAAEAFQRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN AYFRMNY +V+L ILFLSLLWHPISLIVFV  MAAWLFLYFLRD P++I+GR I+DR
Sbjct  61   TNAAYFRMNYVIVILFILFLSLLWHPISLIVFVVTMAAWLFLYFLRDGPVVILGRSIDDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            VV+++L+V TIVLL  T+ T NIL+SLL+G VVVL H   R T+DLF D E GA L
Sbjct  121  VVMVILAVVTIVLLFLTDVTINILVSLLIGVVVVLTHSVVRMTEDLFVDGEDGARL  176



>ref|XP_007150535.1| hypothetical protein PHAVU_005G160500g [Phaseolus vulgaris]
 gb|ESW22529.1| hypothetical protein PHAVU_005G160500g [Phaseolus vulgaris]
Length=189

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT YG IPTSSS   +LE+ISR K+R+KEGL  RRPW+ M N HS  LP+ F DAV R+K
Sbjct  1    MTNYGAIPTSSSPSTNLEFISRAKQRVKEGLATRRPWKIMLNLHSFALPAGFSDAVRRVK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N+ YF+MNYA+VVLV+LFLSLLW+PISLIVFV L  AWLFLYFLRDEPL + GR+I+DR
Sbjct  61   ENVGYFQMNYAIVVLVVLFLSLLWYPISLIVFVVLTVAWLFLYFLRDEPLFLFGRMISDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
            VVL+V+ V T+ LLL T A  NIL++LL+GAV+V+ H A R+TDDLF DEE  A  A   
Sbjct  121  VVLVVMGVLTVALLLLTGAIPNILVALLIGAVLVVAHAALRRTDDLFYDEEEAA--ARFV  178

Query  581  PSAPSS  598
            P  P S
Sbjct  179  PPPPHS  184



>ref|XP_003597623.1| PRA1 family protein F2 [Medicago truncatula]
 ref|XP_003636422.1| PRA1 family protein F2 [Medicago truncatula]
 gb|ACJ85222.1| unknown [Medicago truncatula]
 gb|AES67874.1| PRA1 (prenylated RAB acceptor) family protein [Medicago truncatula]
 gb|AFK48221.1| unknown [Medicago truncatula]
Length=185

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS-LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            MT YGTIPTSSS  A+ LE+I+R K+R+K GLG RRPW+ + N  S  LPSNFHDA+SRI
Sbjct  1    MTNYGTIPTSSSPPATNLEFITRAKDRLKSGLGTRRPWKLLVNLRSFNLPSNFHDAISRI  60

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            KTN+++F+MNYA+++L+ILFLSLLWHPISLIVFV L+AAWLFLYFLRDEP++I GRLI+D
Sbjct  61   KTNISFFQMNYAIILLIILFLSLLWHPISLIVFVVLIAAWLFLYFLRDEPIVIFGRLISD  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGH  577
            RV+L+++ + T+ LLL T A  NILI++ VG VV+L+H AFR T DLF DEE G   +  
Sbjct  121  RVILVLMLILTVGLLLLTGAILNILIAVAVGVVVILLHAAFRNTSDLFLDEEEGHSFS--  178

Query  578  APSAPSS  598
             P AP S
Sbjct  179  PPGAPVS  185



>ref|XP_002527418.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34984.1| conserved hypothetical protein [Ricinus communis]
Length=201

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 144/180 (80%), Gaps = 3/180 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS---LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MT YG IPTSSS GA+   LEYISR KERIKEGLG RRPW+ MFN  S+ L  NF +++ 
Sbjct  1    MTHYGAIPTSSSPGATTVNLEYISRAKERIKEGLGTRRPWKMMFNIRSLNLLPNFQESLV  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            R++TN+++FRMNY +++L+ILFLSLLWHPISLIVF+ +  AW+FLYFLRDEPL+I GR+I
Sbjct  61   RVRTNVSFFRMNYMIIILMILFLSLLWHPISLIVFIVMAFAWIFLYFLRDEPLVIFGRVI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLA  571
            +DRVV+IVL   T+V LL T+ T N+L+SLLVG VVV++H   RKTDDLF DEE+   ++
Sbjct  121  DDRVVMIVLGALTVVFLLLTHVTLNVLVSLLVGVVVVVIHAVVRKTDDLFLDEEATGLMS  180



>ref|XP_004298557.1| PREDICTED: PRA1 family protein F2 [Fragaria vesca subsp. vesca]
Length=188

 Score =   187 bits (475),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 144/187 (77%), Gaps = 4/187 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASL----EYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAV  208
            MTTYGTIPTSSS   S     EYI+R K+RIK GLG RRPW+ MF+F S+     F DA+
Sbjct  1    MTTYGTIPTSSSPSGSTSASGEYIARAKDRIKAGLGARRPWKLMFDFRSLNFAHGFGDAL  60

Query  209  SRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRL  388
            +R++ N +YFRMNYA++VL+ILFLSLLWHPISLIV + ++AAWLFLYFLRDEPL++ GR 
Sbjct  61   TRLRYNASYFRMNYAIIVLLILFLSLLWHPISLIVLIVMLAAWLFLYFLRDEPLVLFGRT  120

Query  389  INDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            ++DR+VLIVLSV TIVLL  T+AT NIL++LL+  VVV VH   RKT+DL  DEE+   +
Sbjct  121  VDDRIVLIVLSVVTIVLLFLTSATMNILVALLISVVVVAVHATLRKTEDLHVDEENAGLM  180

Query  569  AGHAPSA  589
             G A S+
Sbjct  181  TGPAGSS  187



>ref|XP_011007090.1| PREDICTED: PRA1 family protein F3-like [Populus euphratica]
Length=200

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 142/179 (79%), Gaps = 2/179 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS--LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            M  YGTIPTSSS G S  LEYISR KERIK GLG RRPW+ MFNF S   P N  +A++R
Sbjct  1    MANYGTIPTSSSPGTSTKLEYISRAKERIKAGLGTRRPWKVMFNFRSFNFPGNLSEALAR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            ++TN+AYF MNYA+VVL+ILFLSLLWHP+SLIVF+ +  AW+FLYFLRDEPL+++GR I+
Sbjct  61   VRTNIAYFTMNYAIVVLIILFLSLLWHPVSLIVFIVMGVAWVFLYFLRDEPLVVLGRTID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLA  571
            DRVV+IVL V TI  LL T+ T N+L+SLLVG VVVL+HG  RKTDDL  +EE+   ++
Sbjct  121  DRVVMIVLGVLTIFFLLLTHVTLNVLVSLLVGVVVVLIHGVTRKTDDLLLEEEATGLMS  179



>ref|NP_564679.1| protein PRA7 [Arabidopsis thaliana]
 sp|Q9C889.1|PR1F2_ARATH RecName: Full=PRA1 family protein F2; Short=AtPRA1.F2 [Arabidopsis 
thaliana]
 gb|AAG51564.1|AC027034_10 hypothetical protein; 89971-89402 [Arabidopsis thaliana]
 gb|AAM63371.1| unknown [Arabidopsis thaliana]
 gb|AAO42116.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50631.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33200.1| PRA1 family protein F2 [Arabidopsis thaliana]
Length=189

 Score =   184 bits (468),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS  S    LEYISR K RIK GL  RRPW+ MF+F S+ LP  F DA+SR
Sbjct  1    MTNYGAIPTSSHPSPAIDLEYISRAKHRIKSGLATRRPWKSMFDFESMTLPHGFFDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNL YFR NYA+ VL ILFLSLL+HP SLIV   L+  W+FLYFLRDEPL++ G  I+
Sbjct  61   IKTNLGYFRANYAIGVLFILFLSLLYHPTSLIVLSILVVFWIFLYFLRDEPLVVFGYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR VLI LSV T+V+LL T+AT+NIL SLL  AV+VL+H A R++D+LF DEE+ A
Sbjct  121  DRTVLIGLSVLTVVMLLLTHATSNILGSLLTAAVLVLIHAAVRRSDNLFLDEEAAA  176



>ref|XP_010501126.1| PREDICTED: PRA1 family protein F2-like [Camelina sativa]
Length=189

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 130/176 (74%), Gaps = 2/176 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS  S    LEYISR K RIK GL  RRPW+ MF+F S+ +P  F DAVSR
Sbjct  1    MTNYGAIPTSSHPSPAIDLEYISRAKHRIKSGLATRRPWKSMFDFDSMTVPHGFFDAVSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNL YFR NYA+ VL ILFLSLL+HP SLIV   L+  W+FLYFLRDEPL++ G  I+
Sbjct  61   IKTNLGYFRANYAIGVLFILFLSLLYHPTSLIVLSILVVFWIFLYFLRDEPLVVFGYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR VLI LSV TIV+LL T+AT NIL SLL   V++ +H A R++D+LF DEE+ A
Sbjct  121  DRTVLIALSVLTIVMLLLTHATWNILGSLLTATVLLSIHAAVRRSDNLFLDEEAAA  176



>emb|CDY26125.1| BnaC06g10710D [Brassica napus]
Length=189

 Score =   182 bits (463),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS  S    LEYIS  K R+K GL  RRPWR MF+  S+ LP  F DA+SR
Sbjct  1    MTNYGAIPTSSHPSPPVDLEYISHVKHRLKAGLATRRPWRSMFDLESMTLPHGFFDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            +KTNL YFR NYA+ VL +LF+SLL+HP SL+V   L+  W+FLYFLRDEPL++ G L++
Sbjct  61   MKTNLVYFRANYAIAVLFMLFVSLLYHPTSLLVLAILVVFWIFLYFLRDEPLVVFGHLVD  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR V+I LSV TIV+LLFT+AT NIL SLL   ++VL+H A R++D+L++DEE+ A
Sbjct  121  DRTVMISLSVLTIVMLLFTHATGNILGSLLTTVLLVLIHAAIRRSDNLYSDEEAAA  176



>ref|XP_006305837.1| hypothetical protein CARUB_v10010880mg [Capsella rubella]
 gb|EOA38735.1| hypothetical protein CARUB_v10010880mg [Capsella rubella]
Length=189

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT+YG IPTSS  S    L+YISR K RIK GL  RRPW+ MF F S+ LP  F DA+SR
Sbjct  1    MTSYGAIPTSSHPSPAIDLQYISRAKHRIKSGLATRRPWKSMFEFESMTLPHGFFDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNL YFR NYA+ VL ILFLSLL+HP SLIV   L+  W+FLYFLRDEPL++    I+
Sbjct  61   IKTNLGYFRANYAIGVLFILFLSLLYHPTSLIVLSILVVFWIFLYFLRDEPLVVFNYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR VLI LSV T+V+LL T+AT+NIL SLL  AV+VL+H A R++D+LF DEE+ A
Sbjct  121  DRTVLIALSVLTVVMLLLTHATSNILGSLLTAAVLVLIHAAVRRSDNLFLDEEAAA  176



>ref|XP_002891819.1| prenylated rab acceptor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68078.1| prenylated rab acceptor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=189

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT Y  IPTSS  S    LEYISR K RIK GL  RRPW+ MF+F S+ LP  F DA+SR
Sbjct  1    MTNYNAIPTSSHPSPAIDLEYISRAKHRIKSGLATRRPWKSMFDFESMTLPHGFFDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNL YFR NYA+ VL ILFLSLL+HP SLIV   L+  W+FLYFLRDEPL++ G  I+
Sbjct  61   IKTNLGYFRANYAIGVLFILFLSLLYHPTSLIVLSILVVFWIFLYFLRDEPLVVFGYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR VLI LSV T+V+LL T+AT+NIL SLL  AV+VL+H A R++D+LF DEE+ A
Sbjct  121  DRTVLIGLSVFTVVMLLLTHATSNILGSLLTAAVLVLIHAAVRRSDNLFLDEEAAA  176



>ref|XP_006392675.1| hypothetical protein EUTSA_v10011807mg [Eutrema salsugineum]
 gb|ESQ29961.1| hypothetical protein EUTSA_v10011807mg [Eutrema salsugineum]
Length=189

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS  S    LEYISR K RIK GL  RRPW+ MF+  S+ LP  F DA+SR
Sbjct  1    MTNYGAIPTSSHPSPAVELEYISRAKHRIKSGLATRRPWKSMFDLKSMNLPHGFFDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNL YFR NYA+ VLV+LFLSLL+HP SL+V   L+  W+FLYFLRDEPL++ G  I+
Sbjct  61   IKTNLGYFRANYAIGVLVVLFLSLLYHPTSLLVLAILVVFWIFLYFLRDEPLMVFGHQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR V+I LS+ T+ LLLFT+ATANIL SLL  AV+VLVH A R++D+LF DE++ A
Sbjct  121  DRTVMIGLSILTVGLLLFTHATANILGSLLTAAVLVLVHAAVRRSDNLFLDEDAAA  176



>ref|XP_010440813.1| PREDICTED: PRA1 family protein F2 [Camelina sativa]
Length=189

 Score =   179 bits (455),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 132/176 (75%), Gaps = 2/176 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS  S    LEYISR K RIK GL  RRPW+ MF+F S+ +P  F DA+SR
Sbjct  1    MTNYGAIPTSSHPSPAIDLEYISRAKHRIKSGLATRRPWKSMFDFESMTVPHGFFDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNL YFR NYA+ VL ILFLSLL+HP SLIV   L+  W+FLYFLRDEPL++ G  I+
Sbjct  61   IKTNLGYFRANYAIGVLFILFLSLLYHPTSLIVLSILVFFWIFLYFLRDEPLVVFGYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR V+I LSV T+V+LL T+AT NIL SLL  AV++L+H A R++D+LF DEE+ A
Sbjct  121  DRTVMIGLSVLTVVMLLLTHATWNILGSLLTAAVLLLIHAAVRRSDNLFLDEEAAA  176



>ref|XP_010480042.1| PREDICTED: PRA1 family protein F2-like [Camelina sativa]
Length=189

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 131/176 (74%), Gaps = 2/176 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSA--GASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS       LEYISR K RIK GL  RRPW+ MF+F S+ +P  F DAVSR
Sbjct  1    MTNYGAIPTSSHPLPAIDLEYISRAKHRIKSGLATRRPWKSMFDFESMTVPHGFFDAVSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNL YFR NYA+ VL ILFLSLL+HP SLIV   L+  W+FLYFLRDEPL++ G  I+
Sbjct  61   IKTNLGYFRANYAIGVLFILFLSLLYHPTSLIVLSILVVFWIFLYFLRDEPLVVFGYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR V+I LSV TIV+LL T+AT NI+ SLL  AV++L+H A R++D+LF DEE+ A
Sbjct  121  DRTVMIGLSVLTIVMLLLTHATWNIIGSLLTAAVLLLIHAAVRRSDNLFLDEEAAA  176



>gb|KEH18334.1| PRA1 family protein [Medicago truncatula]
Length=180

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 134/165 (81%), Gaps = 1/165 (1%)
 Frame = +2

Query  44   TTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKT  223
            +TYGTIPTS +    LEYI+R K+RIK GLG RRPW+ MF+  S+G+P+   +A+SR++ 
Sbjct  3    STYGTIPTSPTP-PKLEYITRGKQRIKAGLGTRRPWKTMFDIRSLGIPTGVPEAISRVRV  61

Query  224  NLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRV  403
            N++YFRMNY +V+L+ILFLSLLWHP SLIVFV LMAAWLF YFLRD+P+I+ GRL++DR+
Sbjct  62   NISYFRMNYTMVMLLILFLSLLWHPYSLIVFVILMAAWLFFYFLRDQPVILWGRLVDDRI  121

Query  404  VLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDL  538
            V+++++  T+ LLL T AT NI++++ V  VVV+ HG FRKT+DL
Sbjct  122  VVVLMAFVTVALLLLTQATVNIVVAVSVATVVVVAHGVFRKTEDL  166



>ref|XP_010501087.1| PREDICTED: PRA1 family protein F3-like [Camelina sativa]
Length=177

 Score =   177 bits (449),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 129/174 (74%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT    +PTSS A     L+ IS TK+RIK+GL  RRPWR MF+FHS+GLP    DA SR
Sbjct  1    MTNNDAVPTSSHAHPLVDLDSISHTKQRIKDGLATRRPWRVMFDFHSMGLPRGVSDAFSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNLAYFR NYA+ VL I+F SL+WHP SLIVF  L+  W+FLYFLRDEPL +    I+
Sbjct  61   IKTNLAYFRSNYAIFVLTIVFFSLIWHPTSLIVFTVLVFVWIFLYFLRDEPLKMFRFQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
            D  VLIVLSV T+VLLL TNAT NI+ +L+ GAV+VL+H   RKT+DLF DEE+
Sbjct  121  DPTVLIVLSVITVVLLLCTNATFNIIGALVTGAVLVLIHAVVRKTEDLFLDEEA  174



>ref|XP_003529735.1| PREDICTED: PRA1 family protein F2-like isoform X1 [Glycine max]
 ref|XP_006583021.1| PREDICTED: PRA1 family protein F2-like isoform X2 [Glycine max]
Length=178

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = +2

Query  44   TTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSN-FHDAVSRIK  220
            TTYGTIPTS     +LEYISR K+RIK GLG RRPW+ MFNF S+ +P     +A+SRI+
Sbjct  3    TTYGTIPTSPPP--NLEYISRAKQRIKAGLGTRRPWKAMFNFRSLKVPGGGVPEALSRIR  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N++YFRMNYA+V L+ILFLSLLWHPISLIVF+ LMAAWLFLYFLRDEPL+++G L++DR
Sbjct  61   INVSYFRMNYAMVTLLILFLSLLWHPISLIVFLVLMAAWLFLYFLRDEPLVVLGHLVDDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
            +VL+V+++ T+ LLL T+AT NIL+++ VG V V+ H AFR+T+DLF  EE 
Sbjct  121  LVLLVMALLTVALLLLTDATVNILVAVAVGVVAVVAHAAFRRTEDLFLGEEE  172



>ref|XP_010487141.1| PREDICTED: PRA1 family protein F3-like [Camelina sativa]
Length=177

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 128/174 (74%), Gaps = 2/174 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT  G +PTSS A     L+ IS TK+RIK+GL  RRPWR MF+FHS+GLP    DA S 
Sbjct  1    MTKNGAVPTSSHAHPLVDLDSISHTKQRIKDGLATRRPWRVMFDFHSMGLPRGVSDAFSS  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNLAYFR NYA+ VL ++F SL+WHP SLIVF  L+  W+FLYFL DEPL +    I+
Sbjct  61   IKTNLAYFRSNYAIFVLTVVFFSLIWHPTSLIVFTVLVFVWIFLYFLCDEPLKMFRFQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
            D  VLIVLSV T+VLLL TNAT NI+ +L+ GAV+VL+H   RKT+DLF DEE+
Sbjct  121  DPTVLIVLSVITVVLLLCTNATFNIIGALVTGAVLVLIHAVVRKTEDLFLDEEA  174



>gb|KGN59828.1| hypothetical protein Csa_3G848860 [Cucumis sativus]
Length=181

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MT YGTIPTSS+A A+LEYISR K+R K+GLG RRPWR + ++HS  LPSN HD +SRIK
Sbjct  1    MTNYGTIPTSSAAAANLEYISRAKQRFKDGLGHRRPWRLIADYHSFTLPSNLHDTLSRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             NL YFRMNYA+VVLV+LFL+LLWHPISL+V   +++ WLFLYFLRD+PLI+ GR++ D 
Sbjct  61   INLTYFRMNYAIVVLVVLFLALLWHPISLLVLFLMLSLWLFLYFLRDQPLILAGRVLEDW  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            ++L++LS+ T+  L  TNAT NILI+LLVGA +VL H A RKTD+L+ DEE    L
Sbjct  121  IILLLLSLFTLGFLFLTNATLNILIALLVGAALVLAHAAVRKTDNLYLDEEEATGL  176



>ref|XP_010552207.1| PREDICTED: PRA1 family protein F3-like [Tarenaya hassleriana]
Length=190

 Score =   174 bits (442),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 144/190 (76%), Gaps = 4/190 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSS---AGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLP-SNFHDAV  208
            MT YG IPTSS      A+LEYISR K+R+K G   RRPW+ MF+ HS GLP   F   +
Sbjct  1    MTNYGAIPTSSHPALTSANLEYISRAKQRLKSGFAARRPWKLMFDLHSFGLPHGGFFATI  60

Query  209  SRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRL  388
            SR+KTNLAYFRMNYA++VL+ILFLSLL+HP SLIVFVALMA WLFLYFLRDEPL ++GR 
Sbjct  61   SRMKTNLAYFRMNYAIIVLIILFLSLLYHPTSLIVFVALMAIWLFLYFLRDEPLSVIGRQ  120

Query  389  INDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            ++DR VLI LSV T+VLLL T+AT NI+ +L++GAVV++VH   R+T+DLF DEE     
Sbjct  121  VDDRTVLICLSVLTVVLLLLTHATMNIVGALVIGAVVIVVHSVVRRTEDLFMDEEEARGE  180

Query  569  AGHAPSAPSS  598
            A    S PSS
Sbjct  181  ASGLTSYPSS  190



>ref|XP_006299764.1| hypothetical protein CARUB_v10015960mg [Capsella rubella]
 gb|EOA32662.1| hypothetical protein CARUB_v10015960mg [Capsella rubella]
Length=178

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 129/176 (73%), Gaps = 3/176 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT  G +PTSS A     LE ISR K RIK+GL  RRPW+ MF+FHS+GLP    DA SR
Sbjct  1    MTNNGAVPTSSHASPMVDLESISRAKRRIKDGLATRRPWKVMFDFHSMGLPHGVSDAFSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNLAYFR NYA+VVL ++F SL+WHPISLI+F  L+  W+FLYFLR+EPL I    IN
Sbjct  61   IKTNLAYFRSNYAIVVLNVMFFSLIWHPISLIIFAGLVFLWIFLYFLREEPLKIFRLQIN  120

Query  395  DRVVLIVLSVATIV-LLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            D+ VLI LSV T+  LLL  NAT +I+ +LL GAV+VL+H   RKT+DLF DEE+ 
Sbjct  121  DQAVLIGLSVITVASLLLLANATFSIVAALLTGAVLVLIHALVRKTEDLFLDEEAA  176



>ref|XP_008782551.1| PREDICTED: PRA1 family protein F3-like [Phoenix dactylifera]
Length=196

 Score =   172 bits (437),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 140/175 (80%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS-LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            MTTYGTIPTSS   A+ L++ISR KER +E L  RRPWRE+ + H+I LP +  +A  RI
Sbjct  1    MTTYGTIPTSSGGAATPLDFISRAKERGREALATRRPWREVADIHAISLPPSLGEAYLRI  60

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            +TNL YF MNYA++VL+I+FLSLLWHP+SLIVF+ +MA WLFLYFLRDEPL+I+GR I D
Sbjct  61   RTNLGYFAMNYAIIVLLIVFLSLLWHPVSLIVFMVMMALWLFLYFLRDEPLVILGRTIGD  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            R VLIVL++ T+ +LL TNAT NIL+S LVG +VV++H A R+TDDLF +EE  A
Sbjct  121  RTVLIVLALVTLGVLLLTNATLNILVSFLVGLLVVVLHAALRRTDDLFMEEEEAA  175



>emb|CDY23634.1| BnaC05g39600D [Brassica napus]
Length=181

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 127/175 (73%), Gaps = 2/175 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS  S    L+ ISR K++IK+GL  RRPWR MF+FHS+GLP    DA SR
Sbjct  1    MTNYGAIPTSSHGSPVVDLDSISRVKQQIKDGLATRRPWRVMFDFHSMGLPRGVSDAFSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IK NL YF+ NYA+V LV++F SL+ HP SLIV   L+  W+FLYFLRDEP+ +    ++
Sbjct  61   IKKNLVYFQTNYAIVFLVVIFFSLIKHPTSLIVLTVLVFVWIFLYFLRDEPIKLFSYQVD  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            D+ VL+ LSV TIVLL  TNAT NI  +LL+GAV+VL+H   RKTDDLF DEE+ 
Sbjct  121  DKTVLVCLSVITIVLLFLTNATLNIAGALLIGAVLVLIHAVVRKTDDLFLDEEAA  175



>gb|KJB83061.1| hypothetical protein B456_013G227900 [Gossypium raimondii]
Length=196

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 131/172 (76%), Gaps = 3/172 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIP  +    S  +ISR KE+I+ GLG RR W+EM NF SI LPSN +++  RI+
Sbjct  1    MTTYGTIP--AELPPSTNFISRAKEQIRSGLGTRRQWKEMANFKSINLPSNINESTQRIR  58

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN AYFR+NY ++VL +LF++LLWHP+SLIVF+ +MAAWLFLYFLRD+P+ I G +I+DR
Sbjct  59   TNAAYFRVNYMIIVLFVLFITLLWHPVSLIVFIIMMAAWLFLYFLRDDPVSIKGFVIDDR  118

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFA-DEE  553
            VV+  L VATI LL+ T+ T NI++ L VG  V+LVHG  R TDDLF  DEE
Sbjct  119  VVMTGLLVATIALLMLTDVTDNIIVGLSVGLAVILVHGMTRSTDDLFIRDEE  170



>ref|XP_010465233.1| PREDICTED: PRA1 family protein F3-like [Camelina sativa]
Length=188

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 134/188 (71%), Gaps = 2/188 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS       LE ISRTK RI  GL  RRPW+ MF+FHS+G+P  F DA+SR
Sbjct  1    MTNYGAIPTSSDGSPVVDLESISRTKHRIVAGLATRRPWKVMFDFHSMGIPHGFSDALSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
             K NLAYFR+NY +VVL+++F SL+WHPISLIVF  L+  W+FLYFLRDEPL +    IN
Sbjct  61   TKKNLAYFRVNYVIVVLIVIFFSLIWHPISLIVFTVLVFVWIFLYFLRDEPLKVFRYQIN  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            D  VLIVL V TIVLLL TNAT NI+ +++ GAV+VL+H   RKT+DLF DEE+      
Sbjct  121  DLTVLIVLGVVTIVLLLLTNATLNIIGAVVTGAVLVLIHAVVRKTEDLFLDEEAATTETS  180

Query  575  HAPSAPSS  598
               S PSS
Sbjct  181  GLTSYPSS  188



>emb|CDX97509.1| BnaA05g25700D [Brassica napus]
Length=181

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 128/175 (73%), Gaps = 2/175 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS  S    L+ +SR K++IK+GL  RRPWR MF+FHS+G+P    DA SR
Sbjct  1    MTNYGAIPTSSHGSPVVDLDSVSRVKQQIKDGLATRRPWRVMFDFHSVGIPRGLSDAFSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IK NL YF+ NYA+V LV++FLSL+ HP SLIV   L+  W+FLYFLRDEP+ +    ++
Sbjct  61   IKKNLVYFQTNYAIVFLVVIFLSLIKHPTSLIVLTVLVFVWIFLYFLRDEPIKLFSYQVD  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            D+ VL+ LSV TIVLL  TNAT NI  +LL+GAV+VL+H   RKTDDLF DE++ 
Sbjct  121  DKTVLVCLSVITIVLLFLTNATLNIAGALLIGAVLVLIHAVVRKTDDLFLDEKAA  175



>ref|XP_010465232.1| PREDICTED: PRA1 family protein F3-like [Camelina sativa]
Length=179

 Score =   170 bits (430),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 129/176 (73%), Gaps = 4/176 (2%)
 Frame = +2

Query  41   MTTYGT--IPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAV  208
            MT  G   +PTSS A     L+ IS TK+RIK+GL  RRPWR MF+FHS+ LP    DA 
Sbjct  1    MTKNGADAVPTSSHAHPLVDLDSISHTKQRIKDGLATRRPWRVMFDFHSMVLPRGVSDAF  60

Query  209  SRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRL  388
            SRIKTNLAYFR NYA+ VL ++F SL+WHP SLIVF  L+  W+FLYFLRDEPL +    
Sbjct  61   SRIKTNLAYFRSNYAIFVLTVVFFSLIWHPTSLIVFTVLVFVWIFLYFLRDEPLKMFRFQ  120

Query  389  INDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
            I+D  VL+VLSV T+VLLL TNAT NI+ +L+ GAV+VL+H   RKT+DLF DEE+
Sbjct  121  IDDPTVLMVLSVITVVLLLCTNATFNIIGALVTGAVLVLIHAVVRKTEDLFLDEEA  176



>ref|XP_010535226.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase [Tarenaya 
hassleriana]
Length=712

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 141/177 (80%), Gaps = 4/177 (2%)
 Frame = +2

Query  41   MTTYGTIPTSS---SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLP-SNFHDAV  208
            MT YG IPTSS      A+LEYISR K+RIK GL  RRPW+ MF+ HS GLP   F  A+
Sbjct  522  MTNYGAIPTSSHPIPTSANLEYISRAKQRIKSGLATRRPWKLMFDLHSFGLPRGGFSAAI  581

Query  209  SRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRL  388
            SRIKTNLA+FRMNYA+V L ILFLSLL+HP SLIVF+ALMA W+FLYFLRDEPL+++GR 
Sbjct  582  SRIKTNLAFFRMNYAIVALFILFLSLLYHPTSLIVFIALMAIWMFLYFLRDEPLVVIGRQ  641

Query  389  INDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            I+DR +LI LSV T+ LLL T ATANI+ +L++GAVVVL+H A RKT+DLF DEE+ 
Sbjct  642  IDDRTILICLSVLTVALLLLTKATANIVGALVIGAVVVLIHAAVRKTEDLFLDEEAA  698



>ref|NP_187984.1| RNA-binding family protein [Arabidopsis thaliana]
 sp|Q9LIC7.1|PR1F4_ARATH RecName: Full=PRA1 family protein F4; Short=AtPRA1.F4 [Arabidopsis 
thaliana]
 dbj|BAB01920.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF01134.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABK59669.1| At3g13710 [Arabidopsis thaliana]
 gb|AEE75402.1| prenylated RAB acceptor 1.F4 [Arabidopsis thaliana]
Length=188

 Score =   169 bits (429),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 128/188 (68%), Gaps = 2/188 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASL--EYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            M     I TSS A  ++  E ISR K+RIK+GL  RR WR MF+ HS GLP    D  SR
Sbjct  1    MANNDEITTSSHASPAVNHESISRAKQRIKDGLATRRSWRVMFDLHSTGLPHGVSDVFSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNLAYFR NYA+V+L ++F SL+WHP SLIVF  L+  W+FLYFLRD PL +    I+
Sbjct  61   IKTNLAYFRSNYAIVILNVIFFSLIWHPTSLIVFTGLVFLWIFLYFLRDVPLKVFRFQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            DR VLI LSV TIVLLL TNAT NI+ +L+ GAV+VL+H   RKTDDLF DEE+      
Sbjct  121  DRAVLIGLSVITIVLLLLTNATFNIVAALMAGAVLVLIHAVIRKTDDLFLDEEAATTETS  180

Query  575  HAPSAPSS  598
               S PSS
Sbjct  181  GLTSHPSS  188



>gb|EPS63055.1| hypothetical protein M569_11731, partial [Genlisea aurea]
Length=176

 Score =   169 bits (427),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 139/175 (79%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS---LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MT YGTIPT SS  ++   LEYISR KER+KEGLG RRPWREM    S   P  F +A++
Sbjct  1    MTNYGTIPTGSSPSSTPVNLEYISRAKERLKEGLGTRRPWREMVELRSFSFPKAFGEALA  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            R++ N+AYFRMNY + VL+ILFLSLLWHPISLIVF+ +MA WLFLYFLRDEPL++ GRLI
Sbjct  61   RVRKNVAYFRMNYVIAVLLILFLSLLWHPISLIVFIVMMAVWLFLYFLRDEPLVLFGRLI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
             D+VV+IVL V TIV+LL T AT NIL+SLLVG V+VL+H + R TDDL ADEE+
Sbjct  121  TDQVVVIVLWVVTIVVLLLTRATLNILVSLLVGVVLVLIHASVRSTDDLTADEEA  175



>ref|XP_010487142.1| PREDICTED: PRA1 family protein F3 [Camelina sativa]
Length=188

 Score =   169 bits (428),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS       LE ISR K RI  GL  RRPW+ MF+FHS+G+P  F DA SR
Sbjct  1    MTNYGAIPTSSDGSPVVDLESISRAKHRIVAGLATRRPWKVMFDFHSMGIPHGFSDAFSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
             K NLAYFR+NYA+VVL+++F SL+WHPISLIVF  L+  W+FLYFLRDEPL +    IN
Sbjct  61   TKKNLAYFRVNYAIVVLIVIFFSLIWHPISLIVFTVLVFVWIFLYFLRDEPLKVFRYQIN  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            D  VLIVL V TIVLLL TNAT NI+ +++ GAV+VL+H   RKT+DLF DEE+      
Sbjct  121  DLTVLIVLGVVTIVLLLLTNATLNIIGAVVTGAVLVLIHAVVRKTEDLFLDEEAATTETS  180

Query  575  HAPSAPSS  598
               S PSS
Sbjct  181  GLTSYPSS  188



>ref|XP_002884984.1| hypothetical protein ARALYDRAFT_897614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61243.1| hypothetical protein ARALYDRAFT_897614 [Arabidopsis lyrata subsp. 
lyrata]
Length=188

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 139/188 (74%), Gaps = 2/188 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS A     LE +SR K RIK GL  RRPWR MF+FHS+GLP +  DA +R
Sbjct  1    MTNYGAIPTSSHASPVVDLESLSRAKHRIKAGLATRRPWRVMFDFHSMGLPHSVSDAFTR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNLAYFRMNYA+VVL+++F SL+WHP SLIVF  L+A W+FLYFLRDEP+ +    I+
Sbjct  61   IKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVAVWIFLYFLRDEPIKLFRYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            DR VLIVLSV T+VLLL TNAT NI+ +L+ GAV+VL+H   RKT+DLF DEE+      
Sbjct  121  DRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHAVVRKTEDLFLDEEAATTETS  180

Query  575  HAPSAPSS  598
               S PS+
Sbjct  181  GLTSYPST  188



>ref|XP_010501099.1| PREDICTED: PRA1 family protein F3-like [Camelina sativa]
Length=188

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS       LE ISR K RI  GL  RRPW+ MF+FHS+G+P  F DA+SR
Sbjct  1    MTNYGAIPTSSDGSPVVDLESISRAKHRIVAGLATRRPWKVMFDFHSMGIPHGFSDALSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
             K NLAYFR+NYA++VL+++F SL+WHPISLIVF  L+  W+FLYFLRDEPL +    IN
Sbjct  61   TKKNLAYFRVNYAIIVLIVIFFSLIWHPISLIVFTVLVFVWIFLYFLRDEPLKVFRYQIN  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            D  VLIV  V TIVLLL TNAT NI+ +++ GAV+VL+H   RKT+DLF DEE+      
Sbjct  121  DLTVLIVFGVVTIVLLLLTNATLNIIGAVVTGAVLVLIHAVVRKTEDLFLDEEAATTETS  180

Query  575  HAPSAPSS  598
               S PSS
Sbjct  181  GLTSYPSS  188



>ref|XP_009107086.1| PREDICTED: PRA1 family protein F2-like [Brassica rapa]
Length=189

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS  S    LEYIS  K R+K GL  RRPWR MF+  S+ +P  F DA+SR
Sbjct  1    MTNYGAIPTSSHPSPPVDLEYISHVKHRLKAGLATRRPWRSMFDLESMTVPQGFLDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            +KTNL YFR NYA+ VL +LF+SLL+HP SL+V   L+  W+FLYFLRDEPL++ G  ++
Sbjct  61   MKTNLVYFRANYAIAVLFMLFVSLLYHPTSLLVLAILVVFWIFLYFLRDEPLVLFGHQVD  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFAD  547
            DR V+I LS  TI +LLFT+AT NIL SLL   V+VL+H   R++D+L++D
Sbjct  121  DRTVMISLSALTIGMLLFTHATGNILGSLLTAVVLVLIHAGIRRSDNLYSD  171



>emb|CDY08228.1| BnaA05g13910D [Brassica napus]
Length=189

 Score =   167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS  S    LEYIS  K R+K GL  RRPWR MF+  S+ +P  F DA+SR
Sbjct  1    MTNYGAIPTSSHPSPPVDLEYISHVKHRLKAGLATRRPWRSMFDLESMTVPQGFLDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            +KTNL YFR NYA+ VL +LF+SLL+HP SL+V   L+  W+FLYFLRDEPL++ G  ++
Sbjct  61   MKTNLVYFRANYAIAVLFMLFVSLLYHPTSLLVLAILVVFWIFLYFLRDEPLVLFGHQVD  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFAD  547
            DR V+I LS  TI +LLFT+AT NIL SLL   V+VL+H   R++D+L++D
Sbjct  121  DRTVMISLSALTIGMLLFTHATGNILGSLLTAVVLVLIHAGVRRSDNLYSD  171



>emb|CDY33064.1| BnaC06g07150D [Brassica napus]
Length=187

 Score =   167 bits (423),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 129/171 (75%), Gaps = 2/171 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS  S    LEYISR K RIK GL  RRPW+ MF+  S+ LP  F DA+SR
Sbjct  1    MTNYGAIPTSSHPSPPIDLEYISRAKHRIKSGLATRRPWKTMFDLQSMSLPHGFFDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNL YFR NYA+VVL++LFLSL++HP SL+V   L+  W+FLYFLRDEPL++ G  I+
Sbjct  61   IKTNLVYFRANYAVVVLLVLFLSLIYHPTSLLVLAVLVVFWIFLYFLRDEPLVVFGHQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFAD  547
            DR V+I LSV TIV+LLFT+ATAN+L ++    V+VLVH A R++D+L+ D
Sbjct  121  DRTVMICLSVLTIVMLLFTHATANVLGAVATAVVLVLVHAAVRRSDNLYLD  171



>ref|XP_009147522.1| PREDICTED: LOW QUALITY PROTEIN: PRA1 family protein F2 [Brassica 
rapa]
Length=187

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG+IPTSS  S    LEYISR K RIK GL  RRPW+ MF+  S+ LP  F DA+SR
Sbjct  1    MTNYGSIPTSSHPSPPIDLEYISRAKYRIKSGLATRRPWKTMFDLQSMNLPHGFFDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNL YFR NYA+VVL++LFLSL++HP SL+V   L+  W+FLYFLRDEPL++ G  I+
Sbjct  61   IKTNLVYFRANYAVVVLLVLFLSLVYHPTSLLVLAVLVVFWIFLYFLRDEPLVVFGHQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFAD  547
            DR V+I LSV TIV+LLFT+ATAN+L ++    V+VLVH A R++D+L+ D
Sbjct  121  DRTVMICLSVLTIVMLLFTHATANVLGAVATAVVLVLVHAAVRRSDNLYLD  171



>ref|XP_006385351.1| hypothetical protein POPTR_0003s02980g [Populus trichocarpa]
 gb|ERP63148.1| hypothetical protein POPTR_0003s02980g [Populus trichocarpa]
Length=194

 Score =   167 bits (422),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 138/179 (77%), Gaps = 2/179 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA--SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            M  YGTIPTSSS G+   LEYISR KERIK GLG R+PW+ MFNF S   P    DA++R
Sbjct  1    MANYGTIPTSSSPGSSTKLEYISRAKERIKAGLGTRQPWKVMFNFRSFNFPGTLSDALAR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            ++ N+AYF MNYA+VVL+ILFLSLLWHP+SLIVF+ +  AW+ LYFLRDEPL+++GR I+
Sbjct  61   VRKNIAYFTMNYAIVVLIILFLSLLWHPVSLIVFIVMGVAWVCLYFLRDEPLVVLGRTID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLA  571
            DRVV+IVL V TI  LL T+ T N+L+SLLVG V+VL+HG  RK DDL  DEE+   ++
Sbjct  121  DRVVMIVLGVLTIFFLLLTHVTWNVLVSLLVGVVLVLIHGVTRKIDDLSLDEETTGLMS  179



>ref|XP_007135562.1| hypothetical protein PHAVU_010G139900g [Phaseolus vulgaris]
 gb|ESW07556.1| hypothetical protein PHAVU_010G139900g [Phaseolus vulgaris]
Length=183

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 133/167 (80%), Gaps = 3/167 (2%)
 Frame = +2

Query  44   TTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSN-FHDAVSRIK  220
            TTYGTIPTS     +LEYISR K+RIK GLG RRPW+ M NF S+ +P     +A+SR+ 
Sbjct  3    TTYGTIPTSGPP--NLEYISRAKQRIKAGLGTRRPWKAMLNFRSLKIPGGGAAEALSRVA  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N++YFRMNYA+V L+ILFLSLLWHPISLIVF+ LMAAWLFLYFLRDEPL+++G L++DR
Sbjct  61   VNVSYFRMNYAMVALLILFLSLLWHPISLIVFLLLMAAWLFLYFLRDEPLVLLGHLVDDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF  541
            +VL+ ++V T+ LLL T+AT NIL ++ V  V V+ H AFR+T+DLF
Sbjct  121  LVLVAMAVLTVALLLLTDATVNILGAVAVAVVAVVAHAAFRRTEDLF  167



>ref|XP_003533013.1| PREDICTED: PRA1 family protein F2-like [Glycine max]
Length=176

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = +2

Query  74   SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSN-FHDAVSRIKTNLAYFRMNY  250
            S   +LEYISR K+RIK GLGMRRPW+ MFNF S+ +P     +A+SRI+ N++YFRMNY
Sbjct  12   SPPPNLEYISRAKQRIKAGLGMRRPWKAMFNFRSLKVPGGGLPEALSRIRINVSYFRMNY  71

Query  251  AlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVAT  430
            A+V L+ILFLSLLWHPISLIVF+ LMAAWLFLYFLRDEPL+++G L++DR+VL+V++V T
Sbjct  72   AMVALLILFLSLLWHPISLIVFLVLMAAWLFLYFLRDEPLVVLGHLVDDRLVLVVMAVLT  131

Query  431  IVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            + LLL T+AT NIL+++ VG   V+ H AFR+ +DLF +E + A
Sbjct  132  VALLLLTDATVNILVAVAVGVAAVVAHAAFRRMEDLFLEEVASA  175



>ref|XP_002455006.1| hypothetical protein SORBIDRAFT_03g002890 [Sorghum bicolor]
 gb|EES00126.1| hypothetical protein SORBIDRAFT_03g002890 [Sorghum bicolor]
Length=192

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 128/178 (72%), Gaps = 8/178 (4%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS--------LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNF  196
            M+ YGTIPTSSSAG          L++ISR K R    L  RRPWRE+ + H++GLP + 
Sbjct  1    MSKYGTIPTSSSAGGGVSLGGASPLDFISRAKARGASALATRRPWRELADVHAVGLPPSL  60

Query  197  HDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLII  376
             DA  R++ NLA+F MNYA+VVLV++FLSLLWHP+SLIVF+  M AWL LYFLRDEPL++
Sbjct  61   GDAYLRVRANLAHFAMNYAIVVLVVVFLSLLWHPVSLIVFLVCMLAWLVLYFLRDEPLVL  120

Query  377  VGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADE  550
             GR++ D  VL  L+V T+ LLL T+ATANIL SL +G V+VL+H A  K DD  ADE
Sbjct  121  FGRVVADGYVLAALAVITLGLLLLTDATANILSSLSIGLVLVLLHAALHKADDNAADE  178



>ref|XP_004146852.1| PREDICTED: LOW QUALITY PROTEIN: 3-epi-6-deoxocathasterone 23-monooxygenase-like 
[Cucumis sativus]
Length=861

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +2

Query  35   ENMTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            + MT YGTIPTSS+A A+LEYISR K+R K+GLG RRPWR + ++HS  LPSN HD +SR
Sbjct  679  KTMTNYGTIPTSSAAAANLEYISRAKQRFKDGLGHRRPWRLIADYHSFTLPSNLHDTLSR  738

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IK NL YFRMNYA+VVLV+LFL+LLWHPISL+V   +++ WLFLYFLRD+PLI+ GR++ 
Sbjct  739  IKINLTYFRMNYAIVVLVVLFLALLWHPISLLVLFLMLSLWLFLYFLRDQPLILAGRVLE  798

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            D ++L++LS+ T+  L  TNAT NILI+LLVGA +VL H A RKTD+L+ DEE    L
Sbjct  799  DWIILLLLSLFTLGFLFLTNATLNILIALLVGAALVLAHAAVRKTDNLYLDEEEATGL  856



>ref|XP_004154871.1| PREDICTED: 3-epi-6-deoxocathasterone 23-monooxygenase-like [Cucumis 
sativus]
Length=859

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = +2

Query  35   ENMTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            + MT YGTIPTSS+A A+LEYISR K+R K+GLG RRPWR + ++HS  LPSN HD +SR
Sbjct  677  KTMTNYGTIPTSSAAAANLEYISRAKQRFKDGLGHRRPWRLIADYHSFTLPSNLHDTLSR  736

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IK NL YFRMNYA+VVLV+LFL+LLWHPISL+V   +++ WLFLYFLRD+PLI+ GR++ 
Sbjct  737  IKINLTYFRMNYAIVVLVVLFLALLWHPISLLVLFLMLSLWLFLYFLRDQPLILAGRVLE  796

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            D ++L++LS+ T+  L  TNAT NILI+LLVGA +VL H A RKTD+L+ DEE    L
Sbjct  797  DWIILLLLSLFTLGFLFLTNATLNILIALLVGAALVLAHAAVRKTDNLYLDEEEATGL  854



>ref|XP_010915238.1| PREDICTED: PRA1 family protein F3 [Elaeis guineensis]
Length=195

 Score =   165 bits (417),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 140/175 (80%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS-LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            MTTYGTIPTSS   A+ L++ISR KER +E L  RRPWRE+ + H   LP +  +A  RI
Sbjct  1    MTTYGTIPTSSGGAATPLDFISRAKERGREALATRRPWRELADIHYFSLPPSLGEAYLRI  60

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            +TN+ YF MNYA++VL+I+FLSLLWHPISLIVF+ +MA WLFLYFLRDEPL+I+GR I D
Sbjct  61   RTNMGYFAMNYAIIVLLIVFLSLLWHPISLIVFMVMMALWLFLYFLRDEPLVILGRTIGD  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            R VLIVLS+ T+V+LL TNAT NIL+SLLVG +VV++H A R+TDDLF +EE+  
Sbjct  121  RTVLIVLSLVTLVVLLLTNATLNILVSLLVGLLVVVLHAALRRTDDLFMEEEAAG  175



>ref|XP_009146459.1| PREDICTED: PRA1 family protein F3 [Brassica rapa]
Length=181

 Score =   164 bits (416),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 127/175 (73%), Gaps = 2/175 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG I TSS  S    L+ +SR K++IK+GL  RRPWR MF+FHS+G+P +  DA SR
Sbjct  1    MTNYGAISTSSHGSPVVDLDSVSRVKQQIKDGLATRRPWRVMFDFHSVGIPRSLSDAFSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IK NL YF+ NYA+V LV++FLSL+ HP SLIV   L+  W+FLYF RDEP+ +    ++
Sbjct  61   IKKNLVYFQTNYAIVFLVVIFLSLIKHPTSLIVLTVLVFVWIFLYFPRDEPIKLFSYQVD  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            D+ VL+ LSV TIVLL  TNAT NI  +LL+GAV+VL+H   RKTDDLF DE++ 
Sbjct  121  DKTVLVCLSVITIVLLFLTNATLNIAGALLIGAVLVLIHAVVRKTDDLFLDEKAA  175



>gb|KFK38692.1| hypothetical protein AALP_AA3G147800 [Arabis alpina]
Length=184

 Score =   164 bits (414),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YGTIPTSS  S    LEYISR K+RIK GL  RRPWR MF+  S+ LP  F D++SR
Sbjct  1    MTNYGTIPTSSHPSPAIDLEYISRAKDRIKSGLSTRRPWRSMFDLESMTLPHGFFDSLSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTN+AYFR NYA+V L ILF+SLL+HP SL+V   L+  W+FLYFLRDE L + G  I+
Sbjct  61   IKTNMAYFRANYAIVFLFILFISLLYHPTSLLVLAILIVFWIFLYFLRDESLKVYGYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            DR VLI LSV T+VLLL T+AT+NI+ SL++  V+V++H   R++D+LF DEE+ A L  
Sbjct  121  DRTVLIGLSVLTVVLLLLTHATSNIVWSLVIATVLVMIHTVVRRSDNLFLDEETAAGLTS  180

Query  575  HAPS  586
            H  S
Sbjct  181  HPSS  184



>ref|XP_010501077.1| PREDICTED: PRA1 family protein F3-like [Camelina sativa]
Length=188

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = +2

Query  35   ENMTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAV  208
            +++T  G +PTSS       L+ IS TK+RIK+GL  RRPW+ MF+FH +GLP    DA 
Sbjct  8    KDLTNDGAVPTSSHGLPLVDLDSISHTKQRIKDGLATRRPWKVMFDFHYMGLPQGVSDAF  67

Query  209  SRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRL  388
            SRIKTNLAYFR NYA+VVL ++F SL+WHP SL +F  L+  W+FLYF RDEPL +    
Sbjct  68   SRIKTNLAYFRSNYAIVVLNVIFFSLIWHPTSLFLFGGLLLLWIFLYFFRDEPLKLFRFQ  127

Query  389  INDRVVLIVLSVATI-VLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            I+DRVVLIVLSV T+  LLLFT+AT NI+++L+ GAV+VL+H A R+T+DLF DEE+ 
Sbjct  128  IDDRVVLIVLSVITVACLLLFTDATFNIVVALMAGAVLVLIHAAVRRTEDLFLDEEAA  185



>emb|CDY24050.1| BnaA06g00480D [Brassica napus]
Length=187

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 128/171 (75%), Gaps = 2/171 (1%)
 Frame = +2

Query  41   MTTYGTIPTSS--SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG+IPTSS  S    LEYISR K RIK GL  RRPW+ MF+  S  LP  F DA+SR
Sbjct  1    MTNYGSIPTSSHPSPPIDLEYISRAKHRIKSGLATRRPWKTMFDLQSTNLPHGFFDAISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNL YFR NYA+VVL++LFLSL++HP SL+V   L+  W+FLYFLRDEPL++    I+
Sbjct  61   IKTNLVYFRANYAVVVLLVLFLSLVYHPTSLLVLAVLVVFWIFLYFLRDEPLVVFRHQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFAD  547
            DR V+I LSV TIV+LLFT+ATAN+L ++    V+VLVH A R++D+L+ D
Sbjct  121  DRTVMICLSVLTIVMLLFTHATANVLGAVATAVVLVLVHAAVRRSDNLYLD  171



>ref|XP_010487140.1| PREDICTED: PRA1 family protein F3-like [Camelina sativa]
Length=188

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = +2

Query  35   ENMTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAV  208
            +++T  G +PTSS       L+ IS TK+RIK+GL  RRPW+ MF+FHS+GLP    DA 
Sbjct  8    KDLTNDGAVPTSSHGLPLVDLDSISHTKQRIKDGLATRRPWKVMFDFHSMGLPHGVSDAF  67

Query  209  SRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRL  388
            SRIKTNLAYFR NYA+VVL ++F SL+WHP SL +F  L+  W+FLYF RDEPL +    
Sbjct  68   SRIKTNLAYFRSNYAIVVLNVIFFSLIWHPTSLFLFGGLLLLWIFLYFFRDEPLKLFRFQ  127

Query  389  INDRVVLIVLSVATI-VLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            I+DRVVLIVLSV T+  L+LFT+AT NI+ +L+ GAV+VL+H A R+T+DLF DEE+ 
Sbjct  128  IDDRVVLIVLSVITVACLMLFTDATFNIVAALMAGAVLVLIHAAVRRTEDLFLDEEAA  185



>ref|XP_009371229.1| PREDICTED: PRA1 family protein F3-like [Pyrus x bretschneideri]
Length=181

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSS--AGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MTTYGTIPTSSS   G S EYISR K+RI+ GLG RRPW+ MFNF S   PS+F DA  +
Sbjct  1    MTTYGTIPTSSSSSQGPSGEYISRAKDRIRAGLGARRPWKLMFNFRSFNFPSSFSDAFGQ  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            +++N+AYFRMNYA+VVL+ILFLSLLWHPISLIVFV +MAAWLFLYFLRDEPL + G+  +
Sbjct  61   VRSNVAYFRMNYAIVVLLILFLSLLWHPISLIVFVVMMAAWLFLYFLRDEPLGLFGKTED  120

Query  395  DRVVLIVLS  421
            DRVVLIVL+
Sbjct  121  DRVVLIVLA  129



>ref|XP_010686079.1| PREDICTED: PRA1 family protein F3-like [Beta vulgaris subsp. 
vulgaris]
Length=197

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = +2

Query  80   GASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlv  259
             A+L++ISR K  +   L  RRPWR++F+ HS+  P N  DA+SR+KTNL+YFRMN+A+ 
Sbjct  26   SANLDFISRAKHNLYNNLSARRPWRQIFDHHSLSFPHNLSDAISRLKTNLSYFRMNFAMF  85

Query  260  vlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVL  439
            +L+ILFLSLLWHPISLIVF+ALM AWLFLYFLRDEPL +  R I+DR+VL +LSV T+ L
Sbjct  86   ILLILFLSLLWHPISLIVFLALMLAWLFLYFLRDEPLHLFSRSIDDRIVLTILSVLTVGL  145

Query  440  LLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
            LL T AT NILIS+ VG  +V+++  FR++DDLF DE+ 
Sbjct  146  LLLTGATGNILISVAVGVSIVVIYSVFRRSDDLFLDEDQ  184



>ref|XP_004968524.1| PREDICTED: PRA1 family protein F3-like isoform X1 [Setaria italica]
 ref|XP_004968525.1| PREDICTED: PRA1 family protein F3-like isoform X2 [Setaria italica]
Length=192

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 138/193 (72%), Gaps = 10/193 (5%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--------ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNF  196
            M+ YGTIPTSSSAG        + L++ISR K R    L  RRPWRE+ + H+IGLP + 
Sbjct  1    MSKYGTIPTSSSAGGGAPLGGASPLDFISRAKARGASALATRRPWRELGDVHAIGLPPSL  60

Query  197  HDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLII  376
             DA  R++ NLA+F MNYA+VVLV++FLSLLWHP+SLIVF+  M AWL LYFLRDEPL++
Sbjct  61   GDAYLRVRANLAHFAMNYAIVVLVVVFLSLLWHPVSLIVFLVCMLAWLVLYFLRDEPLVL  120

Query  377  VGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
             GR++ D  VL VL+V T+ LLLFT ATANIL SLL+G V+V++H A  K +D  AD+E 
Sbjct  121  FGRVVADGYVLAVLAVVTLGLLLFTGATANILSSLLIGLVLVVLHAALHKAED-NADDEV  179

Query  557  GAFLAGHAPSAPS  595
            G + A   P  PS
Sbjct  180  GRWYAP-VPQQPS  191



>ref|NP_566461.1| prenylated RAB acceptor 1.F3 [Arabidopsis thaliana]
 sp|Q9LIC6.1|PR1F3_ARATH RecName: Full=PRA1 family protein F3; Short=AtPRA1.F3 [Arabidopsis 
thaliana]
 dbj|BAB01921.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO42194.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50485.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75403.1| PRA1 family protein F3 [Arabidopsis thaliana]
Length=188

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 136/188 (72%), Gaps = 2/188 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS A     +E +SR K RIK GL  RR WR MF+FHS+GLP    DA +R
Sbjct  1    MTNYGAIPTSSHASPLVDVESLSRAKHRIKAGLATRRAWRVMFDFHSMGLPHGVSDAFTR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNLAYFRMNYA+VVL+++F SL+WHP SLIVF  L+  W+FLYFLRDEP+ +    I+
Sbjct  61   IKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVVVWIFLYFLRDEPIKLFRFQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            DR VLIVLSV T+VLLL TNAT NI+ +L+ GAV+VL+H   RKT+DLF DEE+      
Sbjct  121  DRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHSVVRKTEDLFLDEEAATTETS  180

Query  575  HAPSAPSS  598
               S PS+
Sbjct  181  GLTSYPST  188



>gb|AAM66945.1| unknown [Arabidopsis thaliana]
Length=188

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 136/188 (72%), Gaps = 2/188 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS A     +E +SR K RIK GL  RR WR MF+FHS+GLP    DA +R
Sbjct  1    MTNYGAIPTSSHASPLVDVESLSRAKHRIKAGLATRRAWRVMFDFHSMGLPHGVSDAFTR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTNLAYFRMNYA+VVL+++F SL+WHP SLIVF  L+  W+FLYFLRDEP+ +    I+
Sbjct  61   IKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVVVWIFLYFLRDEPIKLFRFQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            DR VLIVLSV T+VLLL TNAT NI+ +L+ GAV+VL+H   RKT+DLF DEE+      
Sbjct  121  DRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHAVVRKTEDLFLDEEAATTETS  180

Query  575  HAPSAPSS  598
               S PS+
Sbjct  181  GLTSYPST  188



>emb|CDM81515.1| unnamed protein product [Triticum aestivum]
Length=190

 Score =   162 bits (409),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 130/186 (70%), Gaps = 10/186 (5%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS---------LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSN  193
            M+ YGTIPTSSSA A          L++ISR K R    L  RRPWRE+ + H++GLP +
Sbjct  1    MSKYGTIPTSSSAAAGAPHLGGASPLDFISRAKARGATALATRRPWRELADVHAVGLPPS  60

Query  194  FHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLI  373
              DA  R++ NLA+F MNYA+VVLV++FLSLLW PISLIVF+  M  WL LYFLRDEP++
Sbjct  61   LGDAYLRVRANLAHFAMNYAIVVLVVVFLSLLWQPISLIVFLVCMVGWLVLYFLRDEPIV  120

Query  374  IVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE  553
            + GR++ D VVL VL+  T++LLL T AT NIL SLL+G V+V+VH A  K +D   DEE
Sbjct  121  LFGRVVGDGVVLAVLAAVTLILLLLTGATTNILTSLLIGFVLVVVHAALHKAED-NVDEE  179

Query  554  SGAFLA  571
             G + A
Sbjct  180  VGRWYA  185



>ref|XP_010465226.1| PREDICTED: PRA1 family protein F3-like [Camelina sativa]
Length=189

 Score =   161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 131/177 (74%), Gaps = 3/177 (2%)
 Frame = +2

Query  35   ENMTTYGTIPTSSSAG--ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAV  208
            +++T  G +PTSS       L+ IS TK+RIK+GL  RRPW+ MF+FH +G+P    DA 
Sbjct  8    KDLTNDGAVPTSSHGLPLVDLDSISHTKQRIKDGLATRRPWKVMFDFHYMGVPQGLSDAF  67

Query  209  SRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRL  388
            SRIKTNLAYFR NYA+VVL ++F SL+WHP SL +F  L+  W+FLYF RDEPL +    
Sbjct  68   SRIKTNLAYFRSNYAIVVLNVIFFSLIWHPTSLFLFAGLLLLWIFLYFFRDEPLKLFRFQ  127

Query  389  INDRVVLIVLSVATI-VLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
            I+DRVVLIVLSV T+  LLLFT+AT NI+ +L+ GAV+VL+H   R+T+DLF DEE+
Sbjct  128  IDDRVVLIVLSVITVACLLLFTDATFNIVAALMAGAVLVLIHAVVRRTEDLFLDEEA  184



>ref|XP_004510362.1| PREDICTED: PRA1 family protein F3-like [Cicer arietinum]
Length=183

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 130/162 (80%), Gaps = 5/162 (3%)
 Frame = +2

Query  59   IPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNF-HDAVSRIKTNLAY  235
            IPT       LEYI+R K+RIK GLG RR W+ MF+  S+G+PSN   +++SRI+ N++Y
Sbjct  13   IPTPPK----LEYIARGKQRIKAGLGTRRAWKTMFDLRSLGIPSNIIPESISRIRVNISY  68

Query  236  FRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIV  415
            FRMNY +V+L+ILFLSLLWHPISLIVFV LMAAWLFLYFLRD+P+I+ GRL++DR+V+++
Sbjct  69   FRMNYTMVLLLILFLSLLWHPISLIVFVLLMAAWLFLYFLRDQPVILWGRLVDDRLVVVL  128

Query  416  LSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF  541
            ++  T+ LLL T+AT NI++++ V  +VVLVH  FRKT+DL 
Sbjct  129  MAFVTVALLLLTHATVNIVVAVFVALLVVLVHAVFRKTEDLL  170



>gb|AAY18432.1| prenylated rab acceptor family protein [Noccaea caerulescens]
Length=179

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 129/178 (72%), Gaps = 0/178 (0%)
 Frame = +2

Query  65   TSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRM  244
            +++S  A L+ ISR K+RIK GL  RRPWR MF++HS+GLP       SRIKTN+ YF+ 
Sbjct  2    SNASPVADLDSISRAKQRIKAGLATRRPWRVMFDYHSVGLPRGVSVVFSRIKTNIVYFQT  61

Query  245  NYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSV  424
            NYA+V+L++LFLSL+ HP SLIVF  L+  W+FLYFLRDEP+ +    I+DR +L VLSV
Sbjct  62   NYAIVILIVLFLSLIKHPTSLIVFTVLIFVWVFLYFLRDEPIKVFRYQIDDRTILGVLSV  121

Query  425  ATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHAPSAPSS  598
             TIVLL  T AT NI+ +LL+GAV+VL+H AFR T+DLF DEE+    A    S PSS
Sbjct  122  ITIVLLFLTGATFNIVGALLIGAVLVLIHAAFRTTEDLFLDEEAATSEASGLTSYPSS  179



>ref|XP_008390975.1| PREDICTED: PRA1 family protein F2-like [Malus domestica]
Length=201

 Score =   160 bits (405),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIPT   A ++  +++R KE+I+  LG RRPW+E+    ++ LPS F+ +V RIK
Sbjct  1    MTTYGTIPTEPPASSNQHFVARAKEQIQSALGNRRPWQEIIQLQNLTLPSTFNQSVHRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+ +FRMNYA++   ILFLSLLWHPISLIVF+ +M AW+FL+FL D+PL+I+G  IN +
Sbjct  61   TNVVFFRMNYAIITXSILFLSLLWHPISLIVFIVMMVAWIFLFFLHDQPLMILGYRINGQ  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF-ADEE  553
            +V++ L V T+V L  TNA  +I+  L +G  VVLVHGA R+ +D+F  D+E
Sbjct  121  LVMMALLVVTLVALYLTNARYHIIAGLCIGLAVVLVHGALREPEDVFIVDDE  172



>emb|CDY37483.1| BnaC01g37490D [Brassica napus]
Length=182

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 124/175 (71%), Gaps = 2/175 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLE--YISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YG IPTSS     ++   ISR K+RIK+GL M RPWR+MF+ HS+ LP    +A SR
Sbjct  1    MTNYGAIPTSSHGSPVMDPDSISRAKQRIKDGLAMSRPWRQMFDLHSMRLPHGVSEAFSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IK NL+YF+ NYA+VVLV++F SL+ HP SLIV   L+  W+FLYF RDEP+ +    I+
Sbjct  61   IKKNLSYFQTNYAIVVLVLIFFSLIKHPTSLIVLTVLVFVWIFLYFFRDEPIKVFRYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            D  VL+ LSV TIVLL  T+ T N++ +L+ GAV+VL+H   RKT+DLF DEE+ 
Sbjct  121  DHTVLVCLSVITIVLLFLTDVTLNLVGALVTGAVLVLIHAVVRKTEDLFLDEEAA  175



>ref|XP_007203351.1| hypothetical protein PRUPE_ppa020384mg [Prunus persica]
 gb|EMJ04550.1| hypothetical protein PRUPE_ppa020384mg [Prunus persica]
Length=201

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIPT     ++L +++R KE+I+ GLG RRPW EM     + LP+ F+ ++ RIK
Sbjct  1    MTTYGTIPTEPPPSSNLHFVARAKEQIESGLGKRRPWLEMIELQDLTLPTTFNQSIQRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            +N+ +FRMNYA+++L ILFLSLLWHPISLIVF+  M AWLFLYFL D+PL+++G  I++R
Sbjct  61   SNVVFFRMNYAIIILFILFLSLLWHPISLIVFIITMVAWLFLYFLHDQPLMVLGYRIDER  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF  541
            +V I L + TIV L  T+A  +I++ L +G  VVLVHGA R+ +D+F
Sbjct  121  LVTISLLLVTIVALFLTSAKYHIIVGLSIGLGVVLVHGALREPEDVF  167



>ref|XP_008242408.1| PREDICTED: PRA1 family protein F2-like [Prunus mume]
Length=215

 Score =   158 bits (399),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 126/173 (73%), Gaps = 1/173 (1%)
 Frame = +2

Query  38   NMTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
             MTTYGTIPT      +L +++R KE+I+ GLG RRPW EM     + LP+ F+ ++ RI
Sbjct  14   TMTTYGTIPTEPPPSLNLHFVARAKEQIESGLGKRRPWLEMIQLQDLTLPTTFNQSIQRI  73

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            K+N+ +FRMNYA+++L ILFLSLLWHPISLIVF+  M AWLFLYFL D+PL+++G  I++
Sbjct  74   KSNVVFFRMNYAIIILFILFLSLLWHPISLIVFIITMVAWLFLYFLHDQPLMVLGYRIDE  133

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF-ADEE  553
            R+V I L + TIV L  T+A   I++ L +G  VVLVHGA R+ +D+F  DEE
Sbjct  134  RLVTISLLLVTIVALFLTSAKYLIIVGLSIGLGVVLVHGALREPEDVFIVDEE  186



>ref|XP_003597622.1| PRA1 family protein F2 [Medicago truncatula]
 ref|XP_003636421.1| PRA1 family protein F2 [Medicago truncatula]
 gb|ABN08419.1| Prenylated rab acceptor PRA1 [Medicago truncatula]
 gb|AES67873.1| PRA1 (prenylated RAB acceptor) family protein [Medicago truncatula]
Length=188

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 124/176 (70%), Gaps = 7/176 (4%)
 Frame = +2

Query  44   TTYGTIPTS-SSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            TTYGTIPT  S    +L+ ISRT E IK  +G RRPW+  FN  S  LP NF+DA+SR K
Sbjct  3    TTYGTIPTPLSPLQTNLQLISRTNESIKFVIGTRRPWKLFFNVQSFNLPRNFNDAISRYK  62

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N+ +F MNY +++++ILFLSLL+HP SLIVF+ LMA+WLFLYFLRDEP  + GRLI+DR
Sbjct  63   INICFFEMNYTIILVIILFLSLLFHPTSLIVFLELMASWLFLYFLRDEPFTVFGRLISDR  122

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTD-----DLFADEE  553
            VV+  + + T+V +LF     NI ++ +   VV+++H AFR T+     DLF DEE
Sbjct  123  VVVFPMLILTVVFILFIGTIFNIFVA-VFMCVVIVLHAAFRNTNDYSIADLFIDEE  177



>gb|KFK38720.1| hypothetical protein AALP_AA3G151200 [Arabis alpina]
Length=189

 Score =   157 bits (397),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG-ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            MT YG IPTSS+A    L+ ISR K R+K GL   R WR MF+FHS+ LP     A SRI
Sbjct  1    MTNYGAIPTSSNASPVDLDSISRAKHRLKAGLATCRSWRTMFDFHSMNLPRGVSAAFSRI  60

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            KTN+AYF+ NYA+VVL+I+F SL+ HP SLIVF  L   W+FLYFLRDEP+ +    I+D
Sbjct  61   KTNIAYFQTNYAIVVLLIIFFSLIEHPTSLIVFTVLGFVWIFLYFLRDEPIKVFRYQIDD  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            + VLI LSV TI LLL T  T NI+ +LL+GAVV+L+H   RKT+DLF DEE+ 
Sbjct  121  KTVLIGLSVITIGLLLLTGVTFNIIGALLIGAVVILIHAVVRKTEDLFVDEEAA  174



>ref|XP_006838852.1| hypothetical protein AMTR_s00002p00265420 [Amborella trichopoda]
 gb|ERN01421.1| hypothetical protein AMTR_s00002p00265420 [Amborella trichopoda]
Length=199

 Score =   157 bits (397),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 136/187 (73%), Gaps = 6/187 (3%)
 Frame = +2

Query  44   TTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKT  223
            T+YGT+ ++S +G  +E+IS  KE+ K     R  WRE+ N  + GLP +F +A+ RIK 
Sbjct  6    TSYGTVSSASKSG--IEFISLAKEKGKAVYATRTQWRELANPSAFGLPRSFGEALVRIKR  63

Query  224  NLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRV  403
            NLA+FR+NYA+V+L+ILFLSLLWHP+SLIVF+ + AAW  LYF RDEP+++ GR ++DR+
Sbjct  64   NLAHFRVNYAIVILLILFLSLLWHPVSLIVFLVMFAAWFLLYFFRDEPIMVFGRTLDDRL  123

Query  404  VLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE----SGAFLA  571
            VL +LS+ T++ LL T+ T N+L+S+L+G V+VL+H +FR TDDLF DE+    SG    
Sbjct  124  VLAMLSIVTLIALLLTHVTLNVLVSILIGVVIVLLHASFRGTDDLFMDEQEAVGSGLMSF  183

Query  572  GHAPSAP  592
              +P  P
Sbjct  184  AESPMHP  190



>ref|XP_002514139.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48093.1| conserved hypothetical protein [Ricinus communis]
Length=205

 Score =   157 bits (396),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 126/176 (72%), Gaps = 3/176 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIP  S   + L  +   +E+I+  LG RRPWREM    S  LP+ FH+ V  IK
Sbjct  1    MTTYGTIPAESLPSSKLRILLNAREKIESNLGTRRPWREMMQLQSFNLPTTFHETVQSIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRD-EPLIIVGRLIND  397
             N AYFR NY +++LVILFLSLLWHPISLIVF+ +MAAWLFLYFLR+ +PL++   +++D
Sbjct  61   MNAAYFRYNYVIIILVILFLSLLWHPISLIVFIIMMAAWLFLYFLREGDPLVVFDIVMHD  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDL--FADEESG  559
              V+ +L   T+++LLFTN + NI+I+L VG VVV+VHGA R TDDL    DEE G
Sbjct  121  NAVMTLLLTVTVMVLLFTNVSDNIIIALFVGVVVVVVHGAIRSTDDLKYIEDEEEG  176



>ref|XP_010274188.1| PREDICTED: PRA1 family protein F3-like [Nelumbo nucifera]
Length=202

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 129/182 (71%), Gaps = 4/182 (2%)
 Frame = +2

Query  29   SPENMTTYGTIPTS--SSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHD  202
            S    T YGTIP++  S++  ++E+ISR KER K     RRPWRE+ +  + G P ++ +
Sbjct  2    SKAPQTGYGTIPSTAASTSNPAVEFISRAKERGKSVYATRRPWRELADPSAFGRPYSYGE  61

Query  203  AVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVG  382
            A+ RIK NL YFR+NYA++VL+ILFLSLLWHPIS+IVF+ +  AW FLYF RDEPL++  
Sbjct  62   AMVRIKRNLGYFRVNYAIIVLLILFLSLLWHPISMIVFLVVFVAWFFLYFFRDEPLVVFN  121

Query  383  RLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDD--LFADEES  556
            R  +DRVVL +LSV TIV L+FT    N+L+SL++G V+V +H AFR TDD   F  E+ 
Sbjct  122  RTFDDRVVLAILSVVTIVALVFTRVGLNVLVSLIIGVVIVCLHAAFRVTDDQYQFLSEQE  181

Query  557  GA  562
             A
Sbjct  182  AA  183



>ref|XP_009353727.1| PREDICTED: PRA1 family protein F2-like [Pyrus x bretschneideri]
Length=189

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 124/172 (72%), Gaps = 1/172 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIPT S A  +  ++ R KE+I+  L  RRPW+E+    ++ LPS F+ +V RIK
Sbjct  1    MTTYGTIPTESLASLNQHFVPRAKEQIQSALSNRRPWQEIIQLQNLTLPSTFNQSVHRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+ +FRMNYA++   ILFLSLLWHPISLIV + +M AW+FL+FL D+PL+I+G  IN +
Sbjct  61   TNVVFFRMNYAIITFSILFLSLLWHPISLIVLIVMMVAWIFLFFLHDQPLMILGYRINLQ  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF-ADEE  553
            VV++ L V T+V L  TNA  +I+  L +G  VVLVHGA R+ +D+F  D+E
Sbjct  121  VVMMALLVVTLVALYLTNARYHIVAGLCIGLAVVLVHGALREPEDVFVVDDE  172



>ref|XP_008786098.1| PREDICTED: PRA1 family protein F3-like [Phoenix dactylifera]
Length=202

 Score =   154 bits (390),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = +2

Query  44   TTYGTIPTSSSAGAS---LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            + YGTIPT+  A ++    E+ SR KER +  +  RRPWRE+ +  + G P +  +A++R
Sbjct  8    SGYGTIPTAPEAASTSRAAEFFSRAKERGRALVATRRPWRELADPTAFGRPYSCGEAMAR  67

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            ++ NLAYFR+NYAL+VL ILF SLLWHP+S+IVF+ +  AW FLYF RDEP+ + GR I+
Sbjct  68   LRRNLAYFRVNYALIVLFILFCSLLWHPVSMIVFLIVFIAWFFLYFFRDEPIALFGREID  127

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR+VL+ L+V TIV L+FT+   NIL+SL++GAV+V +H AFR T+DLF DE+  A
Sbjct  128  DRLVLLALAVVTIVALVFTHVGLNILVSLIIGAVIVGLHAAFRVTEDLFLDEQEAA  183



>ref|XP_008337698.1| PREDICTED: PRA1 family protein F2-like [Malus domestica]
Length=201

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 123/171 (72%), Gaps = 0/171 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTI T     ++  +++R KE+I+ GL  RRPW EM    ++ LPS F+ ++ RIK
Sbjct  1    MTTYGTITTEPLPSSNQHFVTRAKEQIQTGLENRRPWLEMIQLQNLTLPSTFNQSIHRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+A++RMNYA++ L ILFLSLLWHPISLIVFV +M AW FL+FL D+PL+I+G  IN+R
Sbjct  61   TNVAFYRMNYAIITLFILFLSLLWHPISLIVFVVMMVAWFFLFFLHDQPLMILGYRINER  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE  553
            VV + L V T+V L  TNA  +I+  L +G  VVLVHGA R  +D+F  ++
Sbjct  121  VVTMALLVVTVVALFLTNARYHIVAGLSIGLTVVLVHGALRVPEDVFIVDD  171



>emb|CDY51735.1| BnaA01g37180D [Brassica napus]
Length=182

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 125/175 (71%), Gaps = 2/175 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLE--YISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YGTIPTSS     ++   ISR K+RIK+GL M RPWR+MF+ HS+ LP    +A SR
Sbjct  1    MTNYGTIPTSSHGSPVMDPDSISRAKQRIKDGLAMSRPWRQMFDLHSMRLPHGVSEAYSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IK NL+YF+ NYA+VVLV++F SL+ HP SL+V   L+  W+FLYF RDEP+ +    I+
Sbjct  61   IKKNLSYFQTNYAIVVLVLIFFSLIKHPTSLVVLTVLVFVWIFLYFFRDEPIKVFRYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            D  VL+ LSV TIVLL  T+ T N++ +L+ GAV+VL+H   RKT+DLF DEE+ 
Sbjct  121  DHTVLVCLSVITIVLLFLTDVTLNLVGALVTGAVLVLIHAVVRKTEDLFLDEEAA  175



>ref|XP_010923472.1| PREDICTED: PRA1 family protein F3-like [Elaeis guineensis]
Length=202

 Score =   151 bits (381),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = +2

Query  44   TTYGTIPTSSSAGAS---LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            + YGTIPT+  A ++    E  SR  ER +  +G RRPWRE+ +  + G P +  +A  R
Sbjct  8    SGYGTIPTAPEAASTSRAAELFSRATERGRALIGTRRPWRELADPTAFGRPYSCGEANVR  67

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            ++ NLAYFR+NYAL+VL ILF SLLWHP+S+IVF+ +  AW FLYF RDEP+++ GR I+
Sbjct  68   LRRNLAYFRVNYALIVLFILFCSLLWHPVSMIVFLIVFIAWFFLYFFRDEPIVLFGRAID  127

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR VL  L+V TIV L+FT+   NIL+SL++GAV+V +H  FR T+DLF DE+  A
Sbjct  128  DRFVLFALAVVTIVALVFTHVGLNILVSLIIGAVIVGLHAVFRVTEDLFLDEQEAA  183



>ref|XP_009388477.1| PREDICTED: PRA1 family protein F2-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   150 bits (378),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = +2

Query  86   SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvl  265
            ++E  SR KER +  +  RRPWRE+ +  +   P  + DA++R++ NLAYFR+NYAL  L
Sbjct  30   TVEMFSRAKERGRALVATRRPWRELADPSAFSRPYGYRDAMARVRRNLAYFRVNYALAAL  89

Query  266  vilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLL  445
            V+LF SLLWHPIS+IVF+A+  AW FLYF RDEP+++VGR ++DR+VL  LS+ T+V L+
Sbjct  90   VVLFCSLLWHPISMIVFLAVFVAWFFLYFFRDEPVVLVGRTLDDRLVLAALSLITVVALV  149

Query  446  FTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            FT+   N+L+SL++ AV++ +H AFR TDD F DE+  A
Sbjct  150  FTHVGLNVLVSLIIAAVLIGLHAAFRITDDQFLDEQEAA  188



>ref|XP_010936306.1| PREDICTED: PRA1 family protein F3-like [Elaeis guineensis]
Length=204

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 123/176 (70%), Gaps = 5/176 (3%)
 Frame = +2

Query  50   YGTIPTSSSAGAS-----LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            YGTIPT+  A  +      E   R KER       RRPWRE+ +  + G P ++ +A++R
Sbjct  10   YGTIPTTPEAAVASTSRAAELFYRAKERGGAFFATRRPWRELADPTAFGRPYSYGEAMTR  69

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            ++ NLAYFR+NYALVVL ILF SLLWHP+S+IVF+ +  AW FLYF RDEP++  GR I+
Sbjct  70   VRRNLAYFRVNYALVVLFILFCSLLWHPVSMIVFLIVFVAWFFLYFFRDEPIVFFGREID  129

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR+VL VLS  T+V L+FT+   N+L+SL++G V+V +H AFR T+DL+ DE+  A
Sbjct  130  DRLVLFVLSAVTVVALVFTHVGLNVLVSLIIGFVLVGLHAAFRVTEDLYLDEQEAA  185



>emb|CAN73850.1| hypothetical protein VITISV_021777 [Vitis vinifera]
Length=206

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 123/177 (69%), Gaps = 6/177 (3%)
 Frame = +2

Query  50   YGTIPT------SSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            YGT+P       SSS      +ISR  +R +  +  RRPWRE  ++ ++  P N+ DA++
Sbjct  9    YGTLPNASPAVPSSSTSEQFTFISRATQRTQTLMATRRPWREFLDYSALSRPHNYSDAMA  68

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            RIK N+ YFR+NYA+V+L ILF+SLLWHP S+IVF+ +  AW FLYF RD P+++  + I
Sbjct  69   RIKRNVNYFRVNYAMVMLFILFVSLLWHPTSMIVFLIIFVAWFFLYFFRDNPVVLFHQTI  128

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            +DRVVL++L + T+V L+FT+   N+L+SL++G  VV +H AFR T+DLF +EE  A
Sbjct  129  DDRVVLVLLGLITVVALVFTDVGLNVLVSLIIGVAVVGLHAAFRGTEDLFLNEEEVA  185



>ref|XP_009352640.1| PREDICTED: PRA1 family protein F2-like [Pyrus x bretschneideri]
Length=201

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 121/171 (71%), Gaps = 0/171 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTI T     ++  ++ R KE+I+ GL  RRPW  M    ++ +PS F+ ++ RIK
Sbjct  1    MTTYGTITTEPPPSSNQHFVIRAKEQIQTGLENRRPWLGMIQLQNLTIPSTFNQSIHRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+ ++RMNYA++ L +LFLSLLWHPISLIVFV +M AW FL+FL D+PL+I+G  IN+R
Sbjct  61   TNVVFYRMNYAIITLFLLFLSLLWHPISLIVFVVMMVAWFFLFFLHDQPLMILGYRINER  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE  553
            VV + L V T+V L  TNA  +I+  L +G  VVLVHGA R+ +D+F  ++
Sbjct  121  VVTMALLVVTVVALFLTNARYHIIAGLSIGLAVVLVHGALREPEDVFIVDD  171



>ref|XP_009407747.1| PREDICTED: PRA1 family protein F2-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 121/185 (65%), Gaps = 14/185 (8%)
 Frame = +2

Query  50   YGTIPTS--------------SSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLP  187
            YG IPT+              +S   ++E  SR KER    +  RRPWRE+    +   P
Sbjct  11   YGAIPTAPEEAAEPLSPRVPFASGSRAVEMFSRAKERGTALVATRRPWRELAAPSAFSSP  70

Query  188  SNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEP  367
              + DAV+R++ NLAYFR+NYALV L +LF SLLWHP+S+IVF+A+  AW FLYF RDEP
Sbjct  71   YGYRDAVARVRRNLAYFRVNYALVALFVLFCSLLWHPVSMIVFLAVFVAWFFLYFFRDEP  130

Query  368  LIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFAD  547
            ++  GR ++DR+VL  LS+ T+V LLFT+   N+L+SL+  AV+V +H AFR TDD F D
Sbjct  131  VVFFGRAVDDRLVLAALSLVTLVALLFTHVGLNVLVSLITVAVLVGLHAAFRFTDDQFLD  190

Query  548  EESGA  562
            E+  A
Sbjct  191  EQEVA  195



>ref|XP_009117519.1| PREDICTED: PRA1 family protein F3-like [Brassica rapa]
Length=182

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 124/176 (70%), Gaps = 2/176 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLE--YISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MT YGTIPTSS     ++   ISR K+RIK+GL M RPWR+MF+ H + LP    +A SR
Sbjct  1    MTNYGTIPTSSHGSPVMDPDSISRAKQRIKDGLDMSRPWRQMFDIHYMRLPHGVPEAYSR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IK NL++F+ NYA+VVLV++F SL+ HP SL+V   L+  W+FLYF RDEP+ +    I+
Sbjct  61   IKKNLSHFQTNYAIVVLVLIFFSLIKHPTSLVVLTVLVFVWIFLYFFRDEPIKVFRYQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            D  VL+ LSV TIVLL  T+ T N++ +L+ GAV+VL+H   RKT+DLF DEE+  
Sbjct  121  DHTVLVCLSVITIVLLFLTDVTLNLVGALVTGAVLVLIHAVVRKTEDLFLDEEAAT  176



>ref|XP_008805952.1| PREDICTED: PRA1 family protein F3-like [Phoenix dactylifera]
 ref|XP_008805953.1| PREDICTED: PRA1 family protein F3-like [Phoenix dactylifera]
Length=204

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 125/176 (71%), Gaps = 5/176 (3%)
 Frame = +2

Query  50   YGTIPTSSSAGAS-----LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            YG IPT+  A  +      E   R KER    +  RRPWRE+ +  + G P ++ +A++R
Sbjct  10   YGAIPTAPEAAVASTSRAAELFGRAKERGGALIATRRPWRELADPTAFGRPYSYGEAMAR  69

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            ++ NL+YFR+NYALVVL +LF SLLWHP+S+IVF+ +  AW FLYF RD PL++ GR I+
Sbjct  70   VRRNLSYFRVNYALVVLFVLFCSLLWHPVSMIVFLVVFVAWFFLYFFRDGPLVLFGREID  129

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DR+VL  LSV T+V L+FT+   N+L+SL++GAV+V++H AFR T+DL+ DE+  A
Sbjct  130  DRLVLFALSVVTVVALVFTHVGLNVLVSLIIGAVLVVLHAAFRVTEDLYLDEQEAA  185



>ref|XP_010660142.1| PREDICTED: PRA1 family protein E [Vitis vinifera]
Length=206

 Score =   147 bits (371),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 122/177 (69%), Gaps = 6/177 (3%)
 Frame = +2

Query  50   YGTIPT------SSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            YGT+P       SSS      +ISR  +R +  +  RRPWRE  ++  +  P N+ DA++
Sbjct  9    YGTLPNASAAVPSSSTSEQFTFISRATQRTQTLMATRRPWREFLDYSVLSRPHNYSDAMA  68

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            RIK N+ YFR+NYA+V+L ILF+SLLWHP S+IVF+ +  AW FLYF RD P+++  + I
Sbjct  69   RIKRNVNYFRVNYAMVMLFILFVSLLWHPTSMIVFLIIFVAWFFLYFFRDNPVVLFHQTI  128

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            +DRVVL++L + T+V L+FT+   N+L+SL++G  VV +H AFR T+DLF +EE  A
Sbjct  129  DDRVVLVLLGLITVVALVFTDVGLNVLVSLIIGVAVVGLHAAFRGTEDLFLNEEEVA  185



>ref|NP_001148484.1| prenylated rab acceptor family protein [Zea mays]
 gb|ACG31682.1| prenylated rab acceptor family protein [Zea mays]
 gb|ACN30850.1| unknown [Zea mays]
 gb|ACR38222.1| unknown [Zea mays]
 tpg|DAA52982.1| TPA: Prenylated rab acceptor family isoform 1 [Zea mays]
 tpg|DAA52983.1| TPA: Prenylated rab acceptor family isoform 2 [Zea mays]
Length=193

 Score =   146 bits (369),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 131/179 (73%), Gaps = 9/179 (5%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS---------LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSN  193
            M+ YGTIPTSSSAG           L++ISR K R    L  RRPWRE+ + H++GLP +
Sbjct  1    MSKYGTIPTSSSAGGGPVPLGGASPLDFISRAKARGASALATRRPWRELVDVHAVGLPPS  60

Query  194  FHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLI  373
              DA  R++ NLA+F MNYA+VVLV++FLSLLWHP+SLIVF+  M AWL LYFLRDEPL+
Sbjct  61   LGDAYLRVRANLAHFAMNYAIVVLVVVFLSLLWHPVSLIVFLVCMLAWLVLYFLRDEPLV  120

Query  374  IVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADE  550
            + GR++ D  VL VL+V T+VLLL T+ATANIL SLL+G V+VLVH A  K +D  ADE
Sbjct  121  LFGRVVADGYVLAVLAVVTLVLLLLTDATANILSSLLIGLVLVLVHAALHKAEDNAADE  179



>ref|XP_011032390.1| PREDICTED: PRA1 family protein E-like [Populus euphratica]
Length=214

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 134/207 (65%), Gaps = 18/207 (9%)
 Frame = +2

Query  29   SPENMTTYGTIPTSSSAGAS-------------LEYISRTKERIKEGLGMRRPWREMFNF  169
            S +    YGTIP++ SA  +             L +ISR     +  +  RRPW+E+   
Sbjct  2    SRKAQAGYGTIPSTMSATTTTTTTTQSPQSPTTLTFISRVSTSTQTLIATRRPWQELIKL  61

Query  170  HSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLY  349
             S   P+N+++A+SRIK N+ YFR+NYA++ L ILFLSLLWHPIS+IVF+ +  AWLFLY
Sbjct  62   SSFISPNNYNEALSRIKFNVNYFRVNYAMICLAILFLSLLWHPISMIVFIVIFVAWLFLY  121

Query  350  FLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKT  529
            F RD P+++  + ++DRVVL VL + TI+ L+FT+   N+LI+L++G V+V VH AFR T
Sbjct  122  FGRDGPVVVFNKSLDDRVVLCVLGLVTILALVFTHVGLNVLIALIIGVVIVGVHAAFRGT  181

Query  530  DDLFADEES---GAFLA--GHAPSAPS  595
            +DLF DEES   G  L+  G  P  P+
Sbjct  182  EDLFLDEESAVEGGLLSVVGSQPLRPT  208



>ref|XP_004135817.1| PREDICTED: PRA1 family protein F2-like [Cucumis sativus]
 gb|KGN66230.1| hypothetical protein Csa_1G587410 [Cucumis sativus]
Length=199

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 120/173 (69%), Gaps = 0/173 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            M TYGTIPT     ++L Y SR +ERI   LG RRPW EM     +  P++F   ++RIK
Sbjct  1    MGTYGTIPTEPVPLSNLHYTSRARERIASALGKRRPWMEMIQPQDLSFPTSFLQLINRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N  YF  NY L+VL ILFLSLLW PISL+VF+    AWL+LYFL DEP ++ G +++D+
Sbjct  61   NNAEYFWTNYILIVLFILFLSLLWQPISLVVFIISFLAWLYLYFLHDEPWVVRGSIVDDQ  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            +V++VL + TI LLL T+AT NI+IS+ VG +VV VHGA + ++D F+ +E G
Sbjct  121  LVMVVLMLITIALLLITDATMNIIISMFVGVLVVFVHGALKGSEDAFSLDEEG  173



>ref|XP_009408855.1| PREDICTED: PRA1 family protein F3-like [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 139/179 (78%), Gaps = 5/179 (3%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS-----LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDA  205
            MTTYGTIPTS+   +S     L+YISR KER +  L MRRPWR++ N H++GLP +  +A
Sbjct  1    MTTYGTIPTSTGPSSSSSATPLDYISRAKERGRSALAMRRPWRQLANVHAMGLPPSLGEA  60

Query  206  VSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGR  385
              RI+TN AYF MNYA++VL+++F SLLWHPISLIVF+A +AAWLFLYFLRDEPL+  GR
Sbjct  61   YVRIRTNAAYFAMNYAIIVLLVVFCSLLWHPISLIVFLACLAAWLFLYFLRDEPLVFFGR  120

Query  386  LINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
             I DRVVLIVLSV T+VLLL T  T+N+LISLLVG ++VL+H   RKT+DL  +EE+  
Sbjct  121  TIGDRVVLIVLSVVTLVLLLLTKVTSNVLISLLVGLLLVLIHAVLRKTEDLVMEEEAAG  179



>ref|XP_010278145.1| PREDICTED: PRA1 family protein F3-like [Nelumbo nucifera]
Length=200

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 129/176 (73%), Gaps = 5/176 (3%)
 Frame = +2

Query  50   YGTIPTSSSAGAS-----LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            YGT+P+++++ ++     +E+ SR KER K     RRPWRE+ +  + G P ++ +A+ R
Sbjct  9    YGTVPSAAASTSTTSGSGIEFFSRAKERGKSIYATRRPWRELADLSAFGRPYSYGEAMVR  68

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            I+ N++YFR+NYA++VL+ILFLSLLWHP+S+IVF+ +   W FLYF RDEPL++  R  +
Sbjct  69   IRRNISYFRVNYAIIVLLILFLSLLWHPVSMIVFLIVFVGWFFLYFFRDEPLVVFNRTFD  128

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            DRVVL +LSV TIV L+FT+   N+L+SL++GAV+V +H  FR T+D F +E+  A
Sbjct  129  DRVVLAILSVITIVALIFTHVWLNVLVSLIIGAVIVFLHATFRTTEDQFLNEQEAA  184



>ref|XP_008450846.1| PREDICTED: PRA1 family protein C [Cucumis melo]
Length=199

 Score =   144 bits (362),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 119/178 (67%), Gaps = 0/178 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            M TYGTIPT     ++L Y SR +ERI   LG RRPW EM     +  PS+F   ++RI+
Sbjct  1    MGTYGTIPTEPLPSSNLHYTSRARERIASALGKRRPWMEMIQPQDLSFPSSFLQLINRIE  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N  YF  NY  ++L ILFLSLLW PISL+VF+    AWL+LYFL DEP ++ G +++D+
Sbjct  61   NNAEYFWTNYIFIILFILFLSLLWQPISLVVFIISFLAWLYLYFLHDEPWVVRGSIVDDQ  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            +V++VL + TI LLL T+AT NI+IS+ VG +VV VHGA + ++D  + +E G    G
Sbjct  121  LVMVVLMLITIALLLITDATKNIIISMFVGVLVVFVHGALKGSEDALSLDEEGLSECG  178



>ref|XP_006382806.1| prenylated rab acceptor family protein [Populus trichocarpa]
 gb|ERP60603.1| prenylated rab acceptor family protein [Populus trichocarpa]
Length=212

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 123/175 (70%), Gaps = 5/175 (3%)
 Frame = +2

Query  86   SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvl  265
            +L +ISR     +  +  RRPW+E+    S   P+N++DA+SRIK N+ YFR+NYA++ L
Sbjct  32   TLTFISRVSTSTQTLIATRRPWQELIKLSSFIRPNNYNDAISRIKFNVNYFRVNYAMIFL  91

Query  266  vilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLL  445
             ILFLSLLWHPIS+IVF+ +  AWLFLYF RD P+++  + ++DRVVL VL + TI+ L+
Sbjct  92   AILFLSLLWHPISMIVFIVMFVAWLFLYFGRDGPVVVFNKSLDDRVVLCVLGLVTILALV  151

Query  446  FTNATANILISllvgavvvlvhgaFRKTDDLFADEES---GAFLA--GHAPSAPS  595
            FT+   N+LI+L++G V+V VH AFR T+DLF DEES   G  L+  G  P  P+
Sbjct  152  FTHVGLNVLIALIIGVVIVGVHAAFRGTEDLFLDEESAVEGGLLSVVGSQPLRPT  206



>ref|XP_010667330.1| PREDICTED: PRA1 family protein F3-like [Beta vulgaris subsp. 
vulgaris]
Length=209

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 127/180 (71%), Gaps = 6/180 (3%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA-SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            MTTYGTIPTS S    +L++I+R K +I+  L   RPW  +F+  S+  P++ +D    I
Sbjct  1    MTTYGTIPTSQSPNTDNLQFITRAKHKIQSTLTTCRPWNLLFSLSSLSFPTSINDTFLTI  60

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            KTNL+YFRMNYA++ L+ILFLSLLWHP+SLIVF   M+AWLF YFLR+ PL++ G  + D
Sbjct  61   KTNLSYFRMNYAIIALIILFLSLLWHPLSLIVFTLFMSAWLFFYFLRESPLVVFGYEVGD  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFA-----DEESGA  562
            + VL++L+V T+V LL T+ T NI+++L V   V++ H A R+TDDL       ++ESGA
Sbjct  121  KAVLLLLTVFTVVFLLLTDVTVNIVVALFVAVAVIVAHAAVRRTDDLPVSDVGFEDESGA  180



>ref|XP_006407177.1| hypothetical protein EUTSA_v10021584mg [Eutrema salsugineum]
 gb|ESQ48630.1| hypothetical protein EUTSA_v10021584mg [Eutrema salsugineum]
Length=189

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 132/189 (70%), Gaps = 3/189 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEY--ISRTKERIKEGLGMRRPWREMFNFHSIGLP-SNFHDAVS  211
            MT YG+IPTSS A   +++  ISR K+RIK GL  RRPWR MF+FHS+G+P     DA S
Sbjct  1    MTNYGSIPTSSHASPVVDHESISRAKQRIKAGLATRRPWRVMFDFHSMGIPRGGVSDAFS  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
             IK NL YF+ NYA+VVL++LFL L+ HP SLIV   L+  W+FLYFLRDEP+ +    I
Sbjct  61   GIKKNLVYFQTNYAIVVLIVLFLGLIKHPTSLIVLTVLVFVWVFLYFLRDEPIKLFRYQI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLA  571
            +DR VL+ L++ TI+LL  TNAT NI+ + LVGAV++L+H   RKT+DLF DEE+     
Sbjct  121  DDRTVLLSLTLLTIILLFLTNATLNIVGACLVGAVLILIHAVVRKTEDLFLDEEAATAET  180

Query  572  GHAPSAPSS  598
                S PSS
Sbjct  181  SGLTSYPSS  189



>ref|XP_009785504.1| PREDICTED: PRA1 family protein F3 [Nicotiana sylvestris]
Length=191

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 130/184 (71%), Gaps = 9/184 (5%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIPTS+++   +  +  +   +   LG RRPW+EM +F    LP +  DA+ RIK
Sbjct  1    MTTYGTIPTSTTSSDDMGMMRSSGGLL---LGTRRPWKEMLSF---SLPESSGDALLRIK  54

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN +YF MNY +++L ++FLSLLWHP+SL+VF+  +AAWLFLYFLRD PL++ G ++++R
Sbjct  55   TNSSYFHMNYLIIILFVIFLSLLWHPVSLVVFLITLAAWLFLYFLRDNPLVVFGYIVDER  114

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDL--FADEESGAFLAG  574
            VVL VLS+ T+VLL+ + +T N++  + VG  +V+ HGA R+TDDL  F DEE    + G
Sbjct  115  VVLAVLSIFTMVLLI-SISTMNVVSGIAVGVAIVVAHGALRRTDDLIIFIDEEEQGGVRG  173

Query  575  HAPS  586
              P+
Sbjct  174  QWPT  177



>dbj|BAJ94157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=190

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 101/149 (68%), Gaps = 6/149 (4%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS------LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHD  202
            M+ YGTIP SSS+ A       L++ISR K R    L  R+PWRE+ +  +I LP    D
Sbjct  1    MSKYGTIPISSSSDAPPPGSSPLDFISRAKARGASALATRQPWRELADPKAIALPRGLGD  60

Query  203  AVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVG  382
            A  R + NLA+F MNYA+VVL ++FLSLLWHP SLIVF+A M AW+FLYFLRD PL + G
Sbjct  61   AYLRARANLAHFSMNYAIVVLGVVFLSLLWHPFSLIVFLACMVAWVFLYFLRDVPLALFG  120

Query  383  RLINDRVVLIVLSVATIVLLLFTNATANI  469
              I D VVL VLS  T++LLL T AT NI
Sbjct  121  HTIGDGVVLAVLSAVTLILLLLTGATGNI  149



>ref|XP_002300800.1| hypothetical protein POPTR_0002s04490g [Populus trichocarpa]
 gb|EEE80073.1| hypothetical protein POPTR_0002s04490g [Populus trichocarpa]
Length=195

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 128/196 (65%), Gaps = 15/196 (8%)
 Frame = +2

Query  26   NSPENMTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDA  205
            NSP    +YG+ P +  +   L   + T   I      RRPWRE+  F S   P +  D 
Sbjct  2    NSPSP-ASYGSFPPTEPSSTFLTRATNTTSTI---FATRRPWRELIEFSSFARPGSLGDT  57

Query  206  VSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGR  385
              RIK NL+YFR+NY +++L ILFLSLLWHP+S+IVF+ +  AW FLYF RD+PL+I  R
Sbjct  58   TIRIKRNLSYFRVNYTMIILSILFLSLLWHPLSMIVFLIVFVAWFFLYFFRDQPLVIFHR  117

Query  386  LINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE---S  556
             I+DRVVL +L VATIV L+FT+   N+L+SLL+GA +V++H AFR+TDD+++D++    
Sbjct  118  TIDDRVVLGLLGVATIVALIFTHVWLNVLVSLLIGAAIVVLHAAFRRTDDMYSDDQDVAD  177

Query  557  GAFL--------AGHA  580
            G+ L        AGHA
Sbjct  178  GSLLSFVGSPTRAGHA  193



>gb|KFK43954.1| hypothetical protein AALP_AA1G196100 [Arabis alpina]
Length=181

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 122/175 (70%), Gaps = 3/175 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA-SLEYISRTKER--IKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MTTYGT PTS +  A  LEYI+R  +   ++ GL  RRPW++M + HS   P      ++
Sbjct  1    MTTYGTNPTSGNDLAPKLEYITRANDHNYVRPGLATRRPWKQMLDLHSFDFPGKIATVIT  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            R + N  YF+ NY ++VL  +FLSL+W+P SL++ VAL+ AWLFLYF+RDEPL++  R I
Sbjct  61   RTRANTVYFQTNYTIIVLFSVFLSLVWNPFSLLILVALLGAWLFLYFVRDEPLVVFDRDI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
            + R+VLI++SV T+ +L  T+A  NI ++++ GAV VLVH A RKT+D++ ++E 
Sbjct  121  DHRIVLILMSVLTLSILFLTDAKLNIAVAIVAGAVAVLVHAAVRKTEDMYQNDED  175



>ref|XP_011028734.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
 ref|XP_011028735.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
 ref|XP_011028736.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
 ref|XP_011028737.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
 ref|XP_011028738.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
Length=198

 Score =   140 bits (354),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 118/172 (69%), Gaps = 0/172 (0%)
 Frame = +2

Query  47   TYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTN  226
            +YG+ P ++ +   L     T          RRPWRE+  F S   P +  D   RIK N
Sbjct  8    SYGSFPPTAPSSTFLTRAINTTYTTSTIFATRRPWRELIEFSSFARPLSLGDTTIRIKRN  67

Query  227  LAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVV  406
            L+YFR+NY +++L ILFLSLLWHP+S+IVF+ +  AW FLYF RD+PL+I  R I+DRVV
Sbjct  68   LSYFRVNYTMIILSILFLSLLWHPLSMIVFLIVFVAWFFLYFFRDQPLVIFHRTIDDRVV  127

Query  407  LIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            L +L VAT+V L+FT+   N+L+SLL+GA +V++H AFR+TDDL++DE+  A
Sbjct  128  LGLLGVATVVALIFTHVWLNVLVSLLIGAAIVVLHAAFRRTDDLYSDEQDVA  179



>emb|CDP03174.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 125/175 (71%), Gaps = 12/175 (7%)
 Frame = +2

Query  44   TTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKT  223
            T YGTIPTS       ++ +   +R++  LG RRPW+EM +  S+  P  F  ++SRI T
Sbjct  3    TMYGTIPTS-------DFYADRLDRVRSDLGKRRPWKEMLS--SLSFPDGFQHSLSRINT  53

Query  224  NLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRV  403
            N+AYF MNYA++VL +LFLSLLWHP+SLIVF  LM AWLFLYFLRD+P+++ G  +++RV
Sbjct  54   NVAYFHMNYAMIVLFVLFLSLLWHPVSLIVFTVLMVAWLFLYFLRDDPIVVFGYAVDERV  113

Query  404  VLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDL--FADEESGA  562
            VL +LS++T+VLL+ T  T N+++ + VG   V+VHGAFR T+DL  + +E  G 
Sbjct  114  VLTILSISTVVLLV-TRTTLNVVVGVAVGLAAVVVHGAFRMTEDLNVYGNEGVGG  167



>ref|XP_011026037.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
 ref|XP_011026038.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
 ref|XP_011026039.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
Length=198

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 118/172 (69%), Gaps = 0/172 (0%)
 Frame = +2

Query  47   TYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTN  226
            +YG+ P ++ +   L     T          RRPWRE+  F S   P +  D   RIK N
Sbjct  8    SYGSFPPTAPSSTFLTRAINTTYTTSTIFATRRPWRELIEFSSFARPLSLGDTTIRIKRN  67

Query  227  LAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVV  406
            L+YFR+NY +++L ILFLSLLWHP+S+IVF+ +  AW +LYF RD+PL+I  R I+DRVV
Sbjct  68   LSYFRVNYTMIILSILFLSLLWHPLSMIVFLIVFVAWFYLYFFRDQPLVIFHRTIDDRVV  127

Query  407  LIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            L +L VAT+V L+FT+   N+L+SLL+GA +V++H AFR+TDDL++DE+  A
Sbjct  128  LGLLGVATVVALIFTHVWLNVLVSLLIGAAIVVLHAAFRRTDDLYSDEQDVA  179



>ref|XP_010519211.1| PREDICTED: PRA1 family protein F1 [Tarenaya hassleriana]
Length=185

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 122/184 (66%), Gaps = 4/184 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSA--GASLEYISRTKERIKEGL--GMRRPWREMFNFHSIGLPSNFHDAV  208
            MTTYGT  TSS++     LEYI+R  +  K       RRPW  MF+  S+  P  F  AV
Sbjct  1    MTTYGTNTTSSNSDLAPKLEYIARANDHHKRHALSTRRRPWTMMFDARSMSFPRKFATAV  60

Query  209  SRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRL  388
            +R++TN  YF+ NYA+V+L  +FLSLLW P+SLIV +AL+ AWL LYFLRDEPL +  R 
Sbjct  61   ARVRTNTVYFQTNYAIVILFAVFLSLLWDPVSLIVLLALLGAWLSLYFLRDEPLKVFDRD  120

Query  389  INDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            I+DR+VLI +SV T+ +L  T A  N+  ++ VGA VV+ H A RKT+DL++++E  A L
Sbjct  121  IDDRLVLIAMSVVTLAVLFLTEAKLNVAAAIAVGAFVVVAHAAVRKTEDLYSNDEETACL  180

Query  569  AGHA  580
               +
Sbjct  181  VNQS  184



>ref|XP_007200543.1| hypothetical protein PRUPE_ppa011712mg [Prunus persica]
 gb|EMJ01742.1| hypothetical protein PRUPE_ppa011712mg [Prunus persica]
Length=200

 Score =   139 bits (351),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 119/173 (69%), Gaps = 2/173 (1%)
 Frame = +2

Query  50   YGTIP-TSSSAGASLEYISRTKERIKEGLGMRRPWREMFN-FHSIGLPSNFHDAVSRIKT  223
            YGT+P T++++ A+     R +E  +     RRPW E+   F++   P  F DA  RIK 
Sbjct  9    YGTLPSTTATSTAAPSTFFRARETTQSFFAKRRPWLELVQPFYNFTRPYTFSDATIRIKR  68

Query  224  NLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRV  403
            NL+YFR+NY +VVL ILFLSLLWHP+SLIVF+ +  AW FLYF RD PL+I   +++DR+
Sbjct  69   NLSYFRVNYTMVVLFILFLSLLWHPVSLIVFLLVFVAWFFLYFFRDNPLVIFNHIVDDRI  128

Query  404  VLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            VL VL V TIV L+FT+   N+L+S+L+G  +V +H AFR T+DL+ DE+  A
Sbjct  129  VLGVLGVVTIVALIFTHVWLNVLVSVLIGVAIVALHAAFRGTEDLYNDEQEAA  181



>ref|XP_009385403.1| PREDICTED: PRA1 family protein F2-like [Musa acuminata subsp. 
malaccensis]
Length=235

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 108/153 (71%), Gaps = 0/153 (0%)
 Frame = +2

Query  92   EYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvi  271
            + +SR KE+ K  +  +RPW ++ N  ++  P+N  +AV+R++ NLAYFR NYAL  +  
Sbjct  57   DLVSRFKEQGKALIAAQRPWPQLLNTTALSRPANAGEAVARLRRNLAYFRSNYALFAIAA  116

Query  272  lflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFT  451
            L  SLLWHP SL+ FVAL+AAW  LYF RD+PL++ GRLI+D  VL  LSVAT+V LLF+
Sbjct  117  LSASLLWHPASLVAFVALVAAWFLLYFSRDQPLVLFGRLIDDGTVLGALSVATVVALLFS  176

Query  452  NATANILISllvgavvvlvhgaFRKTDDLFADE  550
            +  + +  +++VGA +V +H  FR TDDLF DE
Sbjct  177  DVGSTVFGAIMVGAALVCLHAVFRATDDLFLDE  209



>ref|XP_008235318.1| PREDICTED: PRA1 family protein F2-like [Prunus mume]
Length=200

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 119/173 (69%), Gaps = 2/173 (1%)
 Frame = +2

Query  50   YGTIP-TSSSAGASLEYISRTKERIKEGLGMRRPWREMFN-FHSIGLPSNFHDAVSRIKT  223
            YGT+P T++++ A+     R +E  +     RRPW E+   F++   P  F DA  RIK 
Sbjct  9    YGTLPSTTATSTAAPSTFFRARETTQSFFAKRRPWLELVQPFYNFTRPYTFGDATIRIKR  68

Query  224  NLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRV  403
            NL+YFR+NY +VVL ILFLSLLWHP+SLIVF+ +  AW FLYF RD PL+I   +++DR+
Sbjct  69   NLSYFRVNYTMVVLFILFLSLLWHPVSLIVFLLVFVAWFFLYFFRDNPLVIFNHIVDDRI  128

Query  404  VLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            VL VL V TIV L+FT+   N+L+S+L+G  +V +H AFR T+DL+ DE+  A
Sbjct  129  VLGVLGVVTIVALIFTHVWLNVLVSVLIGVAIVALHAAFRGTEDLYNDEQEAA  181



>ref|XP_011038559.1| PREDICTED: PRA1 family protein E-like [Populus euphratica]
Length=215

 Score =   139 bits (351),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 120/178 (67%), Gaps = 5/178 (3%)
 Frame = +2

Query  86   SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvl  265
            +L +ISR     +  +  RRPW+E+  F S   P  + +++SRIK N+ YFR+NYA++ L
Sbjct  32   TLTFISRATTTTQTLIATRRPWQELIKFSSFIRPYTYDESISRIKYNVNYFRVNYAMIFL  91

Query  266  vilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLL  445
             ILFLSLLWHPIS+IVF+ +  AWLFLYF RD P+++  R  +DRVVL VL + TIV L 
Sbjct  92   AILFLSLLWHPISIIVFIGVFVAWLFLYFERDGPVVLFNRSFDDRVVLCVLGLVTIVALA  151

Query  446  FTNATANILISllvgavvvlvhgaFRKTDDLFADEES---GAFL--AGHAPSAPSS*C  604
            +T+   N+LI+L++G VVV VH AFR T+DLF DEES   G  L  AG  P  P + C
Sbjct  152  YTDVGLNVLIALIIGVVVVGVHAAFRGTEDLFLDEESAVEGGLLSVAGSRPLQPKTGC  209



>ref|XP_006854893.1| hypothetical protein AMTR_s00052p00041770 [Amborella trichopoda]
 gb|ERN16360.1| hypothetical protein AMTR_s00052p00041770 [Amborella trichopoda]
Length=184

 Score =   138 bits (347),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 128/180 (71%), Gaps = 0/180 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            M  YGTIP SSS   +L+  S+ KE+       RRPWRE+ +  S   P +F +AV+R++
Sbjct  1    MANYGTIPVSSSPSPALDLFSKAKEKGISIYAKRRPWRELTHLDSFSFPPSFREAVARVR  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N  YFR+NYAL+VLV++FLSLLWHP+SLIVF+ +MA WLFLYFLRD+PLI  GR + DR
Sbjct  61   ANTDYFRVNYALIVLVVVFLSLLWHPVSLIVFLVMMAIWLFLYFLRDDPLIFFGRTLGDR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
            +VL++LSV T+V LL T+AT NIL+SL +G V+VLVH A R  ++ + D++    L   +
Sbjct  121  LVLLLLSVVTLVALLLTHATKNILVSLTIGIVLVLVHSAIRSIENHYEDDKESGLLPAES  180



>ref|XP_004288927.1| PREDICTED: PRA1 family protein F3-like [Fragaria vesca subsp. 
vesca]
Length=197

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIPT     A++  +S+ KE+I+  LG++RPW EM    ++  PS+ + ++ RI+
Sbjct  1    MTTYGTIPTEPLPSANVAIVSQAKEQIELCLGIQRPWLEMIQLQNLRPPSSLNQSIERIR  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+A+FRMNY +++L ILF+SLLWHPISL++ + LMAAWL LY+L D+PL+++   I+ R
Sbjct  61   TNVAFFRMNYTIIILAILFISLLWHPISLLLMIVLMAAWLSLYYLHDKPLMVLDHDIDHR  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF-ADEESGA  562
             ++  L + T ++L  TN   NI+ +L  G   VLVHGA R+ +D+F  D+E G+
Sbjct  121  FLMTALFLVTALVLFLTNVKYNIIRALSFGLAFVLVHGALREPEDVFVVDDEEGS  175



>gb|ACN40786.1| unknown [Picea sitchensis]
Length=198

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 119/176 (68%), Gaps = 3/176 (2%)
 Frame = +2

Query  35   ENMTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
             + T YGT+PT   A   + Y  R +E  +     RRPWR++ +  + G P +F DA + 
Sbjct  7    SDSTRYGTVPT---APRQMGYFERVRENGEALYAQRRPWRDLISRTAFGRPDSFADAFAH  63

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            I+ NL YFR+NYAL++L I+FLSLLWHPISLIV + +  AW FLYF RDEP+++ GR +N
Sbjct  64   IRKNLGYFRVNYALIILGIVFLSLLWHPISLIVLIIMFVAWGFLYFFRDEPVVVFGRTLN  123

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            + +V++VLS+ T V ++ T+AT   LI LL+  V+V+VH AFR  +DLF +E+  A
Sbjct  124  EGIVIVVLSIVTFVAVMLTHATMTFLIGLLIAVVIVVVHAAFRLPEDLFLNEDEAA  179



>ref|XP_007152983.1| hypothetical protein PHAVU_004G176600g [Phaseolus vulgaris]
 gb|ESW24977.1| hypothetical protein PHAVU_004G176600g [Phaseolus vulgaris]
Length=201

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 123/179 (69%), Gaps = 6/179 (3%)
 Frame = +2

Query  41   MTTYGTI----PTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAV  208
            M TYGTI    P +SS   S+ + S+ KERI+ GLG  RPW+EM     + LPS+F+ ++
Sbjct  1    MNTYGTISQEAPEASSNPHSV-FASKAKERIQTGLGTTRPWKEMLQPSHLKLPSSFYGSI  59

Query  209  SRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRL  388
             RI TN  +FR NY +++L +LFLSLL HP+SLI+ V +M AWL+LYFLRD PL+++   
Sbjct  60   QRINTNARHFRANYVIIILFVLFLSLLEHPVSLIILVVMMIAWLYLYFLRDTPLMVLRFE  119

Query  389  INDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFA-DEESGA  562
            I++R+V+I L + TI LL+ T+ T N+++ + V  V+ LVH   R+T+DLF  DEE G 
Sbjct  120  IDERLVVIFLLLITIGLLVLTSVTYNVIVGMCVALVLDLVHAVMRETEDLFTMDEEVGV  178



>ref|XP_006416675.1| hypothetical protein EUTSA_v10009485mg [Eutrema salsugineum]
 gb|ESQ35028.1| hypothetical protein EUTSA_v10009485mg [Eutrema salsugineum]
Length=181

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 121/179 (68%), Gaps = 3/179 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA-SLEYISRT--KERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MTTYGT PTS++  A  LEYI+R   +  ++ GL  RRPW++M + HS   P      ++
Sbjct  1    MTTYGTNPTSANDLAPKLEYITRANGQHNVRPGLATRRPWKQMLDLHSFNFPRKIATVIT  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            R++ N  YF+ NY +VVL  +FLSL+W+P SL++ + L+ AWLFLYFLRDEPL +  R I
Sbjct  61   RVRANTVYFQTNYTIVVLFSVFLSLIWNPFSLLILLTLIGAWLFLYFLRDEPLTVFDRDI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            + R+VLI +SV T+ +L  T+A  NI ++++ GA  VL H A RKT+D++ +++  + L
Sbjct  121  DHRLVLIFMSVLTLSILFLTDAKLNIAVAVVAGAAAVLSHAAVRKTEDMYQNDDETSRL  179



>ref|XP_010106674.1| hypothetical protein L484_004546 [Morus notabilis]
 gb|EXC11123.1| hypothetical protein L484_004546 [Morus notabilis]
Length=147

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  158  MFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAW  337
            MFN HS+GLP +  +A+ R+KTN AYFR+NYA+VVLVILFLSLLWHPISLIVFV ++A W
Sbjct  1    MFNVHSLGLPPSVAEAIRRVKTNAAYFRVNYAIVVLVILFLSLLWHPISLIVFVVMIAVW  60

Query  338  LFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhga  517
            LFLYFLRDEPL+++ R I+DR+VL VLSV T+VLLL T+AT NIL +LL GAVVV+VH A
Sbjct  61   LFLYFLRDEPLVVINRTIDDRIVLTVLSVLTVVLLLLTHATVNILSALLTGAVVVVVHAA  120

Query  518  FRKTDDLFADEESGAFLAGHAPSAPSS  598
             RK+DDLF DEE+   L G  P + SS
Sbjct  121  IRKSDDLFLDEENAGLLTGVGPGSSSS  147



>ref|XP_003530196.1| PREDICTED: PRA1 family protein F2-like isoform X1 [Glycine max]
 ref|XP_006583575.1| PREDICTED: PRA1 family protein F2-like isoform X2 [Glycine max]
Length=198

 Score =   136 bits (342),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 125/178 (70%), Gaps = 0/178 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTI   +S+ ++  ++S+ KERI++GLG  RPW EM     + LPS+F  A+ RI 
Sbjct  1    MTTYGTISEEASSNSNSVFVSQAKERIEDGLGTTRPWSEMLQTCHLKLPSSFFGAIQRIN  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN  +FR NY +++L++LFLSLL HPISLI+ V +M AWL+LYFLRD PL+I+   +++R
Sbjct  61   TNAKHFRANYVIIILLVLFLSLLGHPISLIILVVMMIAWLYLYFLRDTPLVILRFEMDER  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            +V+I L + TI LL+ TN T N+++ + V  VVVLVH   R+T+DLF  +E    + G
Sbjct  121  LVVISLLLITIGLLVLTNVTYNVIVGMCVALVVVLVHAIMRETEDLFTMDEDVGVVKG  178



>ref|XP_003620939.1| PRA1 family protein F2 [Medicago truncatula]
 gb|AES77157.1| PRA1 (prenylated RAB acceptor) family protein [Medicago truncatula]
Length=201

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 116/176 (66%), Gaps = 3/176 (2%)
 Frame = +2

Query  41   MTTYGTIP--TSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MTTYGTI    ++ +  +L Y++  KER ++ +G+ RPW+EM  F    LPS+F+D + R
Sbjct  1    MTTYGTISDAEATPSNPNLHYVTEAKERFQDNIGVTRPWKEMIQFSHFKLPSSFYDTIQR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            I TN  +FR NY + +L+ +FLSLL HPISLI+ + +M AW++LYFLR  PL+I G  I+
Sbjct  61   INTNAKHFRANYVITMLLTIFLSLLEHPISLIILIVMMIAWVYLYFLRVTPLVIFGYEID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFA-DEESG  559
            +R V+I L   T  LL+ T+ T N+ + +     VVL+H   R+T+DLF  DE+ G
Sbjct  121  ERYVVISLLSITAGLLVLTDVTHNVEVGMCFALGVVLIHAVLRETEDLFTLDEDVG  176



>ref|XP_008372317.1| PREDICTED: PRA1 family protein E-like [Malus domestica]
 ref|XP_008372318.1| PREDICTED: PRA1 family protein E-like [Malus domestica]
 ref|XP_008372319.1| PREDICTED: PRA1 family protein E-like [Malus domestica]
 ref|XP_008372320.1| PREDICTED: PRA1 family protein E-like [Malus domestica]
Length=200

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 116/171 (68%), Gaps = 1/171 (1%)
 Frame = +2

Query  53   GTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFN-FHSIGLPSNFHDAVSRIKTNL  229
            GT+ ++S   A+ E  SR +   +     RRPW E+   F S   P  F +A  RIK NL
Sbjct  10   GTLXSASFTTATPEPYSRARATTQSFFATRRPWLELVQPFSSFTRPYTFGEATVRIKRNL  69

Query  230  AYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVL  409
             +FR+NY ++VL +LFLSLLWHP SLIVF+ +  AW FLYF RDEPL+I  R+++DRVVL
Sbjct  70   GHFRVNYTMLVLFVLFLSLLWHPFSLIVFLLVFVAWFFLYFFRDEPLVIFHRIVDDRVVL  129

Query  410  IVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
             +L+V TIV L+ T+   N+L+S+L+G  +V +H AFR TDDL+ADE+  A
Sbjct  130  GILAVITIVALVLTHVWLNVLVSVLIGLAIVGLHAAFRGTDDLYADEQEAA  180



>ref|XP_009385825.1| PREDICTED: PRA1 family protein F3-like [Musa acuminata subsp. 
malaccensis]
Length=177

 Score =   135 bits (340),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 128/187 (68%), Gaps = 13/187 (7%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            M+TY T+P S+S   S  ++S T            PWRE+ +  ++G P+   +A  R +
Sbjct  1    MSTYETLPISTS---SPGFVSLTTWC---------PWRELADVRALGRPAGLGEAYIRTR  48

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN A+F MNYA++VL+ +FLSLLWHP+SLIVFVA MAAWLF YFLR EPL+++G +I DR
Sbjct  49   TNAAHFSMNYAIIVLLFVFLSLLWHPLSLIVFVASMAAWLFFYFLRGEPLVVLGWVIRDR  108

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLA-GH  577
            VVL+ L+V T+V LL TNATANIL SL VG ++V+VH A R+TD  F + E   + A G 
Sbjct  109  VVLMGLAVVTLVPLLKTNATANILTSLSVGLLLVVVHAALRRTDYAFVEAEGPCYAAFGS  168

Query  578  APSAPSS  598
            AP++  S
Sbjct  169  APASVQS  175



>gb|KDO68524.1| hypothetical protein CISIN_1g028921mg [Citrus sinensis]
Length=202

 Score =   136 bits (342),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 120/175 (69%), Gaps = 4/175 (2%)
 Frame = +2

Query  50   YGTIPTSSSAGA----SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            YG++P +S++      +  +++R ++  +     RRPWRE+ + H+I  PS+  +A   +
Sbjct  9    YGSLPPTSTSPTYVPPTTAFLTRARDTTQSVFSTRRPWRELLDIHAITRPSSVGEATIHL  68

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            K NL YFR+NYA++VL ILFLSLLWHP+S+IVF+ +  AW FLYF RD PL++  R ++D
Sbjct  69   KRNLCYFRVNYAMIVLAILFLSLLWHPVSMIVFIVVFIAWFFLYFFRDGPLVVFHRTVDD  128

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            RV+L +L V TIV L+ T+   N+L+SLL+G  +V +H AFR T+DL+ DE   A
Sbjct  129  RVLLGILGVVTIVSLVLTHVWLNVLVSLLIGFFIVGLHAAFRGTEDLYCDEGEVA  183



>ref|XP_004156493.1| PREDICTED: PRA1 family protein E-like [Cucumis sativus]
Length=213

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 123/184 (67%), Gaps = 13/184 (7%)
 Frame = +2

Query  50   YGTIPTSSSAG-------------ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPS  190
            YG +P+ ++A              +S  +I R K   +  +  +RPWRE+F+F +  LP 
Sbjct  10   YGAVPSQAAATIPTTSSGAPPSFPSSSSFIERAKTTTQSLIATQRPWRELFDFSAFSLPF  69

Query  191  NFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPL  370
            ++ DA++RI+ N+ YFR+NYALV+L+I+FLSL WHPIS+IVF+ +  AWLF YF RD+PL
Sbjct  70   SYDDAMARIRQNVNYFRVNYALVMLIIVFLSLFWHPISIIVFLLIFVAWLFFYFFRDQPL  129

Query  371  IIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADE  550
            ++  +  +D+VVL VLS+ TI+ L+ T+  +N+L +L+ G  VV +H AFR T D F DE
Sbjct  130  VLFNQTFDDKVVLGVLSIFTIIALVSTDVGSNVLGALITGVAVVGLHSAFRITADHFLDE  189

Query  551  ESGA  562
            E+ A
Sbjct  190  ETAA  193



>ref|XP_006451445.1| hypothetical protein CICLE_v10010325mg [Citrus clementina]
 gb|ESR64685.1| hypothetical protein CICLE_v10010325mg [Citrus clementina]
Length=199

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 118/173 (68%), Gaps = 2/173 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIPT +   +S    +R K  I+ G G  RPW E     SI LP++F + + RI+
Sbjct  1    MTTYGTIPTETPELSSQPLSTRVKRLIESGFGTPRPWDEFIQIQSIKLPTSFGNFIERIQ  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRD-EPLIIVGRLIND  397
            +N A++RMNYA+++L I+ +SL W+P+SLI+ + L+AAWLFLYFLRD + L++ G +I+D
Sbjct  61   SNAAFYRMNYAVIILSIIVVSLFWNPVSLIILIILIAAWLFLYFLRDGDRLVVYGFVIDD  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF-ADEE  553
            R+++  L   TI  L  T+ T NI+I L +G VV+  H  FR TDD+F AD+E
Sbjct  121  RILMTALLPGTIAFLFLTDVTKNIIIGLCIGTVVIAAHAGFRSTDDMFSADDE  173



>ref|XP_010553757.1| PREDICTED: PRA1 family protein E-like [Tarenaya hassleriana]
Length=210

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = +2

Query  98   ISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilf  277
            I+R K+  +  +   RPWRE+ +  S  LP ++ +A+SR++ NL YFR+NYAL+VL ++F
Sbjct  33   IARAKQTTQSVIATLRPWRELLDISSFSLPHSYDEAMSRVRHNLGYFRVNYALIVLAVVF  92

Query  278  lsllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVATIVLLLFT  451
            L LL+HPIS+I F+ +   W+ LYF RD  +P++I GR+++DR+VL +LS+ TI+ L++T
Sbjct  93   LGLLYHPISMIAFIVVFVGWILLYFSRDANDPIVISGRVVDDRIVLGILSLVTILALVYT  152

Query  452  NATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
            +   N+L+SL+VG V+V  H AFR TDDLF DEES 
Sbjct  153  DVGENVLVSLIVGVVIVGAHAAFRCTDDLFLDEESA  188



>gb|KDO57741.1| hypothetical protein CISIN_1g043789mg [Citrus sinensis]
Length=199

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 118/173 (68%), Gaps = 2/173 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIPT +   +S    +R K  I+ G G  RPW E     SI LP++F + + RI+
Sbjct  1    MTTYGTIPTETPELSSQPLSTRVKRLIESGFGTPRPWDEFIQIQSIKLPTSFANFIERIQ  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRD-EPLIIVGRLIND  397
            +N A++RMNYA+++L I+ +SL W+P+SLI+ + L+AAWLFLYFLRD + L++ G +I+D
Sbjct  61   SNAAFYRMNYAVIILSIIVVSLFWNPVSLIILIILIAAWLFLYFLRDGDRLVVYGFVIDD  120

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF-ADEE  553
            R+++  L   TI  L  T+ T NI+I L +G VV+  H  FR TDD+F AD+E
Sbjct  121  RILMTALLPGTIAFLFLTDVTKNIIIGLCIGTVVIAAHAGFRSTDDMFSADDE  173



>ref|XP_008802843.1| PREDICTED: PRA1 family protein F3-like [Phoenix dactylifera]
Length=211

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 116/183 (63%), Gaps = 12/183 (7%)
 Frame = +2

Query  50   YGTIPTSSSAGASL------------EYISRTKERIKEGLGMRRPWREMFNFHSIGLPSN  193
            YGTIPT+     S             + I+  KE+ +  +  RRPW+E+ N  +   PS 
Sbjct  9    YGTIPTAVPPPPSEAPPAPSAASRATDLITGFKEQGQALIAARRPWQELLNSGAFARPST  68

Query  194  FHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLI  373
              +A +R+  NLAYFR NY +VVLV +FLSL+WHP SLI FVAL AAWLFLYF R+ PL+
Sbjct  69   TGEASARLHRNLAYFRANYTIVVLVAVFLSLIWHPSSLIAFVALSAAWLFLYFSRNGPLV  128

Query  374  IVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE  553
            + GR I+D  VLI LSV T+V L+ T+  +N+L S++VG  ++ +H   R TDDLF DE 
Sbjct  129  LFGRAIDDGAVLIALSVVTVVALIVTDVASNVLASIMVGVAIIGIHAVLRTTDDLFLDEH  188

Query  554  SGA  562
            + A
Sbjct  189  AAA  191



>ref|XP_008456115.1| PREDICTED: PRA1 family protein E [Cucumis melo]
 ref|XP_008456124.1| PREDICTED: PRA1 family protein E [Cucumis melo]
Length=213

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 118/175 (67%), Gaps = 5/175 (3%)
 Frame = +2

Query  53   GTIPTSSSAGASLEY-----ISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
             TIPT+SS            + R K   +  +   RPWRE+F+F +  LP ++ DA++RI
Sbjct  19   ATIPTTSSGAPPPFPSSSSFLERAKTTTQSLIATLRPWRELFDFSAFSLPFSYDDAMARI  78

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            + N+ YFR+NYALV+L+I+FLSL WHPIS+IVF+ +  AWLF YF RD+PL++  +  +D
Sbjct  79   RQNVNYFRVNYALVMLIIVFLSLFWHPISIIVFLLIFVAWLFFYFFRDQPLVLFNQTFDD  138

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            +VVL VLS+ TI+ L+ T+  +N+L +L+ G  VV +H AFR T D F DEE+ A
Sbjct  139  KVVLGVLSIFTIIALVSTDVGSNVLGALITGVAVVGLHAAFRITADHFLDEETAA  193



>ref|XP_003517620.1| PREDICTED: PRA1 family protein F2-like [Glycine max]
Length=200

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 119/180 (66%), Gaps = 2/180 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYIS--RTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MTTYGTI   +   ++   +   + KE I+ GLG RRPWREM        PS+F  A+ R
Sbjct  1    MTTYGTISEEAEPSSNSNSVFVSQAKEHIQGGLGTRRPWREMLQTSHFKFPSSFFGAIQR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            I TN  +FR NY +++L++LFLSLL HPISLI+ + +M AWL+LYFLRD PL+I+   I+
Sbjct  61   INTNAKHFRANYVIIILLVLFLSLLGHPISLIILIVMMIAWLYLYFLRDTPLVILRFEID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            +R+V+I L + TI LL+ TN T N+++ + V  V+VLVH   R+T+DLF  +E    + G
Sbjct  121  ERLVVISLLLITIGLLVLTNVTYNVIVGICVALVIVLVHAMIRETEDLFTMDEDVGVMKG  180



>ref|XP_010043255.1| PREDICTED: PRA1 family protein E-like [Eucalyptus grandis]
 gb|KCW85273.1| hypothetical protein EUGRSUZ_B02120 [Eucalyptus grandis]
Length=217

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 112/170 (66%), Gaps = 3/170 (2%)
 Frame = +2

Query  62   PTSSSAGASLEY---ISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLA  232
            PTS +  A+L Y   +   +      L  RRPWRE  +  ++ LP  + DA +RI+ N  
Sbjct  27   PTSQTPFATLSYTPSVGGARAAASSFLATRRPWREFLDVTALSLPHGYADATARIRRNCD  86

Query  233  YFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLI  412
            +FR+NYA+V L ILFLSLLWHP+S+IVF+A+   W FLYF RD PL++ GR I+DR+V+ 
Sbjct  87   HFRVNYAMVALGILFLSLLWHPVSMIVFIAVFVGWYFLYFARDSPLVVFGRTIDDRIVMA  146

Query  413  VLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
             L + T+V L+ T+   N+L++LL+   ++ +H AFR  D+L+ DEE+ A
Sbjct  147  ALGLVTVVALVLTDVGLNVLVALLIAVFLLGLHSAFRNPDNLYVDEETAA  196



>ref|XP_004139244.1| PREDICTED: PRA1 family protein E-like [Cucumis sativus]
 gb|KGN60794.1| hypothetical protein Csa_2G010300 [Cucumis sativus]
Length=213

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 123/184 (67%), Gaps = 13/184 (7%)
 Frame = +2

Query  50   YGTIPTSSSAG-------------ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPS  190
            YG +P+ ++A              +S  ++ R K   +  +  +RPWRE+F+F +  LP 
Sbjct  10   YGAVPSQAAATIPTTSSGAPPSFPSSSSFLERAKTTTQSLIATQRPWRELFDFSAFSLPF  69

Query  191  NFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPL  370
            ++ DA++RI+ N+ YFR+NYALV+L+I+FLSL WHPIS+IVF+ +  AWLF YF RD+PL
Sbjct  70   SYDDAMARIRQNVNYFRVNYALVMLIIVFLSLFWHPISIIVFLLIFVAWLFFYFFRDQPL  129

Query  371  IIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADE  550
            ++  +  +D+VVL VLS+ TI+ L+ T+  +N+L +L+ G  VV +H AFR T D F DE
Sbjct  130  VLFNQTFDDKVVLGVLSIFTIIALVSTDVGSNVLGALITGVTVVGLHSAFRITADHFLDE  189

Query  551  ESGA  562
            E+ A
Sbjct  190  ETAA  193



>ref|XP_004513103.1| PREDICTED: PRA1 family protein F2-like [Cicer arietinum]
Length=201

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 119/176 (68%), Gaps = 3/176 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSS--AGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MTTYGTI       +  +L Y+S+ K+RI+ GLG+ RPW+E+        PS+F+  + R
Sbjct  1    MTTYGTISEDDDIPSNPNLLYVSQAKDRIQAGLGVTRPWKELIQSSHFKFPSSFYGTIQR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            I TN  +FR NY +++L +LFLSLL HPISLI+ + +M AWL+LYFLR  PL+I+   I+
Sbjct  61   INTNAKHFRANYVIIILFVLFLSLLGHPISLIILIVMMIAWLYLYFLRPTPLVILRFQID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFA-DEESG  559
            +R+V+I L + TI LL+ T+ T N+++ + V   VVL+H   R+T+DLF  DE+ G
Sbjct  121  ERLVVISLLLITIGLLVLTDVTHNVVVGMCVALGVVLIHAVLRETEDLFTLDEDVG  176



>ref|XP_002307629.1| hypothetical protein POPTR_0005s24060g [Populus trichocarpa]
 gb|EEE94625.1| hypothetical protein POPTR_0005s24060g [Populus trichocarpa]
Length=201

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 115/163 (71%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYA  253
            SA A   +++R+          RRPWRE+  F S   P +F +A  R+K NL YFR+NY 
Sbjct  20   SAAAPSTFLTRSANTTTNFFATRRPWRELIEFSSFTRPLSFGEATIRVKRNLYYFRVNYT  79

Query  254  lvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATI  433
            +++LVILFLSLLWHP+S+IVF+ +  AW FLYF RD+PL+I  R I+DRVVL +LS+ TI
Sbjct  80   MIILVILFLSLLWHPLSMIVFLVVFVAWFFLYFFRDQPLVIFHRPIDDRVVLGLLSIVTI  139

Query  434  VLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            + L+FT+   N+L+S+L+GA VV++H AFR T++L+ DE   A
Sbjct  140  IALIFTHVWLNVLVSVLIGAAVVVLHAAFRGTENLYLDEHDLA  182



>gb|KHN40329.1| PRA1 family protein F2 [Glycine soja]
Length=275

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 125/178 (70%), Gaps = 0/178 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTI   +S+ ++  ++S+ KERI++GLG  RPW EM     + LPS+F  A+ RI 
Sbjct  1    MTTYGTISEEASSNSNSVFVSQAKERIEDGLGTTRPWSEMLQTCHLKLPSSFFGAIQRIN  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN  +FR NY +++L++LFLSLL HPISLI+ V +M AWL+LYFLRD PL+I+   +++R
Sbjct  61   TNAKHFRANYVIIILLVLFLSLLGHPISLIILVVMMIAWLYLYFLRDTPLVILRFEMDER  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAG  574
            +V+I L + TI LL+ TN T N+++ + V  VVVLVH   R+T+DLF  +E    + G
Sbjct  121  LVVISLLLITIGLLVLTNVTYNVIVGMCVALVVVLVHAIMRETEDLFTMDEDVGVVKG  178



>ref|XP_002531279.1| Prenylated Rab acceptor protein, putative [Ricinus communis]
 gb|EEF31092.1| Prenylated Rab acceptor protein, putative [Ricinus communis]
Length=216

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 124/184 (67%), Gaps = 13/184 (7%)
 Frame = +2

Query  50   YGTIPTS-------------SSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPS  190
            YGTIP +              +   SL +ISR     +  +  RRPW+E+ N  S   P 
Sbjct  10   YGTIPATTTTTTTTHFSQPLPTTATSLTFISRATSATQSVIATRRPWKELLNPSSFSCPC  69

Query  191  NFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPL  370
            N+ +A+SR+K N+ YFR+NYA+VVL +LFLSLLWHP+S+IVF+ +  AW FLYF RD P+
Sbjct  70   NYSEAMSRVKYNVNYFRVNYAMVVLSVLFLSLLWHPVSMIVFIVVFIAWFFLYFSRDGPI  129

Query  371  IIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADE  550
            ++  R  +DRVVL+VL + TIV L+ T+   N+L++L++GAVVV +HGAFR T+DLF DE
Sbjct  130  VLFNREFDDRVVLVVLGLVTIVALVLTHVGLNVLVALMIGAVVVGIHGAFRNTEDLFLDE  189

Query  551  ESGA  562
            ES A
Sbjct  190  ESAA  193



>ref|XP_003564938.1| PREDICTED: PRA1 family protein F3-like [Brachypodium distachyon]
Length=194

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 135/195 (69%), Gaps = 12/195 (6%)
 Frame = +2

Query  41   MTTYGTIPTSSS---------AGAS-LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPS  190
            M+ YGTIPTSSS          GAS L++ISR K R    L  RRPWRE+ + H++GLP 
Sbjct  1    MSKYGTIPTSSSAAAAGAPQFGGASPLDFISRAKARGATALATRRPWRELADLHAVGLPP  60

Query  191  NFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPL  370
            +  DA  R++ NLA+F MNYA+V+LV++FLSLLW P+SLIVF+  M AWL LYFLRDEP+
Sbjct  61   SLGDAYLRVRANLAHFAMNYAIVILVVVFLSLLWKPVSLIVFLVCMIAWLVLYFLRDEPI  120

Query  371  IIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADE  550
            ++ GR++ D VVL  L+V T+ LLL T ATANIL SLL+G V+V++H A  K +D   DE
Sbjct  121  VLFGRVVGDGVVLAGLAVVTLGLLLLTGATANILSSLLIGFVLVVLHAALHKAED-NVDE  179

Query  551  ESGAFLAGHAPSAPS  595
            E G + A   P  PS
Sbjct  180  EVGRWYA-PVPPPPS  193



>ref|XP_011026036.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
Length=193

 Score =   131 bits (329),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = +2

Query  134  GMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIV  313
              RRPWRE+  F S   P +  D   RIK NL+YFR+NY +++L ILFLSLLWHP+S+IV
Sbjct  7    ATRRPWREIIEFSSFARPLSLGDTTIRIKRNLSYFRVNYTMIILSILFLSLLWHPLSMIV  66

Query  314  FVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvga  493
            F+ +  AW +LYF RD+PL+I  R I+DRVVL +L VAT+V L+FT+   N+L+SLL+GA
Sbjct  67   FLIVFVAWFYLYFFRDQPLVIFHRTIDDRVVLGLLGVATLVALIFTHVWLNVLVSLLIGA  126

Query  494  vvvlvhgaFRKTDDLFADEESGAFLAGHAPSA  589
             VVL+H AFR++DDL+ DE+     +   P+A
Sbjct  127  AVVLLHAAFRRSDDLYLDEQDLPSPSAQRPTA  158



>gb|KDP21357.1| hypothetical protein JCGZ_21828 [Jatropha curcas]
Length=196

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 116/179 (65%), Gaps = 7/179 (4%)
 Frame = +2

Query  17   AVRNSPENMTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNF  196
            A   SP    +  TIPT+ ++ A       T          RRPWRE+  F S   P +F
Sbjct  3    APSRSPFGSPSSSTIPTTFNSRA-------TVTTATTSFATRRPWRELIEFSSFTRPYSF  55

Query  197  HDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLII  376
             +A +R K NL YFR+NY +++L ILF+SLLWHP+S+IVF+ +  AW FLYF RD+P++I
Sbjct  56   GEATARTKRNLFYFRVNYTMIILFILFISLLWHPLSMIVFLIVFVAWFFLYFFRDQPIVI  115

Query  377  VGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE  553
              R I+DRVVL VL+V TIV L FT+   N+LIS+LVG  +V++H A R T+DL+ DE+
Sbjct  116  FHRTIDDRVVLGVLAVITIVALAFTHVWLNVLISILVGLAIVVLHAAIRGTEDLYLDEQ  174



>ref|XP_006443903.1| hypothetical protein CICLE_v10022315mg [Citrus clementina]
 ref|XP_006479582.1| PREDICTED: PRA1 family protein E-like [Citrus sinensis]
 gb|ESR57143.1| hypothetical protein CICLE_v10022315mg [Citrus clementina]
Length=202

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 120/175 (69%), Gaps = 4/175 (2%)
 Frame = +2

Query  50   YGTIPTSSSAGA----SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            YG++P +S++      +  +++R ++  +     RRPWR++ + H+I  PS+  +A   +
Sbjct  9    YGSLPPTSTSPTYVPPTTAFLTRARDTTQSVFSTRRPWRQLLDIHAITRPSSVGEATIHL  68

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            K NL+ FR+NYA++VL ILFLSLLWHP+S+IVF+ +  AW FLYF RD PL++  R ++D
Sbjct  69   KRNLSSFRVNYAMIVLAILFLSLLWHPVSMIVFIVVFIAWFFLYFFRDGPLVVFHRTVDD  128

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            RV+L +L V TIV L+ T+   N+L+SLL+G  +V +H AFR T+DL+ DE   A
Sbjct  129  RVLLGILGVVTIVSLVLTHVWLNVLVSLLIGFFIVGLHAAFRGTEDLYYDEGEVA  183



>emb|CDP06825.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = +2

Query  116  RIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWH  295
            R +  +   RPW+E+ +  S  LP ++ + +SR++ NL YFRMNYALV+L ILF SL++H
Sbjct  77   RARAQIATFRPWKELLDLSSFSLPYSYAEIMSRVRRNLNYFRMNYALVMLFILFCSLIYH  136

Query  296  PISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILI  475
            P S+I+F+A+  AWLFLYF RD+P+++ GR+++DR+V+I+LS+ T+  L+FT+   N+L+
Sbjct  137  PFSMIIFLAIFVAWLFLYFFRDDPVMVFGRVVDDRIVMIILSLVTVFALVFTHVGLNVLV  196

Query  476  SllvgavvvlvhgaFRKTDDLFADEESGA  562
            +L+VG V+V +H  FR  +DLF DE   A
Sbjct  197  ALIVGVVIVGLHATFRGVEDLFLDENEAA  225



>ref|XP_002284210.1| PREDICTED: PRA1 family protein E-like [Vitis vinifera]
Length=191

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 128/175 (73%), Gaps = 7/175 (4%)
 Frame = +2

Query  50   YGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNL  229
            Y + P++S+AG    ++S  +E+ +  +   RPW E+ +  ++ LP +  +A +RIK +L
Sbjct  9    YMSPPSTSAAG----FLSTAREKTQSVMAGCRPWGELLDLSALSLPFSLGEATARIKRSL  64

Query  230  AYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVL  409
            AYFR+NY L+VL++LF+SLLWHPIS+IVF+ +  AWLFLYFLRD+P++I  R+++DRVVL
Sbjct  65   AYFRVNYTLIVLLVLFVSLLWHPISMIVFLVVFVAWLFLYFLRDDPVLIFNRIVDDRVVL  124

Query  410  IVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES--GAFL  568
            + ++  TIV L+ T+   N+ +SL++G+ +V +HGAFR +D+L  D+ES  GA L
Sbjct  125  VGVAAVTIVALVLTHVWLNVFVSLVIGSFLVCLHGAFRASDNL-DDQESPYGALL  178



>ref|XP_011028739.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
Length=193

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 109/152 (72%), Gaps = 0/152 (0%)
 Frame = +2

Query  134  GMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIV  313
              RRPWRE+  F S   P +  D   RIK NL+YFR+NY +++L ILFLSLLWHP+S+IV
Sbjct  7    ATRRPWREIIEFSSFAHPLSLGDTTIRIKRNLSYFRVNYTMIILSILFLSLLWHPLSMIV  66

Query  314  FVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvga  493
            F+ +  AW +LYF RD+PL+I  R I+DRVVL +L V T+V L+FT+   N+L+SLL+GA
Sbjct  67   FLIVFVAWFYLYFFRDQPLVIFHRTIDDRVVLGLLGVTTLVALIFTHVWLNVLVSLLIGA  126

Query  494  vvvlvhgaFRKTDDLFADEESGAFLAGHAPSA  589
             VVL+H AFR++DDL+ DE+     +   P+A
Sbjct  127  AVVLLHAAFRRSDDLYLDEQDLPSPSAQRPTA  158



>ref|XP_010917587.1| PREDICTED: PRA1 family protein F2-like [Elaeis guineensis]
Length=212

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 113/184 (61%), Gaps = 13/184 (7%)
 Frame = +2

Query  50   YGTIPTSSSAGASLEY-------------ISRTKERIKEGLGMRRPWREMFNFHSIGLPS  190
            YGTIPT+ S   S                I+  KE+ +  +  RRPW+E+ N  +   P 
Sbjct  9    YGTIPTAGSPPPSEAAPASSSPASRATYLINGFKEQGQALIAARRPWQELLNPGAFARPL  68

Query  191  NFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPL  370
               +A  R++ NLAYFR NY + VL+ +FLSL+WHP SLI F+AL AAWLFLYF  + PL
Sbjct  69   TTAEATDRLRRNLAYFRANYTIAVLLAVFLSLIWHPSSLIAFIALSAAWLFLYFSHNGPL  128

Query  371  IIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADE  550
            ++ GR I+D  VLI LSV T+V L+ T+  +N+L S +VG  ++ +H   R TDDLF DE
Sbjct  129  VLFGRAIDDGAVLIALSVVTVVALIVTDVASNVLASFMVGLAIIGIHAVLRTTDDLFLDE  188

Query  551  ESGA  562
            ++ A
Sbjct  189  QAAA  192



>gb|KDO54396.1| hypothetical protein CISIN_1g029094mg [Citrus sinensis]
Length=199

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = +2

Query  86   SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvl  265
            SL + SR +         RRPWRE FN  ++ LP++++DA+SR + N +YFR+NYA+V+L
Sbjct  23   SLSFFSRAESLT----ATRRPWREFFNTSALSLPADYNDAISRARRNASYFRVNYAVVML  78

Query  266  vilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLL  445
             ILFLSLLWHP+S+IVF+ +   WLF YF RD+P+++  + ++D+ VL  L++ T++ L+
Sbjct  79   FILFLSLLWHPVSMIVFIVVFVLWLFFYFARDDPVVVFNQTLDDKFVLGCLTLVTVLALI  138

Query  446  FTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
             T+   N+L+ L+VG V+V +H +FR TDDLF DEES A
Sbjct  139  LTDVGTNVLVGLIVGVVLVGLHASFRATDDLFLDEESAA  177



>ref|XP_006487784.1| PREDICTED: PRA1 family protein E-like [Citrus sinensis]
Length=200

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = +2

Query  86   SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvl  265
            SL + SR +         RRPWRE FN  ++ LP++++DA+SR + N +YFR+NYA+V+L
Sbjct  24   SLSFFSRAESLT----ATRRPWREFFNTSALSLPADYNDAISRARRNASYFRVNYAVVML  79

Query  266  vilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLL  445
             ILFLSLLWHP+S+IVF+ +   WLF YF RD+P+++  + ++D+ VL  L++ T++ L+
Sbjct  80   FILFLSLLWHPVSMIVFIVVFVLWLFFYFARDDPVVVFNQTLDDKFVLGCLTLVTVLALI  139

Query  446  FTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
             T+   N+L+ L+VG V+V +H +FR TDDLF DEES A
Sbjct  140  LTDVGTNVLVGLIVGVVLVGLHASFRATDDLFLDEESAA  178



>ref|XP_011457975.1| PREDICTED: PRA1 family protein F2-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011457976.1| PREDICTED: PRA1 family protein F2-like [Fragaria vesca subsp. 
vesca]
Length=200

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 119/182 (65%), Gaps = 4/182 (2%)
 Frame = +2

Query  29   SPENMTTYGTIPTSSSAGA---SLEYISRTKERIKEGLGMRRPWREMFN-FHSIGLPSNF  196
            S  + + YGT+P +++A +        SR +         RRPW E+   F S   P  F
Sbjct  2    SSNSKSPYGTLPPTAAADSFPTPSTTFSRARSVTSSYFATRRPWLELIQPFSSFTRPFTF  61

Query  197  HDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLII  376
             +A  RIK+NL +FR+NYA+ VL ILFLSLLWHP+SLIVF+ +  AW FLYF RD PL++
Sbjct  62   GEATLRIKSNLNHFRVNYAMAVLFILFLSLLWHPVSLIVFLLVFVAWFFLYFFRDGPLVL  121

Query  377  VGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
               +++DR+VL VL+V TIV L+FT+   N+L+SLL+   +VL+H AFR T+DL++++  
Sbjct  122  FNWIVDDRIVLAVLAVVTIVALVFTHVWLNVLVSLLIAVALVLLHAAFRGTEDLYSEDLE  181

Query  557  GA  562
            G 
Sbjct  182  GG  183



>ref|XP_002890244.1| prenylated rab acceptor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66503.1| prenylated rab acceptor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=180

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 119/178 (67%), Gaps = 2/178 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA-SLEYISR-TKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MTTYGT P SS+  A  LEYI+R   ++ + GL  RRPW++M +  S   P      +SR
Sbjct  1    MTTYGTNPKSSNDLAPKLEYITRGINQQKRSGLATRRPWKQMLDLGSFNFPRKLATVISR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            I+ N  YF+ NY +VVL  + LSL+W+P SL++ +AL+ AWLFLYFLRDEPL +  R I+
Sbjct  61   IRANTVYFQTNYTIVVLFSVSLSLIWNPFSLLILIALLGAWLFLYFLRDEPLAVFDREID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
             R+VLIV+SV T+ +L  T+A  NI ++++ GA  VL H A RKT+DL+  +E  + L
Sbjct  121  HRIVLIVMSVLTLSILFLTDAKLNIAVAIVAGAAAVLSHAAVRKTEDLYQTDEETSLL  178



>ref|XP_009117647.1| PREDICTED: PRA1 family protein F1-like [Brassica rapa]
Length=181

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA-SLEYISRT--KERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MTTYGT PTS++  A  LEYI+R   ++ ++ GL  RR W++M + HS   P      ++
Sbjct  1    MTTYGTNPTSANDLAPKLEYITRANDQQNVRPGLATRRSWKQMLDLHSFNFPRKIATVIT  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            RIK N  YF+ NY +VVL  +FLSL+W+P+SL++ +A++ AWLFLYFLRDEPL +  R I
Sbjct  61   RIKANTVYFQTNYTIVVLFSVFLSLVWNPLSLLILLAIIGAWLFLYFLRDEPLTVFDREI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            + RVVL+ +SV T+ +L  T+A  NI ++++ G  VVL H A RKT+D++ +E+  + L
Sbjct  121  DHRVVLMAMSVLTLSILFLTDAKLNIAVAIVAGVAVVLSHAAVRKTEDMYQNEDETSRL  179



>gb|KJB27196.1| hypothetical protein B456_004G284100 [Gossypium raimondii]
Length=179

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 109/172 (63%), Gaps = 1/172 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIPT      SL  I + +E +   LG RR W +M N  ++ LP N ++AV RI+
Sbjct  1    MTTYGTIPTELPQ-QSLSLIVQAREFLGSSLGSRRKWEDMINIRALNLPPNVNEAVGRIR  59

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+ +F+ NY +VVL +L L+L +HP SL++ V +M AW   YFLRD PL I G +++  
Sbjct  60   TNIVFFKTNYVIVVLFLLLLTLFFHPTSLVIIVVIMIAWFLQYFLRDNPLSIYGFVVDRN  119

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
            +++ VL++ TI +   T+  +NI+  +  G  VVL HG FR TDDLF  +E 
Sbjct  120  MIITVLTLFTIAVFFLTDVMSNIMSGITFGLTVVLAHGFFRTTDDLFVGDEK  171



>gb|KJB80571.1| hypothetical protein B456_013G104700 [Gossypium raimondii]
Length=185

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +2

Query  140  RRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFV  319
            RRPWR   +  S   P +F DA +R+K NL YFR+NYA+++LVILFLSLLWHPIS+IVF+
Sbjct  22   RRPWRVFLSLSSFARPISFGDASARMKRNLNYFRVNYAMIILVILFLSLLWHPISMIVFL  81

Query  320  ALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavv  499
             +  AW FLYF RD+PL+I+ R I+DR+VL +L+V TIV L+ T+   N+L+S+L+GA +
Sbjct  82   VVFVAWFFLYFFRDDPLVILNRSIDDRIVLAILAVITIVALVLTDVWLNVLVSVLIGAFI  141

Query  500  vlvhgaFRKTDDLFADEESGA  562
            V VH AFR T+DL++D   G+
Sbjct  142  VGVHAAFRGTEDLYSDGLDGS  162



>ref|XP_006424007.1| hypothetical protein CICLE_v10029308mg [Citrus clementina]
 gb|ESR37247.1| hypothetical protein CICLE_v10029308mg [Citrus clementina]
Length=199

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = +2

Query  86   SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvl  265
            SL + SR +         RRPWRE FN  ++ LP++++DA+SR + N +YFR+NYA+V+L
Sbjct  23   SLSFFSRAESLT----ATRRPWREFFNTSALSLPADYNDAISRARRNASYFRVNYAMVML  78

Query  266  vilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLL  445
             ILFLSLLWHP+S++VF+ +   WLF YF RD+P+++  + ++D+ VL  L++ T++ L+
Sbjct  79   FILFLSLLWHPVSMMVFIVVFVLWLFFYFARDDPVVVFNQTLDDKFVLGCLTLVTVLALI  138

Query  446  FTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
             T+   N+L+ L+VG V+V +H +FR TDDLF DEES A
Sbjct  139  LTDVGTNVLVGLIVGVVLVGLHASFRATDDLFLDEESAA  177



>ref|XP_009364486.1| PREDICTED: PRA1 family protein E-like [Pyrus x bretschneideri]
Length=218

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 122/184 (66%), Gaps = 6/184 (3%)
 Frame = +2

Query  17   AVRNSPENMT--TYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPS  190
            AV+  P+     T+ + P   ++   L Y + T + +      RRPWRE+F+  S  +PS
Sbjct  16   AVQIDPQTSKDLTFTSRPKPQTSSQPL-YPTITSQSVYP---TRRPWRELFSLTSFSVPS  71

Query  191  NFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPL  370
            N+ DA++RIK N AYFR+NY +  L I+FLSLLWHPIS+IVF+ ++ AWL LYF+R  P+
Sbjct  72   NYADAMARIKRNTAYFRVNYTMAALFIVFLSLLWHPISMIVFLIILVAWLALYFIRTTPV  131

Query  371  IIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADE  550
            ++  +  +DRVV I L   T+V L+FT+   N+L++L+V  V++ +H AFR T+DLF DE
Sbjct  132  VLYNQSFDDRVVAIALGFVTVVALVFTHVGLNVLVALIVAVVIIGLHAAFRVTEDLFLDE  191

Query  551  ESGA  562
            E+ A
Sbjct  192  ETAA  195



>ref|XP_007050406.1| PRA1 family protein [Theobroma cacao]
 gb|EOX94563.1| PRA1 family protein [Theobroma cacao]
Length=181

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  113  ERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllW  292
             R  +    RRPWRE  +  S   P +F  A +R+K NL YFR+NYA++VLVILFLSLLW
Sbjct  13   TRATQSTFTRRPWRECLSLSSFARPISFGGATARMKRNLTYFRVNYAMIVLVILFLSLLW  72

Query  293  HPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANIL  472
            HPIS+IVF+ +  AW FLYF RD+PL+I+ R I+DR+VL+VL+V TIV L+ T+   N++
Sbjct  73   HPISMIVFLVVFVAWFFLYFFRDDPLVILNRTIDDRLVLVVLAVITIVALVLTDVWLNVV  132

Query  473  ISllvgavvvlvhgaFRKTDDLF  541
            +S+L+GA +V +H AFR T+DL+
Sbjct  133  VSVLIGAFIVGLHAAFRGTEDLY  155



>ref|XP_009354891.1| PREDICTED: PRA1 family protein F2-like [Pyrus x bretschneideri]
 ref|XP_009354892.1| PREDICTED: PRA1 family protein F2-like [Pyrus x bretschneideri]
 ref|XP_009354893.1| PREDICTED: PRA1 family protein F2-like [Pyrus x bretschneideri]
 ref|XP_009354894.1| PREDICTED: PRA1 family protein F2-like [Pyrus x bretschneideri]
Length=202

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 117/174 (67%), Gaps = 3/174 (2%)
 Frame = +2

Query  50   YGTIP--TSSSAGASLEYISRTKERIKEGLGMRRPWREMFN-FHSIGLPSNFHDAVSRIK  220
            YG +P  TSS   A  E  +R +   +     RRPW E+   F S   P  F +A  RIK
Sbjct  9    YGALPSTTSSFTTAMPEPFTRARATTQSFFATRRPWLELVQPFSSFTRPYTFGEATVRIK  68

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             NL +FR+NY ++VL +LFLSLLWHP+SLIVF+ +  AW FLYF RDEPL+I  R+++DR
Sbjct  69   RNLGHFRVNYTMLVLFVLFLSLLWHPVSLIVFLLVFVAWFFLYFFRDEPLVIFHRIVDDR  128

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            +VL  L+V T+V L+FT+   N+L+S+L+G  +V +H AFR TDDL+ADE+  A
Sbjct  129  IVLGTLAVVTVVALVFTHVWLNVLVSVLIGLAIVGLHAAFRGTDDLYADEQEAA  182



>gb|KFK43188.1| hypothetical protein AALP_AA1G091300 [Arabis alpina]
Length=206

 Score =   125 bits (315),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 120/171 (70%), Gaps = 7/171 (4%)
 Frame = +2

Query  101  SRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            +R K+  +  +   RPWRE+ +  ++ LP  + +A++ ++ N++YFR NYAL VLVI+FL
Sbjct  34   ARAKQTTQSMITTLRPWRELLDLSALSLPHKYDEAMAHLRHNISYFRANYALTVLVIVFL  93

Query  281  sllWHPISLIVFVALMAAWLFLYFLRDE--PLIIVGRLINDRVVLIVLSVATIVLLLFTN  454
             L++HPIS++ F+ +   W+ LYF RDE  P++I G+ ++DR+VL +LS+ TI+ L++T+
Sbjct  94   GLIYHPISMVAFIFVFIGWILLYFSRDENDPIVISGKEVDDRIVLGLLSLITILALVYTD  153

Query  455  ATANILISllvgavvvlvhgaFRKTDDLFADEES---GAFLAGHAPSAPSS  598
               N+L+SL+VG V+V  H AFR TDDLF DEES   G  ++G+   APSS
Sbjct  154  VGENVLVSLIVGLVIVGAHAAFRTTDDLFVDEESARRGGLVSGN--RAPSS  202



>emb|CDX81845.1| BnaC08g37560D [Brassica napus]
Length=181

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 122/179 (68%), Gaps = 3/179 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA-SLEYISRTKER--IKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MTTYGT PTS++  A  LEYI+R  +   ++ GL  RRPW++M +  S   P      ++
Sbjct  1    MTTYGTNPTSANDLAPKLEYITRADDHHNVRPGLATRRPWKQMLDLRSFNFPRKIATVIT  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            RIK N  YF+ NY +VVL  +FLSL+ +P+SL++ +A++ AWLFLYFLRDEPL +  R I
Sbjct  61   RIKANTVYFQTNYTIVVLFSVFLSLVSNPLSLLILLAIIGAWLFLYFLRDEPLTVFDREI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            + RVVLI +SV T+++L  T+A  NI ++++ G  VVL H A RKT+D++ +E+  + L
Sbjct  121  DHRVVLIAMSVLTLLILFLTDAKLNIAVAVVAGVAVVLSHAAVRKTEDMYQNEDETSRL  179



>ref|XP_010475691.1| PREDICTED: PRA1 family protein E [Camelina sativa]
Length=206

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 119/171 (70%), Gaps = 7/171 (4%)
 Frame = +2

Query  101  SRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            +R K+     +   RPWR++ +  ++ LP  + +A++R++ N++YFR NYAL VLVI+FL
Sbjct  33   ARAKQTTHSMISTLRPWRQLLDLSALSLPQGYDEAMARLRHNISYFRGNYALAVLVIVFL  92

Query  281  sllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVATIVLLLFTN  454
             L++HPIS+I F+ +   W+ LYF RD  + ++I G+ ++DR+VL++LS+ TI+ L++T+
Sbjct  93   GLVYHPISMIAFIVVFIGWILLYFSRDANDSIVISGKQVDDRIVLVLLSLVTILALVYTD  152

Query  455  ATANILISllvgavvvlvhgaFRKTDDLFADEES---GAFLAGHAPSAPSS  598
               N+L+SL+VG +V   HGAFR TDDLF DEES   G  ++G  P+ P S
Sbjct  153  VGQNVLVSLIVGLLVDGAHGAFRATDDLFLDEESARQGGLVSG--PNRPPS  201



>ref|XP_010102283.1| hypothetical protein L484_024565 [Morus notabilis]
 gb|EXB93226.1| hypothetical protein L484_024565 [Morus notabilis]
Length=207

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 123/175 (70%), Gaps = 3/175 (2%)
 Frame = +2

Query  38   NMTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRI  217
            N+TT G  P++SS    L +I+R +   +  +  RRPWRE+    S  +P N+  A+SR+
Sbjct  16   NVTTAGKSPSTSS---ELSFIARARHTTESVIATRRPWRELLELSSFSVPDNYAAAMSRV  72

Query  218  KTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIND  397
            + NL YFR+NY +  L+++FL LLWHP+S+IVF+ +  AW FLYF RD P+++ GR ++D
Sbjct  73   RWNLNYFRVNYVMATLLVVFLGLLWHPVSMIVFLVVFVAWFFLYFFRDGPVVMHGRTVDD  132

Query  398  RVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            R VL+VLS+ T++ L+FT+   N+L+SL+VG  VV +H AFR T+DLF DEES A
Sbjct  133  RTVLVVLSLVTVLALVFTDVGVNVLVSLVVGVCVVGLHAAFRGTEDLFLDEESAA  187



>ref|XP_009793326.1| PREDICTED: PRA1 family protein F3-like [Nicotiana sylvestris]
Length=176

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = +2

Query  140  RRPWREMF-NFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVF  316
            RRPWRE+  +  S   P +  D  SR+K NL YFR+NYA++VL+ILFLSLLWHPIS+IVF
Sbjct  23   RRPWRELLAHPSSYTRPISLADFTSRVKRNLGYFRVNYAIIVLLILFLSLLWHPISMIVF  82

Query  317  VALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgav  496
            + +  AW FLYF RDEPL+I  R+++DR+VL+VLSV T+V L+ T    N+L+S++VG V
Sbjct  83   LVVFVAWFFLYFHRDEPLMIFNRMVDDRIVLLVLSVITVVSLVLTRVWVNVLVSIVVGMV  142

Query  497  vvlvhgaFRKTDDLFADEESGA  562
            +V +H  FR T+DLF +E+  A
Sbjct  143  LVFLHCTFRITEDLFLEEDDAA  164



>ref|XP_006305929.1| hypothetical protein CARUB_v10011150mg [Capsella rubella]
 gb|EOA38827.1| hypothetical protein CARUB_v10011150mg [Capsella rubella]
Length=196

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 120/179 (67%), Gaps = 2/179 (1%)
 Frame = +2

Query  35   ENMTTYGTIPTSSSAGA-SLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
             NMTTYGT PTS +  A  LEYISR    ++ GL  RRPW++M +  S   P      ++
Sbjct  17   HNMTTYGTNPTSPNDLAPKLEYISR-GNNVRSGLATRRPWKQMLDLRSFSFPRKLATVIT  75

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            R+K N+ YF+ NY +VV   +FLSL+W+P SL++ +AL+ AWLFLYFLRDEPL +  R I
Sbjct  76   RVKANIVYFQTNYTIVVFFSVFLSLVWNPFSLLILLALLGAWLFLYFLRDEPLAVFDREI  135

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            + R+VLIV+SV T+ +L  T+A  NI ++++ G   VL H A RKT+DL+ ++E  + L
Sbjct  136  DHRIVLIVMSVLTLSILFLTDAKLNIAVAIVAGTAAVLSHAAVRKTEDLYQNDEETSLL  194



>ref|XP_011042410.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
 ref|XP_011042411.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
 ref|XP_011042412.1| PREDICTED: PRA1 family protein F2-like [Populus euphratica]
Length=195

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 110/158 (70%), Gaps = 0/158 (0%)
 Frame = +2

Query  74   SAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYA  253
            SA A   +++R+          RRP RE+  F S  LP +F +A  R+K NL YFR+NY 
Sbjct  14   SAAAPSTFLTRSANTTTNFFATRRPLRELIEFSSFSLPLSFGEATIRVKRNLYYFRVNYT  73

Query  254  lvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATI  433
            +++L ILFLSLLWHP+S+IVF+ +  AW FLYF RD+PL I  R I+DRVVL +L+V TI
Sbjct  74   MIILFILFLSLLWHPLSMIVFLVVFVAWFFLYFFRDQPLEIFHRPIDDRVVLGLLAVVTI  133

Query  434  VLLLFTNATANILISllvgavvvlvhgaFRKTDDLFAD  547
            + L+FT+   N+L+S+L+G  VV++H AFR T++L+ D
Sbjct  134  IALIFTHVWLNVLVSVLIGVAVVVLHAAFRGTENLYLD  171



>emb|CDY06788.1| BnaC01g08870D [Brassica napus]
Length=194

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 115/178 (65%), Gaps = 4/178 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIP+ ++A ++   + R K  I  GL  RRPW E+  + S+ LP++F  A  RIK
Sbjct  1    MTTYGTIPSQANAASNQSMLGRAKGLISLGLSSRRPWLELVQWSSLSLPTSFSVATERIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+  FR NY ++ +V +F+S+LW P+ L VFV L+ AWL++Y   +EPL+I G +I+D 
Sbjct  61   TNIMIFRTNYLVIFVVAIFISMLWQPVHLAVFVVLIIAWLYVYSRDNEPLVIFGSVIDDS  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFA----DEESGA  562
             +++ L V T+ ++L TN T  IL+ +L G  VVLVHG  R T+ LF     DEE G 
Sbjct  121  ALVLTLLVLTLCIILLTNVTGGILLGVLAGLPVVLVHGMCRNTESLFVLEDDDEEKGV  178



>dbj|BAK01798.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=193

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 135/194 (70%), Gaps = 11/194 (6%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG---------ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSN  193
            M+ YGTIPTSSS+          + L++ISR K R    L  RRPWRE+ + H+IGLP +
Sbjct  1    MSKYGTIPTSSSSAAGAAHLGGASPLDFISRAKARGATALATRRPWRELADVHAIGLPPS  60

Query  194  FHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLI  373
              DA  R++ NLA+F MNYA+VVLV++FLSLLW PISLIVF+  M  WL LYFLRDEP++
Sbjct  61   LGDAYLRVRANLAHFAMNYAIVVLVVVFLSLLWQPISLIVFLVCMVGWLVLYFLRDEPVV  120

Query  374  IVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE  553
            + GR++ D VVL VL+V T++LLL T AT NIL SLL+G V+V+VH A  K +D   D+E
Sbjct  121  LFGRVVGDGVVLAVLAVVTLILLLLTGATTNILTSLLIGFVLVVVHAALHKAED-NVDDE  179

Query  554  SGAFLAGHAPSAPS  595
             G + A   P+ PS
Sbjct  180  VGRWYAP-VPAQPS  192



>ref|XP_006304207.1| hypothetical protein CARUB_v10010304mg [Capsella rubella]
 gb|EOA37105.1| hypothetical protein CARUB_v10010304mg [Capsella rubella]
Length=207

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 118/171 (69%), Gaps = 7/171 (4%)
 Frame = +2

Query  101  SRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            +R K+     +   RPWRE+    ++ LP  + +A++R++ N +YFR NYAL VLVI+FL
Sbjct  34   ARAKQTTHSMISTLRPWRELLELSALCLPHGYDEAMARLRHNTSYFRGNYALAVLVIVFL  93

Query  281  sllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVATIVLLLFTN  454
             L++HPIS+I F+ +   W+ LYF RD  + ++I G+ ++DR+VL+VLS+ TI+ L++T+
Sbjct  94   GLVYHPISMIAFIVVFIGWILLYFSRDANDSIVISGKEVDDRIVLVVLSLVTILALVYTD  153

Query  455  ATANILISllvgavvvlvhgaFRKTDDLFADEES---GAFLAGHAPSAPSS  598
               N+L+SL++G ++V  HGAFR TDDLF DEES   G  ++G  P+ P S
Sbjct  154  VGENVLVSLIIGLLIVGAHGAFRTTDDLFLDEESARQGGLVSG--PNRPPS  202



>ref|XP_009149225.1| PREDICTED: PRA1 family protein F1 [Brassica rapa]
Length=184

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 124/178 (70%), Gaps = 3/178 (2%)
 Frame = +2

Query  44   TTYGTIPTSSSAGA-SLEYISRT--KERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            T YGT PT+++  A  LEYI+RT  +  ++ GL  RRPW++M +  S   P      ++R
Sbjct  3    TIYGTNPTAANDLAPKLEYITRTNNQHHVRPGLATRRPWKQMLDLRSFHFPRKIASVITR  62

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTN+ YF+ NY +VVL  +FLSL+W P +L++ +AL+ AWLFLYFLRDEPL +  R I+
Sbjct  63   IKTNVVYFQTNYTIVVLFSVFLSLIWKPFALLILLALIGAWLFLYFLRDEPLTVFDREID  122

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
             RVVLIV+SV T+ +L  T+A  NI ++++VG VVVL+H A RKT+++  +E+  + L
Sbjct  123  HRVVLIVMSVLTLSVLFLTDAKLNIAVAVVVGVVVVLLHAAVRKTEEINQNEDETSPL  180



>ref|XP_003568763.2| PREDICTED: PRA1 family protein F3-like [Brachypodium distachyon]
Length=257

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 125/182 (69%), Gaps = 10/182 (5%)
 Frame = +2

Query  41   MTTYGTIPTSS------SAGAS-LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFH  199
            M+ YGTIP+SS      +AG+S L++ISR K      L  RRPWRE+ +  ++ +P    
Sbjct  65   MSKYGTIPSSSSSEPPPTAGSSPLDFISRAKALGASALSTRRPWRELADPGALAVPRGLG  124

Query  200  DAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLII-  376
            DA +R + NLA+F MNYA+VVL ++F+SLLWHP SL+VF+A M AWLFLYFLRD PL + 
Sbjct  125  DAYARARANLAHFSMNYAIVVLAVVFVSLLWHPWSLVVFLACMVAWLFLYFLRDVPLQVS  184

Query  377  VGR-LINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE  553
             GR +I D VVL  LS  T+VLLL T ATANIL SLLVG V+VLVH    +  D   DEE
Sbjct  185  AGRAVIGDGVVLAALSGITLVLLLLTGATANILGSLLVGVVLVLVHALLHRPADSI-DEE  243

Query  554  SG  559
            +G
Sbjct  244  AG  245



>emb|CDY59501.1| BnaC05g50010D [Brassica napus]
Length=184

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 122/178 (69%), Gaps = 3/178 (2%)
 Frame = +2

Query  44   TTYGTIPTSSSAGA-SLEYISRTK--ERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            T YGT PT+++  A  LEYI+RT     ++ GL  RR W++M +  S   P      ++R
Sbjct  3    TIYGTNPTAANDLAPKLEYITRTNNHHHVRPGLATRRSWKQMLDLGSFHFPRKIASVITR  62

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTN+ YF+ NY + VL  +FLSL+W P +L++ +AL+ AWLFLYFLRDEPLI+  R I+
Sbjct  63   IKTNIVYFQTNYTIAVLFSVFLSLIWKPFALLILLALIGAWLFLYFLRDEPLIVFDREID  122

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
             RVVLIV+SV T+ +L  T+A  NI ++++ G VV+L+H A RKT++++ +E+  + L
Sbjct  123  HRVVLIVMSVLTLSVLFLTDAKLNIAVAVVAGVVVILLHAAVRKTEEIYQNEDETSPL  180



>ref|XP_011078199.1| PREDICTED: PRA1 family protein F2-like [Sesamum indicum]
Length=193

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 113/148 (76%), Gaps = 4/148 (3%)
 Frame = +2

Query  95   YISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvil  274
            ++   ++R++  +G RRPW+EM +F    LP +F+ A+ RI+TN +YF +NYA+++L  L
Sbjct  19   FLVHARQRVRSDMGTRRPWKEMVSF---SLPESFNAALQRIQTNTSYFHVNYAMIILFAL  75

Query  275  flsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTN  454
            F++LLWHP++LIVFVA+ AAWLFLY LRDEP+++ G  + ++VVL+VLS+ T+V L+ T 
Sbjct  76   FINLLWHPVALIVFVAMTAAWLFLYILRDEPVVLFGYAMEEQVVLVVLSILTVVTLMMTR  135

Query  455  ATANILISllvgavvvlvhgaFRKTDDL  538
            A+  +   L+VG VVV+ HGAFR+T+DL
Sbjct  136  ASVFV-AGLVVGVVVVVAHGAFRRTNDL  162



>emb|CDY26225.1| BnaA06g11920D [Brassica napus]
Length=184

 Score =   124 bits (310),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 123/178 (69%), Gaps = 3/178 (2%)
 Frame = +2

Query  44   TTYGTIPTSSSAGA-SLEYISRT--KERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            T YGT PT+++  A  LEYI+RT  +  ++ GL  RRPW++M +  S   P      ++R
Sbjct  3    TIYGTNPTAANDQAPKLEYITRTNNQHHVRPGLATRRPWKQMLDLRSFHFPRKIASVITR  62

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            IKTN+ YF+ NY +VVL  +FLSL+W P +L++ +AL+ AWLFLYFLRDEPL +  R I+
Sbjct  63   IKTNIVYFQTNYTIVVLFSVFLSLIWKPFALLILLALIGAWLFLYFLRDEPLTVFDREID  122

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
             RVVLIV+S  T+ +L  T+A  NI ++++VG VVVL+H A RKT+++  +E+  + L
Sbjct  123  HRVVLIVMSALTLSVLFLTDAKLNIAVAVVVGVVVVLLHAAVRKTEEINQNEDETSPL  180



>ref|XP_010458140.1| PREDICTED: PRA1 family protein E-like [Camelina sativa]
Length=206

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 119/171 (70%), Gaps = 7/171 (4%)
 Frame = +2

Query  101  SRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            +R K+     +   RPWR++ +  ++ LP  + +A++R++ N++YFR NYAL VLVI+FL
Sbjct  33   ARAKQTTHSMISTLRPWRQLLDLSALSLPQGYDEAMARLRHNISYFRGNYALAVLVIVFL  92

Query  281  sllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVATIVLLLFTN  454
             L++HPIS+I F+ +   W+ LYF RD  + +++ G+ ++DR+VL++LS+ TI+ L++T+
Sbjct  93   GLVYHPISMIAFIVVFIGWILLYFSRDANDSIVVSGKQVDDRIVLVLLSLVTILALVYTD  152

Query  455  ATANILISllvgavvvlvhgaFRKTDDLFADEES---GAFLAGHAPSAPSS  598
               N+L+SL+VG +V   HGAFR TDDLF DEE+   G  ++G  P+ P S
Sbjct  153  VGQNVLVSLIVGLLVAGAHGAFRATDDLFLDEETARQGGLVSG--PNRPPS  201



>gb|KEH23866.1| PRA1 family protein [Medicago truncatula]
Length=201

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = +2

Query  140  RRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFV  319
            RRPW E+F  +S   P +  +A SR+K N+ +FR+NY +++L +LFLSLLWHPIS+IVF+
Sbjct  38   RRPWEEVFALYSFTRPYSLTEATSRVKCNINHFRVNYIILILFVLFLSLLWHPISIIVFL  97

Query  320  ALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavv  499
              + AW FLYF RDEP+++ G +++DR    VL+V TIV L FT    N+L+S+ VG V+
Sbjct  98   ITLIAWFFLYFFRDEPIVLFGHVVDDRASAAVLAVVTIVALGFTGVWVNVLVSIAVGVVI  157

Query  500  vlvhgaFRKTDDLFADEESG  559
            V++HGAFR T+DL+ DE  G
Sbjct  158  VVLHGAFRSTEDLYVDEHEG  177



>ref|XP_007215981.1| hypothetical protein PRUPE_ppa011673mg [Prunus persica]
 gb|EMJ17180.1| hypothetical protein PRUPE_ppa011673mg [Prunus persica]
Length=201

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 84/109 (77%), Gaps = 2/109 (2%)
 Frame = +2

Query  8    PP*AVRNSPENMTTYGTIPTSSS-AGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGL  184
            PP   R S + MTTYGTIPTSSS  G S EYISR KERIK GLG RRPW+ MFNF S   
Sbjct  27   PPNGQRRS-KPMTTYGTIPTSSSTQGPSGEYISRAKERIKAGLGARRPWKLMFNFRSFNF  85

Query  185  PSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMA  331
            PS F +   RI++N+AYFRMNYA+VVL+ILFLSLLWHPISLIVF+ +M 
Sbjct  86   PSPFREVFGRIRSNVAYFRMNYAIVVLLILFLSLLWHPISLIVFIIMMG  134



>ref|XP_008388683.1| PREDICTED: PRA1 family protein E-like [Malus domestica]
Length=218

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +2

Query  140  RRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFV  319
            RRPW E+F+  S  +PSN+ DA++RIK N AYFR+NY +  L I+FLSLLWHPIS+IVF+
Sbjct  55   RRPWPELFSLTSFSVPSNYADAMARIKLNTAYFRVNYTMAALFIVFLSLLWHPISMIVFL  114

Query  320  ALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavv  499
             ++ AWL LYF R  P+ +  + ++DRVV I L + T+V L+FT+   N+L++L+V  V+
Sbjct  115  IVLVAWLALYFFRTTPVALYNQSLDDRVVAIALGLVTVVALVFTHVGLNVLVALIVAVVI  174

Query  500  vlvhgaFRKTDDLFADEESGA  562
            + +H AFR T+DLF DEE+ A
Sbjct  175  MGLHAAFRVTEDLFLDEETAA  195



>ref|XP_010489355.1| PREDICTED: PRA1 family protein E-like [Camelina sativa]
Length=206

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 117/171 (68%), Gaps = 7/171 (4%)
 Frame = +2

Query  101  SRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            +R K+     +   RPWR++ +  ++ LP  + +A++R++ N++YFR NYAL VLVI+FL
Sbjct  33   ARAKQTTHSMISTLRPWRQLLDLSALSLPQGYDEAMARLRHNISYFRGNYALAVLVIVFL  92

Query  281  sllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVATIVLLLFTN  454
             L++HPIS+I F+ +   W+ LYF RD  + +++ G+ ++DR+VL++LS+ TI+ L++T+
Sbjct  93   GLVYHPISMIAFIVVFIGWILLYFSRDANDSIVVSGKQVDDRIVLVLLSLVTILALVYTD  152

Query  455  ATANILISllvgavvvlvhgaFRKTDDLFADEES---GAFLAGHAPSAPSS  598
               N+L+SL+VG +    HGAFR TDDLF DEE+   G  ++G  P  P S
Sbjct  153  VGQNVLVSLIVGLLFAGAHGAFRATDDLFLDEETARQGGLVSG--PIRPPS  201



>gb|AAT44309.1| hypothetical protein [Oryza sativa Japonica Group]
Length=193

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 125/194 (64%), Gaps = 11/194 (6%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGAS---------LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSN  193
            M+ YGTIPTSSS+            L++ISR K R    L  RRPWRE+ +  +  +P  
Sbjct  1    MSKYGTIPTSSSSDGPPPGSSSSSPLDFISRAKARGATALAERRPWRELADPRAASVPRG  60

Query  194  FHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLI  373
               A  R + NL +F MNYA+VVL ++FLSLLWHP+SLIVF+A M AWLFLYFLRDEPL 
Sbjct  61   LGGAYRRARANLGHFSMNYAIVVLAVVFLSLLWHPVSLIVFLACMVAWLFLYFLRDEPLA  120

Query  374  IVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE  553
            + GR + +  VL VLSV T+VLLL T AT NIL SLLVG V+VL+H  F +  D   DEE
Sbjct  121  LCGRAVGEGAVLAVLSVLTLVLLLLTGATVNILTSLLVGVVIVLLHAVFHRPADSI-DEE  179

Query  554  SGAFLAGHAPSAPS  595
            +G +     P  PS
Sbjct  180  AGRYYT-PVPPQPS  192



>ref|XP_010523568.1| PREDICTED: PRA1 family protein C [Tarenaya hassleriana]
Length=188

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 117/186 (63%), Gaps = 0/186 (0%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTI T + A +SL  + R KE+I   LG  RPW E+    + GLP++F +A  RIK
Sbjct  1    MTTYGTISTQAQASSSLSLLGRAKEQILLCLGSGRPWLELIQCDAFGLPTSFGEATDRIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
             N+ +FR+NY ++  + LF+SLLW P+SLI+F+ L+  WLFLYF  +EPL+I GR+IND 
Sbjct  61   ANILFFRVNYTIITSIALFISLLWQPVSLIIFLVLIILWLFLYFRDNEPLMIFGRMINDS  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHA  580
             V +VL + TI + L T+    +L+  L  + ++LVH   R  + LF  E+    ++   
Sbjct  121  TVKMVLFILTICMFLVTDVFHGVLVGFLAVSPIILVHSVCRNKEPLFMAEDDEEAVSSKG  180

Query  581  PSAPSS  598
             S+ +S
Sbjct  181  ASSLAS  186



>ref|XP_009128592.1| PREDICTED: PRA1 family protein C [Brassica rapa]
Length=193

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 116/180 (64%), Gaps = 3/180 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIP+ ++A ++   + R K  I  GL  RRPW E+  + S+ LP++F  A  RIK
Sbjct  1    MTTYGTIPSQANASSNQNMLGRAKGLISLGLSSRRPWLELVQWSSLSLPTSFTVATERIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+  FR NY ++  V +F+S+LW P+ L VFV L+ AWL++Y   +EPL+I G +I+D 
Sbjct  61   TNIMIFRTNYLVIFFVAIFISMLWQPVHLSVFVVLIIAWLYVYSRDNEPLVIFGSVIDDS  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFA---DEESGAFLA  571
             +++ L V T+ ++L TN T  IL+ +L G  VVLVHG  R T+ LF    DEE  A ++
Sbjct  121  ALVLTLLVLTLCIILLTNVTGGILLGVLAGLPVVLVHGICRNTESLFVLEDDEEKVATMS  180



>ref|XP_002300798.1| hypothetical protein POPTR_0002s04470g [Populus trichocarpa]
 gb|EEE80071.1| hypothetical protein POPTR_0002s04470g [Populus trichocarpa]
Length=194

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = +2

Query  134  GMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIV  313
              RRPWRE+     I  P +  +   RIK NL+YF +NY +++L +LFLSLLWHP+S+IV
Sbjct  7    ATRRPWREL-----IERPYSLGNTTVRIKRNLSYFSVNYTMIILSVLFLSLLWHPLSMIV  61

Query  314  FVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvga  493
            F+ +  AW +LYF RD+PL+I  R INDRVVL +L VATIV L+FT+   N+L+SLL+GA
Sbjct  62   FLIVFVAWFYLYFFRDQPLVIFHRTINDRVVLGLLGVATIVALIFTHVWLNVLVSLLIGA  121

Query  494  vvvlvhgaFRKTDDLFADEES-GAFLAGHA  580
             +VL+H AFR+TDDL+ DE+   + +A HA
Sbjct  122  AIVLLHAAFRRTDDLYLDEQDLPSPIARHA  151



>ref|XP_006417650.1| hypothetical protein EUTSA_v10008786mg [Eutrema salsugineum]
 gb|ESQ36003.1| hypothetical protein EUTSA_v10008786mg [Eutrema salsugineum]
Length=206

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 110/155 (71%), Gaps = 2/155 (1%)
 Frame = +2

Query  101  SRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            +R K+  +  +   RPWRE+ +  ++ LP  + +A++ ++ NL+YFR NYAL VL I+FL
Sbjct  30   ARAKQTTQSMITTLRPWRELLDLSALSLPHRYDEAMAHLRHNLSYFRANYALAVLAIVFL  89

Query  281  sllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVATIVLLLFTN  454
             L++HPIS++ F+ +   W+ LYF RD  +P++I GR ++DR+VL +LS+ TI+ L++T+
Sbjct  90   GLVYHPISMVAFIVVFIGWILLYFSRDANDPIVISGREVDDRIVLGLLSLVTILALVYTD  149

Query  455  ATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
               N+L SL++G ++V  HGAFR TDDLF DEE+ 
Sbjct  150  VGENVLASLIIGLLIVGAHGAFRSTDDLFIDEETA  184



>ref|XP_010025011.1| PREDICTED: PRA1 family protein F2-like [Eucalyptus grandis]
Length=204

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 107/163 (66%), Gaps = 5/163 (3%)
 Frame = +2

Query  80   GASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlv  259
             A+L Y SR           RRPWRE  +  S  LP +  DA SR+  N+++FR+NYA++
Sbjct  30   AAALFYTSRATT----AFPTRRPWREFLDLSSFSLPYSLADAASRVAKNVSHFRLNYAVL  85

Query  260  vlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVL  439
             L +LFLSLLWHPI+LIV  A + AW  LYF  ++PL+++GR  +DRVVL  LS+ T V 
Sbjct  86   TLFVLFLSLLWHPIALIVLTAALFAWYGLYFSVEQPLVVLGRSFDDRVVLAGLSLVTAVA  145

Query  440  LLFTNATANILISllvgavvvlvhgaFRKTDDLFAD-EESGAF  565
            L+ T    N+LISL +GAVVV +H  FR ++DL+ D EESG F
Sbjct  146  LVLTGVGLNVLISLAIGAVVVGLHAVFRNSEDLYVDEEESGLF  188



>ref|XP_002520992.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41409.1| conserved hypothetical protein [Ricinus communis]
Length=182

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = +2

Query  131  LGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLI  310
               RRPW E+  F S   P    +A +RIK NL YFR+NYA+++L ILFLSLLWHP+S+I
Sbjct  19   FATRRPWSELIKFSSFSRPYLIGEATARIKYNLYYFRVNYAMIILFILFLSLLWHPLSMI  78

Query  311  VFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvg  490
            VF+ +  AW FLYF RD+PL I+ R I+DRVVL VLSV TIV L+FT+   N+L+S+++G
Sbjct  79   VFLIIFVAWFFLYFFRDQPLTILRRTIDDRVVLGVLSVITIVALVFTHVWLNVLVSVVIG  138

Query  491  avvvlvhgaFRKTDDLFADEESGA  562
             V+V++H   R+T+DL+ DE+  A
Sbjct  139  VVIVVLHAVIRRTEDLYWDEQDVA  162



>ref|XP_009148131.1| PREDICTED: PRA1 family protein E [Brassica rapa]
Length=216

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 112/172 (65%), Gaps = 6/172 (3%)
 Frame = +2

Query  101  SRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            +R K+  +  +   RPWR + +  ++ LP ++++A++ ++ NL+YFR NYAL VL ++FL
Sbjct  41   ARAKQTTQSVIATLRPWRMLLDLSALSLPHSYNEAMANLRHNLSYFRANYALAVLGVVFL  100

Query  281  sllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVATIVLLLFTN  454
             L++HPIS++ F+ +   W+  YF RD  +P+++ GR ++DR+VL VLSV T++ L++T+
Sbjct  101  GLVYHPISMVAFIVVFIGWILFYFSRDGNDPIVVSGREVDDRIVLAVLSVVTVLALVYTD  160

Query  455  ATANILISllvgavvvlvhgaFRKTDDLFADEES----GAFLAGHAPSAPSS  598
               N+L+SL+VG + V  H A R T DLF DEES    G   AG     P S
Sbjct  161  VGENVLVSLIVGLLFVGAHAAVRNTGDLFLDEESARQGGLVSAGSVNRGPGS  212



>ref|XP_004495611.1| PREDICTED: PRA1 family protein E-like [Cicer arietinum]
Length=191

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 112/170 (66%), Gaps = 7/170 (4%)
 Frame = +2

Query  50   YGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNL  229
            YG IP+ S+A       +         +   R WRE  +  ++  P ++ DA+ R++ NL
Sbjct  9    YGAIPSPSTA-------TWQPSPTSNLIATPRSWREFLDLSALSRPLSYDDAMLRLRRNL  61

Query  230  AYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVL  409
             YF+ NYA V+L+I+FLSLLWHP S+IVF+ L+ AW FLYF R+ PL+I  R ++DR V+
Sbjct  62   NYFQFNYAAVMLLIVFLSLLWHPFSMIVFLILLVAWFFLYFSRNSPLVIFNRTLDDRTVI  121

Query  410  IVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESG  559
             VL   T+V L+ T+   N+L+SL+VG VV+ +HG+FR T+DLF DEESG
Sbjct  122  CVLGFVTVVGLVSTHVGLNLLLSLIVGVVVLGLHGSFRVTEDLFLDEESG  171



>ref|XP_010100086.1| hypothetical protein L484_005760 [Morus notabilis]
 gb|EXB81322.1| hypothetical protein L484_005760 [Morus notabilis]
Length=184

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 105/164 (64%), Gaps = 1/164 (1%)
 Frame = +2

Query  74   SAGASLEYISRTKERIKEGLGMRRPWREMFN-FHSIGLPSNFHDAVSRIKTNLAYFRMNY  250
            S+ +   Y   T  R  E    RRPWR +     S  LP +  +A  R+K NL YFR+NY
Sbjct  2    SSTSPPHYGGYTFSRASESFATRRPWRVLVQPISSFSLPYSLGEATIRVKRNLNYFRVNY  61

Query  251  AlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVAT  430
            A+V L ILFLSLLWH IS+IVF+ +  AW  LYF R EPL++  R ++DR+VL VL + T
Sbjct  62   AMVALFILFLSLLWHSISMIVFIVVFVAWFALYFFRSEPLVVFNRTVDDRLVLAVLGLVT  121

Query  431  IVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            +V L+ T+   N+L+S+L+GAV+V +H   R TDDL++DE   A
Sbjct  122  VVALVLTDVWLNVLVSVLIGAVLVGLHATIRGTDDLYSDEPGAA  165



>ref|XP_003556473.1| PREDICTED: PRA1 family protein E-like [Glycine max]
Length=192

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 101/139 (73%), Gaps = 0/139 (0%)
 Frame = +2

Query  143  RPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVA  322
            RPWRE  +  ++  P ++ DA+ R++ NL+YFR NYA V L+I+FLSLLWHPIS+IVF+ 
Sbjct  37   RPWREFLDLSALSRPYSYDDAMIRVRRNLSYFRFNYAAVTLLIVFLSLLWHPISMIVFLL  96

Query  323  LMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvv  502
            ++ AW + YF RD PL++  + ++DR VL VL + T+V L+ T+   N+L+SL+V  V+V
Sbjct  97   VLVAWYYFYFSRDVPLVVFNQTLDDRTVLCVLGLLTVVSLVSTHVGLNVLLSLIVSVVLV  156

Query  503  lvhgaFRKTDDLFADEESG  559
             +H AFR T+DLF DEES 
Sbjct  157  GLHAAFRVTEDLFLDEESS  175



>ref|XP_004960927.1| PREDICTED: PRA1 family protein F2-like [Setaria italica]
Length=197

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 116/174 (67%), Gaps = 8/174 (5%)
 Frame = +2

Query  89   LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlv  268
            L++ISR K R    L  RRPWRE+ + H++ +P  F DA  R + NLA+F  NYALVVL 
Sbjct  27   LDFISRAKARGASALATRRPWRELADPHALSVPRGFSDAYRRARANLAHFAANYALVVLA  86

Query  269  ilflsllWHPISLIVFVALMAAWLFLYFLR----DEPLIIVGRLINDRVVLIVLSVATIV  436
            ++F SLLW+P+SL+VF+A  A WLFLYFLR    D+ L+I GR + D VV+  LS  T+V
Sbjct  87   VVFASLLWYPVSLLVFLACFAGWLFLYFLRDRDVDQALLICGRPVGDGVVIAFLSAVTLV  146

Query  437  LLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHAPSAPSS  598
            LLL T AT+NILISLLVG +VVL H    +  D   DEE+G +   + P  PSS
Sbjct  147  LLLLTGATSNILISLLVGLLVVLFHALLHRPADSI-DEEAGRW---YTPVPPSS  196



>gb|EYU46500.1| hypothetical protein MIMGU_mgv1a014374mg [Erythranthe guttata]
Length=191

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 105/155 (68%), Gaps = 1/155 (1%)
 Frame = +2

Query  104  RTKERIKEGLGMRRPWREMF-NFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            R K R +     RRPWRE+F +  S  LP +F D  SR+  NL +FR+NYA++VLV+LFL
Sbjct  26   RAKSRTQTLYATRRPWRELFAHPASYSLPYSFGDFASRLNRNLGHFRVNYAMIVLVVLFL  85

Query  281  sllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNAT  460
            SLL+HPIS+IVF+ +   W  LYF RDEP+++  R+++DR+V++ L + T+  LL T   
Sbjct  86   SLLYHPISMIVFMVIFVFWFLLYFFRDEPIVVFNRMVDDRMVMVGLGILTLGSLLLTRVW  145

Query  461  ANILISllvgavvvlvhgaFRKTDDLFADEESGAF  565
             N+L+S  +G   V++H  FR T+DLF DE+  A+
Sbjct  146  LNVLVSFSIGTAAVVLHATFRVTEDLFLDEDEIAY  180



>emb|CAN60779.1| hypothetical protein VITISV_032147 [Vitis vinifera]
Length=160

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 111/144 (77%), Gaps = 3/144 (2%)
 Frame = +2

Query  143  RPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVA  322
            RPW E+ +  ++ LP +  +A +RIK +LAYFR+NY L+VL++LF+SLLWHPIS+IVF+ 
Sbjct  5    RPWGELLDLSALSLPFSLGEATARIKRSLAYFRVNYTLIVLLVLFVSLLWHPISMIVFLV  64

Query  323  LMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvv  502
            +  AWLFLYFLRD+P++I  R+++DRVVL+ ++  TIV L+ T+   N+ +SL++G+ +V
Sbjct  65   VFVAWLFLYFLRDDPVLIFNRIVDDRVVLVGVAAVTIVALVLTHVWLNVFVSLVIGSFLV  124

Query  503  lvhgaFRKTDDLFADEES--GAFL  568
             +HGAFR +D+L  D+ES  GA L
Sbjct  125  CLHGAFRASDNL-DDQESPYGALL  147



>emb|CDX93539.1| BnaA06g05090D [Brassica napus]
Length=208

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 112/172 (65%), Gaps = 6/172 (3%)
 Frame = +2

Query  101  SRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            +R K+  +  +   RPWR + +  ++ LP ++++A++ ++ NL+YFR NYAL VL ++FL
Sbjct  33   ARAKQTTQSVIATLRPWRMLLDLSALSLPHSYNEAMANLRHNLSYFRANYALAVLGVVFL  92

Query  281  sllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVATIVLLLFTN  454
             L++HPIS++ F+ +   W+  YF RD  +P+++ GR ++DR+VL +LSV T++ L++T+
Sbjct  93   GLVYHPISMVAFIVVFIGWILFYFSRDGNDPIVVSGREVDDRIVLGLLSVVTVLALVYTD  152

Query  455  ATANILISllvgavvvlvhgaFRKTDDLFADEES----GAFLAGHAPSAPSS  598
               N+L+SL+VG + V  H A R T DLF DEES    G   AG     P S
Sbjct  153  VGENVLVSLIVGLLFVGAHAAVRNTGDLFLDEESARQGGLVSAGSVNRGPGS  204



>gb|EPS62668.1| hypothetical protein M569_12125, partial [Genlisea aurea]
Length=163

 Score =   116 bits (291),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 98/153 (64%), Gaps = 0/153 (0%)
 Frame = +2

Query  104  RTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfls  283
            +    ++      RPWR  F+  +  LP ++ DA+SRI+ N  +FR NYA++ L  +F S
Sbjct  2    QITPEVRSAYAAARPWRIFFDVSAFSLPLSYGDAMSRIRRNANHFRGNYAVICLAAVFCS  61

Query  284  llWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATA  463
            L++HPIS+IVF+     WL+LY  R+ P+ + GR ++DR+VL+ LS+ T+V L+ T+A  
Sbjct  62   LVYHPISMIVFLIASIGWLWLYLCREGPIAVFGRAVDDRIVLLTLSLVTVVALVLTHAAL  121

Query  464  NILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            N+LI ++ G +   VHG FR TD+LF DE   A
Sbjct  122  NVLIGIIAGVIASGVHGGFRSTDELFLDESEAA  154



>ref|XP_008382944.1| PREDICTED: PRA1 family protein F2-like [Malus domestica]
 ref|XP_008382945.1| PREDICTED: PRA1 family protein F2-like [Malus domestica]
 ref|XP_008382946.1| PREDICTED: PRA1 family protein F2-like [Malus domestica]
 ref|XP_008382947.1| PREDICTED: PRA1 family protein F2-like [Malus domestica]
 ref|XP_008382948.1| PREDICTED: PRA1 family protein F2-like [Malus domestica]
Length=196

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 122/180 (68%), Gaps = 7/180 (4%)
 Frame = +2

Query  26   NSPENMTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREM-FNFHSIGLPSNFHD  202
            +SP +   YGT P+++   AS E  SR +   +     RRPW E+ +   S   P  F +
Sbjct  4    DSPPH---YGTHPSTT---ASPEPFSRARTTTQSFFATRRPWLELVYPLSSFTRPYTFGE  57

Query  203  AVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVG  382
            A  RIK NL +F +NY ++VL +LFLSLLWHP+SLIVF+ +  AW FLYF RDEPL+I  
Sbjct  58   ATVRIKRNLGHFSVNYTMLVLFVLFLSLLWHPVSLIVFLLVFIAWFFLYFFRDEPLVIFH  117

Query  383  RLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            R+++DRV+L +L+V T+V L+FT+   N+L+S+L+G  +V +H AFR T+DL+ADE+  A
Sbjct  118  RIVDDRVILGILAVVTVVALVFTHVWLNVLVSILIGVAIVGLHAAFRGTEDLYADEQEAA  177



>ref|XP_006589185.1| PREDICTED: PRA1 family protein E-like [Glycine max]
Length=190

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 111/169 (66%), Gaps = 5/169 (3%)
 Frame = +2

Query  50   YGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNL  229
            YGT+     AGA+    + T       L   RPWRE  +  ++  P ++ DA+ R++ NL
Sbjct  9    YGTL-----AGATPTGTTTTTTTTTTSLVTPRPWREFLDLSALSCPYSYDDAMIRVRRNL  63

Query  230  AYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVL  409
            ++FR NYA + L+I+FLSLLWHP+S+IVF+ ++ AW +LYF RD  L++  + ++DR VL
Sbjct  64   SHFRFNYAAITLLIVFLSLLWHPVSMIVFLLVLVAWYYLYFSRDGLLVVFNQTLDDRTVL  123

Query  410  IVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
             VL + T+  L+ T+   N+L+SL+V  V+V +H AFR T+DLF DEES
Sbjct  124  CVLGLLTVAALVSTHVGLNVLLSLIVAVVLVGLHAAFRVTEDLFLDEES  172



>ref|XP_007144698.1| hypothetical protein PHAVU_007G177600g [Phaseolus vulgaris]
 gb|ESW16692.1| hypothetical protein PHAVU_007G177600g [Phaseolus vulgaris]
Length=192

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 109/175 (62%), Gaps = 13/175 (7%)
 Frame = +2

Query  29   SPENMTT-YGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDA  205
            SP  + + Y +IP+ S A A              G   RRPW E F   S  L  +  +A
Sbjct  5    SPSTLPSGYSSIPSFSRATA------------PAGFSTRRPWEEFFAMRSFTLIYSLGEA  52

Query  206  VSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGR  385
            + R++ NL +FR+NYA++ L++LFLSLLW PISLIVF+A+  AW FLYF RD P++++ R
Sbjct  53   MLRVRRNLGHFRVNYAMIGLLVLFLSLLWQPISLIVFIAVFTAWFFLYFFRDGPVVVLHR  112

Query  386  LINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADE  550
             ++DR+VL  LS  T+  L+ T    N++++LLV    VL+H +FR T+DL+ DE
Sbjct  113  ALDDRLVLAALSALTVAALVLTGVWLNVVVALLVATAAVLLHASFRNTEDLYVDE  167



>ref|XP_011459633.1| PREDICTED: PRA1 family protein F3-like, partial [Fragaria vesca 
subsp. vesca]
Length=145

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 101/148 (68%), Gaps = 11/148 (7%)
 Frame = +2

Query  146  PWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVAL  325
            PW+ MF+F S+  P  F D ++R++ N AYFRMNYA+VVL+ILFLSLLWH ISLIV + +
Sbjct  8    PWKLMFDFRSLTFPHCFDDELTRLRYNAAYFRMNYAIVVLLILFLSLLWHLISLIVLIVM  67

Query  326  MAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvl  505
            +AAWLFLYFL DEPL++ G            +V  IVLL  T+AT NIL++L +  VVV+
Sbjct  68   LAAWLFLYFLPDEPLVLFGS-----------TVVKIVLLFLTSATMNILVALSIAVVVVV  116

Query  506  vhgaFRKTDDLFADEESGAFLAGHAPSA  589
            VH   RKT DL  ++E+   + G A S+
Sbjct  117  VHVMLRKTKDLHVNKENTGLMTGPAGSS  144



>ref|XP_009381867.1| PREDICTED: PRA1 family protein F3-like [Musa acuminata subsp. 
malaccensis]
Length=215

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 108/166 (65%), Gaps = 10/166 (6%)
 Frame = +2

Query  68   SSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMN  247
            S+    +   ISRTKER+  GL  RRPWRE+ +  +I LP     A  RI++N AYF MN
Sbjct  28   SAVGAQTASDISRTKERVWSGLATRRPWRELADVRAIRLPPILGVAYLRIRSNAAYFDMN  87

Query  248  YAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLI-IVGRLINDRVVLIVLSV  424
            Y +VV  ++FLS LWHP SL+V         FLYF+R+EPL+ +V   +NDR +LI LS+
Sbjct  88   YVIVVHPVVFLSPLWHPTSLMV---------FLYFVRNEPLVALVRTCVNDRTILIALSM  138

Query  425  ATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
             T+VLLL T AT+++LIS LVG  +VL+H A  +T+DL   EE+  
Sbjct  139  VTLVLLLRTKATSDVLISRLVGLRMVLIHAALLRTEDLVLKEEAAG  184



>ref|XP_007144834.1| hypothetical protein PHAVU_007G188100g [Phaseolus vulgaris]
 gb|ESW16828.1| hypothetical protein PHAVU_007G188100g [Phaseolus vulgaris]
Length=185

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = +2

Query  149  WREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALM  328
            WRE  +F ++  PS++ DA+ R++ NL+YFR NYA V L+I+FLSLLWHPIS+IVF+ ++
Sbjct  32   WREFLDFSALSRPSSYDDAMIRLRRNLSYFRYNYAAVTLLIVFLSLLWHPISMIVFLLVL  91

Query  329  AAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlv  508
             AW + YF R  P+++  + ++DR VL VL+V T++ L+ T+   N+L+SL+V  V V +
Sbjct  92   VAWFYFYFSRHGPIVVFNQTLDDRTVLCVLAVITVIALVSTHVGLNVLLSLIVAVVFVGL  151

Query  509  hgaFRKTDDLFADEES  556
            H AFR T+DLF DEES
Sbjct  152  HAAFRVTEDLFLDEES  167



>ref|XP_003559867.1| PREDICTED: PRA1 family protein B6-like [Brachypodium distachyon]
Length=265

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 106/173 (61%), Gaps = 5/173 (3%)
 Frame = +2

Query  56   TIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAY  235
            T P +S A A+ E ++R +E+ +  +  RRPW E+F   +   P N  +AVSR++ N AY
Sbjct  71   TAPPNSLAKAA-ELVTRFREQGQALIAARRPWGEVFRSPAFSKPPNVGEAVSRMRRNTAY  129

Query  236  FRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLR----DEPLIIVGRLINDRV  403
            FR NYAL VL ++  SLLWHP +L V +AL AAW FLYF R     +PL I G   +D  
Sbjct  130  FRANYALAVLSVVAASLLWHPGTLFVLLALCAAWFFLYFARPAEGGQPLRIFGTEFDDGT  189

Query  404  VLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            VL VLS  T++ +LFT+   N++ S ++G  +V  H A R TDDLF  E+  A
Sbjct  190  VLAVLSGVTVIAMLFTDVGWNVVGSAMIGVALVGAHAALRSTDDLFLTEQEAA  242



>ref|NP_173212.1| prenylated RAB acceptor 1.F1 [Arabidopsis thaliana]
 sp|Q9FZ63.1|PR1F1_ARATH RecName: Full=PRA1 family protein F1; Short=AtPRA1.F1 [Arabidopsis 
thaliana]
 gb|AAF99811.1|AC034257_3 Unknown protein [Arabidopsis thaliana]
 gb|AAT06412.1| At1g17700 [Arabidopsis thaliana]
 gb|AAT41798.1| At1g17700 [Arabidopsis thaliana]
 gb|AEE29623.1| PRA1 family protein F1 [Arabidopsis thaliana]
Length=180

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 119/178 (67%), Gaps = 2/178 (1%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA-SLEYISR-TKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSR  214
            MTTYGT   SS+  A  LEYI+R   +  + GL  RRPW++M +  S   P      ++R
Sbjct  1    MTTYGTNQKSSNDLAPKLEYITRGINQHKRSGLATRRPWKQMLDLGSFNFPRKLATVITR  60

Query  215  IKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLIN  394
            I+ N  YF+ NY +VVL  +FLSL+W+P SL+V +AL+ AWLFLYFLRDEPL +  R I+
Sbjct  61   IRANTVYFQTNYTIVVLFSVFLSLIWNPFSLLVLLALLGAWLFLYFLRDEPLTVFDREID  120

Query  395  DRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
             R+VLI++SV T+ +L  T+A  NI ++++ GA+ VL H A RKT+DLF  +E  + L
Sbjct  121  HRIVLIIMSVITLSILFLTDAKLNIAVAIVAGALAVLSHAAVRKTEDLFQTDEETSLL  178



>ref|XP_003632302.1| PREDICTED: PRA1 family protein E [Vitis vinifera]
Length=188

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 107/173 (62%), Gaps = 6/173 (3%)
 Frame = +2

Query  44   TTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKT  223
            + Y  IP+ S++     +      R +     RRPWR+  +  S   P    +   R+K 
Sbjct  7    SGYRNIPSPSTSAPQFNF------RAQSSPATRRPWRQFADLSSFSRPYAAGEVTIRVKR  60

Query  224  NLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRV  403
            N++YFR+NY ++ L ILFLSLLWHP+S+IVF+ +   W FLYF R+EPL+I  R I DR 
Sbjct  61   NVSYFRVNYVMMALFILFLSLLWHPVSMIVFLIVFLGWFFLYFFRNEPLMIFNRTIGDRT  120

Query  404  VLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            VLIVL + TIV+L+ T+   N+++SL +  VVV +H AFR T+D F DE+  A
Sbjct  121  VLIVLGLVTIVVLVLTHVWLNVVVSLAIVVVVVGLHAAFRGTEDHFLDEQDAA  173



>ref|XP_010476929.1| PREDICTED: PRA1 family protein F1 isoform X1 [Camelina sativa]
 ref|XP_010476930.1| PREDICTED: PRA1 family protein F1 isoform X2 [Camelina sativa]
 ref|XP_010476931.1| PREDICTED: PRA1 family protein F1 isoform X3 [Camelina sativa]
Length=182

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 116/179 (65%), Gaps = 3/179 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA-SLEYISR--TKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MTTYGT PTS +  A  LEYI+R   +  ++ GL  RRPW++M +  S   P      +S
Sbjct  1    MTTYGTNPTSPNDLAPKLEYITRGNNQHNVRSGLATRRPWKQMLDLRSFNFPRKLATVIS  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            R++ N  YF+ NY +V L  +FLSL+W+P SL++ +AL+ AWLFLYFLRDEPL +  R I
Sbjct  61   RVRANTVYFQTNYTIVFLFSVFLSLIWNPFSLLILLALLGAWLFLYFLRDEPLAVFDREI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL  568
            + R+VLI +SV T+ +L  T+A  NI I+++ G V VL H A RKT+DL+   +    L
Sbjct  121  DHRIVLIGMSVLTLSILFLTDAKLNIAIAIVAGTVSVLSHAAVRKTEDLYNQNDEKTSL  179



>dbj|BAD73317.1| hypothetical protein [Oryza sativa Japonica Group]
Length=192

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 124/187 (66%), Gaps = 17/187 (9%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASL-----------------EYISRTKERIKEGLGMRRPWREMFNF  169
            M+ YGTIPTSSS+ +S                  ++ SR K R    L  RRPWRE+ + 
Sbjct  1    MSKYGTIPTSSSSSSSGAAPPPLPLGGGGGASPLDFFSRAKARGATALATRRPWRELADP  60

Query  170  HSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLY  349
            H++GLP +  DA  R++ NLA++ MNYA+VVL ++FLSLLWHP SLIVF+  M AWL LY
Sbjct  61   HALGLPPSLADAYLRVRANLAHYAMNYAIVVLAVVFLSLLWHPASLIVFLVCMVAWLVLY  120

Query  350  FLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKT  529
            FLRDEP+++ GR++ D  VL  L+  T+VLLL T ATANI+ SLL+G ++V++H A  K 
Sbjct  121  FLRDEPIVLFGRVVGDGAVLAALAAVTLVLLLLTGATANIVSSLLIGVLLVVLHAALHKA  180

Query  530  DDLFADE  550
            ++   DE
Sbjct  181  EENVDDE  187



>ref|NP_001042294.2| Os01g0196500 [Oryza sativa Japonica Group]
 dbj|BAH01567.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54048.1| hypothetical protein OsJ_00736 [Oryza sativa Japonica Group]
 dbj|BAF04208.2| Os01g0196500 [Oryza sativa Japonica Group]
Length=201

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 124/187 (66%), Gaps = 17/187 (9%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASL-----------------EYISRTKERIKEGLGMRRPWREMFNF  169
            M+ YGTIPTSSS+ +S                  ++ SR K R    L  RRPWRE+ + 
Sbjct  1    MSKYGTIPTSSSSSSSGAAPPPLPLGGGGGASPLDFFSRAKARGATALATRRPWRELADP  60

Query  170  HSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLY  349
            H++GLP +  DA  R++ NLA++ MNYA+VVL ++FLSLLWHP SLIVF+  M AWL LY
Sbjct  61   HALGLPPSLADAYLRVRANLAHYAMNYAIVVLAVVFLSLLWHPASLIVFLVCMVAWLVLY  120

Query  350  FLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKT  529
            FLRDEP+++ GR++ D  VL  L+  T+VLLL T ATANI+ SLL+G ++V++H A  K 
Sbjct  121  FLRDEPIVLFGRVVGDGAVLAALAAVTLVLLLLTGATANIVSSLLIGVLLVVLHAALHKA  180

Query  530  DDLFADE  550
            ++   DE
Sbjct  181  EENVDDE  187



>gb|EAY96881.1| hypothetical protein OsI_18804 [Oryza sativa Indica Group]
Length=242

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 113/169 (67%), Gaps = 2/169 (1%)
 Frame = +2

Query  89   LEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlv  268
            L++ISR K R    L  RRPWRE+ +  +  +P     A  R + NL +F MNYA+VVL 
Sbjct  75   LDFISRAKARGATALAERRPWRELADPRAASVPRGLGGAYRRARANLGHFSMNYAIVVLA  134

Query  269  ilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLF  448
            ++FLSLLWHP+SLIVF+A M AWLFLYFLRDEPL + GR + +  VL VLSV T+VLLL 
Sbjct  135  VVFLSLLWHPVSLIVFLACMVAWLFLYFLRDEPLALCGRAVGEGAVLAVLSVLTLVLLLL  194

Query  449  TNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFLAGHAPSAPS  595
            T AT NIL SLLVG V+VL+H  F +  D   DEE+G +     P  PS
Sbjct  195  TGATVNILTSLLVGVVIVLLHAVFHRPADSI-DEEAGRYYTP-VPPQPS  241



>ref|XP_010528804.1| PREDICTED: PRA1 family protein E-like [Tarenaya hassleriana]
Length=249

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 112/162 (69%), Gaps = 2/162 (1%)
 Frame = +2

Query  77   AGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAl  256
            +G ++  I+R K+  +  +   RPWRE+ +  S+ LP ++ +A++R++ NL YFR NYA 
Sbjct  67   SGTTVAMIARAKQTTQSVIATLRPWRELLDLSSLSLPYSYEEAMARVRHNLGYFRGNYAF  126

Query  257  vvlvilflsllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVAT  430
             VL ++FL L++HP S+I F+ +   W+ LY  RD  +P+ I GR+++D +VL VLS+ T
Sbjct  127  AVLAVVFLGLIYHPFSMIAFIVVFVGWILLYSSRDATDPISISGRVVDDWIVLGVLSLVT  186

Query  431  IVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEES  556
            ++ L++T+   N+L+SL+VG V+V  H AFR TDDLF DEES
Sbjct  187  VLALVYTDVGENVLVSLIVGLVIVGAHAAFRCTDDLFLDEES  228



>ref|XP_011471000.1| PREDICTED: PRA1 family protein F3-like, partial [Fragaria vesca 
subsp. vesca]
Length=146

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 102/148 (69%), Gaps = 11/148 (7%)
 Frame = +2

Query  146  PWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVAL  325
            PW+ MF+F S+  P  F D ++R++ N AYFRMNYA+VVL+ILFLSLLWH ISLI+ + +
Sbjct  9    PWKLMFDFRSLTFPHCFDDELTRLRYNAAYFRMNYAIVVLLILFLSLLWHLISLIILIVM  68

Query  326  MAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvl  505
            +AAWLFLYFLRDEPL++ G            +V  IVLL  T+AT NIL++LL+  VVV 
Sbjct  69   LAAWLFLYFLRDEPLVLFGS-----------TVVKIVLLFLTSATMNILVALLIAVVVVA  117

Query  506  vhgaFRKTDDLFADEESGAFLAGHAPSA  589
            VH   RKT DL  D+E+   + G A S+
Sbjct  118  VHAMLRKTKDLHVDKENARLMTGPAGSS  145



>ref|XP_004495288.1| PREDICTED: PRA1 family protein D-like [Cicer arietinum]
Length=188

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = +2

Query  140  RRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFV  319
            RRPW   F+  +   P +  +A  R+K NL +FR+NY  ++L ILFLSLLWHP+SLIVF+
Sbjct  25   RRPWDNFFSLQTFTTPYSIAEATHRLKRNLNHFRVNYTTILLFILFLSLLWHPLSLIVFL  84

Query  320  ALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavv  499
            A+ AAW FL+F R+ P++I+   I+DR++L  LS  T+V L+FT    N+L+S+LVGA V
Sbjct  85   AIFAAWFFLFFYRNHPVVILRCTIDDRILLAALSTLTVVALVFTGVWLNVLVSILVGAAV  144

Query  500  vlvhgaFRKTDDLFADE  550
            V++H AFR T+DL++DE
Sbjct  145  VVLHAAFRSTEDLYSDE  161



>gb|KEH42613.1| PRA1 family protein [Medicago truncatula]
Length=193

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 110/169 (65%), Gaps = 9/169 (5%)
 Frame = +2

Query  47   TYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTN  226
            TY ++P++S++          +         RRPW+  F+  S  LP +  +   RIK N
Sbjct  9    TYNSLPSTSTSP---------RATTPSNYPTRRPWQNFFSPQSFTLPHSLFETTLRIKRN  59

Query  227  LAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVV  406
            L +FR+NYA+++L ILFLSLL+HP+SLIVF+ + A W  L+F RD P+++    I+DR +
Sbjct  60   LNHFRINYAIIILFILFLSLLYHPLSLIVFLVVFAVWFLLFFFRDRPVVLFRFTIDDRFL  119

Query  407  LIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE  553
            L++LS  TIV L+FT    N+L+S+LVG+ VV++H AFR  DDL+ DEE
Sbjct  120  LVLLSTLTIVALVFTGVWLNVLVSVLVGSAVVVLHAAFRSIDDLYLDEE  168



>ref|XP_010459377.1| PREDICTED: PRA1 family protein F1-like [Camelina sativa]
Length=182

 Score =   112 bits (279),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 117/178 (66%), Gaps = 5/178 (3%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGA-SLEYISR--TKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            MTTYGT PT+ +  A  LEYI+R   +  +  GL  RRPW++M +  S   P      +S
Sbjct  1    MTTYGTNPTAPNDLAPKLEYITRGNNQHNVISGLATRRPWKQMLDLRSFNFPRKLATVIS  60

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            R++ N  YF+ NY +VVL  +FLSL+W+P SL++ +AL+ AWLFLYF+RDEPL +  R I
Sbjct  61   RVRANTVYFQTNYTIVVLFSVFLSLIWNPFSLLILLALLGAWLFLYFIRDEPLAVFDRDI  120

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF--ADEESG  559
            + R+VLI +SV T+ +L  T+A  NI ++++ G   VL H A RKT+DL+   DEE+ 
Sbjct  121  DHRIVLIFMSVLTLSILFLTDAKLNIAVAIVAGTAAVLSHAAVRKTEDLYHQNDEETS  178



>ref|XP_010433077.1| PREDICTED: PRA1 family protein C-like [Camelina sativa]
Length=189

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 110/174 (63%), Gaps = 3/174 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIP+ ++  +SL  + R KE I  GL  +RPW E+    +  LP +F  A  RIK
Sbjct  1    MTTYGTIPSQANTSSSLSLVGRAKELISLGLSSQRPWLELVQCSAFSLPVSFSVATERIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+  FR NY ++ +V +F+S+LW P+ L VF  L+ AW+++Y   +EP +I G +++D 
Sbjct  61   TNIMIFRTNYIIIFIVSIFISMLWQPVHLSVFFILIVAWIYVYSRDNEPWVIFGNMVDDS  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFA---DEE  553
             +++VL V TI + L T+ +  I+I ++ G  VVLVHG  R T+ LF    DEE
Sbjct  121  NLVLVLLVLTIGIFLLTDVSRGIMIGVMAGLPVVLVHGMCRNTEMLFVLEDDEE  174



>ref|XP_010447827.1| PREDICTED: PRA1 family protein C-like [Camelina sativa]
Length=189

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 111/174 (64%), Gaps = 3/174 (2%)
 Frame = +2

Query  41   MTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIK  220
            MTTYGTIP+ ++A +SL  + R KE I  GL  +RPW E+    +  LP +F  A  RIK
Sbjct  1    MTTYGTIPSQANASSSLSLLGRAKELISLGLSSQRPWLELVQCSAFSLPLSFSVATERIK  60

Query  221  TNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDR  400
            TN+  FR NY ++ +V +F+S+LW P+ L VF  L+ AW+++Y   +EP +I G +I+D 
Sbjct  61   TNIMIFRTNYIIIFIVSIFISMLWQPVHLSVFFILILAWIYVYSRDNEPWVIFGNVIDDS  120

Query  401  VVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFA---DEE  553
             +++VL V TI + L T+ +  I+I ++ G  VVLVHG  R T+ LF    DEE
Sbjct  121  NLVLVLLVLTIGIFLLTDVSRGIMIGVMAGLPVVLVHGMCRNTEMLFVLEDDEE  174



>emb|CDX95035.1| BnaC05g06360D [Brassica napus]
Length=208

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 112/172 (65%), Gaps = 6/172 (3%)
 Frame = +2

Query  101  SRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            +R K+  +  +   RPWR + +  ++ LP ++++A++ ++ N++YFR NYAL VL I+FL
Sbjct  33   ARAKQTTQSVIATLRPWRMLLDLSALALPHSYNEAMANLRHNISYFRANYALAVLGIVFL  92

Query  281  sllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVATIVLLLFTN  454
             L++HPIS++ F+ +   W+  YF RD  +P+++ GR ++DR+VL VLSV T++ L++T+
Sbjct  93   GLVYHPISMVAFIVVFIGWILFYFSRDGNDPIVVSGREVDDRIVLGVLSVVTVLALVYTD  152

Query  455  ATANILISllvgavvvlvhgaFRKTDDLFADEES----GAFLAGHAPSAPSS  598
               N+L+SL+VG + V  H A R T DLF DEES    G   AG     P S
Sbjct  153  VGENVLVSLVVGLLFVGAHAAVRNTGDLFLDEESARQGGIVSAGSVNRGPGS  204



>gb|EPS67895.1| hypothetical protein M569_06879, partial [Genlisea aurea]
Length=151

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  140  RRPWREMFNF-HSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVF  316
            RRPWRE+ +   S  +P    +A  RIK NLA+FR+NY ++ L+ILFLSLL+HPIS+IVF
Sbjct  7    RRPWRELLSHPSSYSIPYALGEAAFRIKFNLAHFRVNYTMIALLILFLSLLYHPISMIVF  66

Query  317  VALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgav  496
            +A+ A WL LY  RDEP+ +  R +NDR V IVL + T+  L+ T    N+L++LL+  +
Sbjct  67   LAVFALWLLLYLSRDEPITLCSRTVNDRAVSIVLGILTVASLILTGVWLNVLVALLIAGL  126

Query  497  vvlvhgaFRKTDDLFADEE  553
            +V++H AFR T+DLF DE+
Sbjct  127  IVVLHSAFRVTEDLFLDED  145



>ref|XP_010038888.1| PREDICTED: PRA1 family protein E-like [Eucalyptus grandis]
 gb|KCW84678.1| hypothetical protein EUGRSUZ_B01496 [Eucalyptus grandis]
Length=187

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 112/167 (67%), Gaps = 3/167 (2%)
 Frame = +2

Query  62   PTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFR  241
            P + ++ A+   + R  +        RRPW + F+  S+  P +  +A +RI+ NL YFR
Sbjct  5    PFADTSTATARLMPRAGQSF---FATRRPWPQFFSLPSLSRPYSLGEAGARIRRNLDYFR  61

Query  242  MNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLS  421
            +NY ++ L ILFLSLLWHP+S+IVF+ +  AW +LYF RDEPL+++GR ++DR+VL  L+
Sbjct  62   VNYTMIALGILFLSLLWHPVSMIVFLVVFVAWFYLYFFRDEPLVLLGRTVDDRLVLGFLA  121

Query  422  VATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            V T+V L+ T+   N+L+S+L+GA VV VH  FR TDDL+ DE+   
Sbjct  122  VVTVVALVLTSVWLNVLVSVLIGAFVVAVHATFRGTDDLYVDEQDAG  168



>ref|XP_009367738.1| PREDICTED: PRA1 family protein F2-like [Pyrus x bretschneideri]
Length=196

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 120/180 (67%), Gaps = 7/180 (4%)
 Frame = +2

Query  26   NSPENMTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFN-FHSIGLPSNFHD  202
            +SP +   YGT P +++   S E  SR +   +     RRPW E+     S   P  F +
Sbjct  4    DSPPH---YGTHPPTTT---SPEPFSRARTTTQAFFATRRPWLELVQPLSSFTRPYPFGE  57

Query  203  AVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVG  382
            A  RIK NL +F +NY ++VL +LFLSLLW P+SLIVF+ +  AW FLYF RDEPL+I  
Sbjct  58   ATVRIKRNLGHFSVNYTMLVLFVLFLSLLWPPVSLIVFLFVFIAWFFLYFFRDEPLVIFH  117

Query  383  RLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            R+++DRVVL +L+V T+V L+FT+   N+L+S+LVGA +V +H AFR T+DL+ADE+  A
Sbjct  118  RIVDDRVVLGILAVVTVVALVFTHVWLNVLVSILVGAAIVGLHAAFRGTEDLYADEQEAA  177



>ref|XP_004230088.1| PREDICTED: PRA1 family protein F3 [Solanum lycopersicum]
Length=218

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 120/197 (61%), Gaps = 24/197 (12%)
 Frame = +2

Query  38   NMTTYGTIPTSSSAGAS----------------------LEYISRTKERIKEGLGMRRPW  151
            N++ YGT+PTS+   +                        +   RT    +     RR W
Sbjct  6    NLSNYGTLPTSTPPASPQTTPHSARKPPRPPLPRPPQPQPQPPVRTSTVTRSDPATRRSW  65

Query  152  REMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMA  331
            R  F+++ + LP N+ +A++R++ NL YFR+NYA+++LVILF+SL++HPIS+IVF+A+  
Sbjct  66   RVFFDYNIMSLPYNYSEAITRVRRNLNYFRVNYAMIILVILFISLVYHPISMIVFLAISV  125

Query  332  AWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvh  511
            AW   Y+ R+E ++I G  ++DR+VL+ L + T+V L  T+   N+L++L++G  V+ +H
Sbjct  126  AW--FYYFREEAIVISGTQLDDRLVLVGLGLVTVVALALTHVGLNVLVALIIGFFVLGIH  183

Query  512  gaFRKTDDLFADEESGA  562
            GA R T+DLF DE   A
Sbjct  184  GALRGTEDLFLDENEAA  200



>ref|XP_006351632.1| PREDICTED: PRA1 family protein F3-like [Solanum tuberosum]
Length=176

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 109/155 (70%), Gaps = 1/155 (1%)
 Frame = +2

Query  101  SRTKERIKEGLGMRRPWREMFNF-HSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilf  277
            SR +         RRPWRE+     S  LP +  D  SR+K NL+YFR+NYA++VLVILF
Sbjct  10   SRARSGTLSFYARRRPWRELLTHPSSYTLPISVSDFASRVKRNLSYFRVNYAMIVLVILF  69

Query  278  lsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNA  457
            LSLLWHPIS+IVF+ +  AW FLYF RDEPL++  R+I+DR+VL+VL V T+V L+ T+ 
Sbjct  70   LSLLWHPISMIVFLIVSVAWFFLYFHRDEPLMVFNRMIDDRIVLVVLGVVTVVSLMLTHV  129

Query  458  TANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
              N+L+S++VG  ++ +H  FR T+DLF +E+  A
Sbjct  130  WLNVLVSIVVGIGLIFLHATFRITEDLFLEEDDAA  164



>ref|XP_011079997.1| PREDICTED: PRA1 family protein E-like [Sesamum indicum]
Length=193

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = +2

Query  104  RTKERIKEGLGMRRPWREMF-NFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilfl  280
            R K R +    MRRPWRE+  +  S  +P +F D  SR+K NL YFR+NYA++VL ILFL
Sbjct  28   RAKSRTQSLFAMRRPWRELLAHPASYSIPYSFSDFASRLKRNLGYFRVNYAMIVLFILFL  87

Query  281  sllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNAT  460
            SL++HPIS+IVF+ +   W  LYF RDEP+++  R ++DRVVLI L V TI  L+ T   
Sbjct  88   SLVYHPISMIVFLIVFLFWFLLYFFRDEPIVVFHRTVDDRVVLIALGVVTIASLVSTRVW  147

Query  461  ANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
             N+L+S+L+GA VV++H  FR T+DLF +E+  A
Sbjct  148  LNVLVSVLIGAAVVVLHATFRVTEDLFLNEDEVA  181



>ref|XP_007223565.1| hypothetical protein PRUPE_ppa012254mg [Prunus persica]
 gb|EMJ24764.1| hypothetical protein PRUPE_ppa012254mg [Prunus persica]
Length=178

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 107/158 (68%), Gaps = 0/158 (0%)
 Frame = +2

Query  98   ISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilf  277
            +S+ KE  +  +   RPW E+    ++ LPSN  +  +R+  NL +FR NY LV+L++LF
Sbjct  6    VSQVKEVSQSAIATLRPWGELLEPTALSLPSNLSEVTTRLAQNLTHFRSNYTLVLLIVLF  65

Query  278  lsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNA  457
            LSL++HP+S+IVF+ + AAWL LYF RD+PL + G  + DRVV+++L + T++ L+ T+ 
Sbjct  66   LSLIYHPVSIIVFLIIFAAWLVLYFSRDQPLEVFGFTVGDRVVMVILGLVTVLALVLTHV  125

Query  458  TANILISllvgavvvlvhgaFRKTDDLFADEESGAFLA  571
              N+++S+++G  +V +H  FR T+DL  D++   + A
Sbjct  126  WLNVVVSVVIGVALVSLHAVFRGTEDLVMDDQESPYGA  163



>ref|XP_011076644.1| PREDICTED: PRA1 family protein B1 [Sesamum indicum]
Length=212

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +2

Query  95   YISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvil  274
            ++SR    ++ G   RRPW E+ +  S   P +  +A SRI+ N +YFR+NY  ++ + L
Sbjct  28   FLSRLNATVRHGFSQRRPWLELLDRSSFSRPDSLAEAASRIRKNFSYFRINYISLLALSL  87

Query  275  flsllWHPISLIVFVALMAAWLFLYFLR--DEPLIIVGRLINDRVVLIVLSVATIVLLLF  448
              SLL HP SLIV  +L+AAWLFLY  R  D+P+++ GR  +DR VL +L V+TIV++  
Sbjct  88   AFSLLSHPFSLIVLSSLLAAWLFLYSFRPSDQPVVVAGRTFSDREVLGILVVSTIVVVFL  147

Query  449  TNATANILISllvgavvvlvhgaFRKTDDLFADEE  553
            T+  + ++ +LLVG  VV  HGAFR  +DLF DE+
Sbjct  148  TSVGSLLISALLVGLAVVCTHGAFRMPEDLFLDEQ  182



>gb|KJB38282.1| hypothetical protein B456_006G246200 [Gossypium raimondii]
Length=183

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 107/164 (65%), Gaps = 5/164 (3%)
 Frame = +2

Query  98   ISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilf  277
            IS  K   +    +RRPWR+ F+  ++ LPS+  DA +RI  NL +FR+NY L++L+ILF
Sbjct  5    ISGIKGTTQSLTALRRPWRDFFDISTVDLPSSTSDATTRIAQNLTHFRLNYTLILLLILF  64

Query  278  lsllWHPISLIVFVALMAAWLFLYFLRD--EPLIIVGRLINDRVVLIVLSVATIVLLLFT  451
            LSL++HP+SL+ F+ ++ AW FLYF RD  EP++I G  I+DR+V+  L   T+  L+ T
Sbjct  65   LSLIYHPLSLLTFLVILLAWFFLYFARDREEPVVIFGFFIDDRIVIAALFGLTVAGLVLT  124

Query  452  NATANILISllvgavvvlvhgaFRKTDDLFADE-ES--GAFLAG  574
                N+L++L VG   V++H   R TDDL  D+ ES  G  LAG
Sbjct  125  GVWVNVLVALAVGVGFVILHAGLRSTDDLVMDDLESPYGHVLAG  168



>ref|XP_009348289.1| PREDICTED: PRA1 family protein D [Pyrus x bretschneideri]
Length=178

 Score =   109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 111/168 (66%), Gaps = 4/168 (2%)
 Frame = +2

Query  98   ISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilf  277
            +S+ KE  +      RPW E+    ++ LPSN  DA +R+  NL +FR NYAL+ L++LF
Sbjct  6    VSQFKEATQSARATLRPWGELLEPTALRLPSNLSDATTRLVQNLTHFRSNYALIALIVLF  65

Query  278  lsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNA  457
            LSLL+HP S+IVF+ + AAWL LYFLRD+PL   G  + DRVV++ L++ T+V L+ T+ 
Sbjct  66   LSLLYHPFSIIVFLIVFAAWLVLYFLRDQPLEGFGFAVPDRVVMVFLALVTVVALVLTHV  125

Query  458  TANILISllvgavvvlvhgaFRKTDDLFADEES---GAFLAGHA-PSA  589
              N+++S ++G V++ +H  FR T+DL  D++    GA L+  A PS 
Sbjct  126  WLNVIVSGVIGVVLIGLHTVFRGTEDLVMDDQESPYGALLSDDADPSG  173



>ref|XP_004288430.1| PREDICTED: PRA1 family protein D-like [Fragaria vesca subsp. 
vesca]
 ref|XP_004288431.1| PREDICTED: PRA1 family protein D-like [Fragaria vesca subsp. 
vesca]
Length=178

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 111/161 (69%), Gaps = 3/161 (2%)
 Frame = +2

Query  98   ISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilf  277
            ++R KE  +  +   RPW E  +  ++ LP NF DA +R+  N  +FR NYA++VLV+LF
Sbjct  6    VTRFKEAGQSAMAAHRPWSEFSDLSALSLPQNFSDATTRLFQNSTHFRSNYAMLVLVVLF  65

Query  278  lsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNA  457
            LSLL+HP+SLIVF+ + AAW+F YF RD+ + + G ++ DRVV+ VL + T+V L+ TN 
Sbjct  66   LSLLYHPVSLIVFLLVFAAWVFFYFSRDDDVSVFGFVVGDRVVMAVLGLVTVVALVLTNV  125

Query  458  TANILISllvgavvvlvhgaFRKTDDL-FADEES--GAFLA  571
              N+++S +VGAVVV VH  FR T+DL   D+ES  GA L+
Sbjct  126  WLNVVVSGVVGAVVVCVHAVFRGTEDLVMEDKESPYGALLS  166



>ref|XP_010543179.1| PREDICTED: PRA1 family protein B5 [Tarenaya hassleriana]
 ref|XP_010543181.1| PREDICTED: PRA1 family protein B5 [Tarenaya hassleriana]
Length=216

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 110/186 (59%), Gaps = 9/186 (5%)
 Frame = +2

Query  65   TSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRM  244
            T S   ++L  +SR  E I+ GL  RRPW E+ +  +   P +  DA +R + N +YFR+
Sbjct  27   TESQPQSTLAVVSRVAESIRSGLSRRRPWTELVDRSAFARPESLSDAANRFRKNYSYFRV  86

Query  245  NYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLR--DEPLIIVGRLINDRVVLIVL  418
            NYA VV + +  SL  HP SL V + ++A+W+FLY  R  D+PL++ GR  ++R  L  L
Sbjct  87   NYACVVALTVAFSLFNHPFSLFVLLFIVASWMFLYLFRPSDQPLVLFGRTFSERETLGGL  146

Query  419  SVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAFL-------AGH  577
             + +I L+  T+  + ++ +++VG   V VHGAFR TDDLF +E+  A +       AG 
Sbjct  147  ILTSIFLIFLTSVGSVLISAVMVGVAAVCVHGAFRVTDDLFLEEQDPAAMGFLSLLGAGA  206

Query  578  APSAPS  595
             P+ P+
Sbjct  207  TPAYPA  212



>ref|XP_006347739.1| PREDICTED: PRA1 family protein E-like [Solanum tuberosum]
Length=215

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 118/194 (61%), Gaps = 21/194 (11%)
 Frame = +2

Query  38   NMTTYGTIPTSSSAGASLEYISRTKERI-------------------KEGLGMRRPWREM  160
            N++ YGT+PTS+   +        ++                     +     RR WR  
Sbjct  6    NLSNYGTLPTSTPPESPQTTPHSARKPPRPPLPRPPQPQPPRPSTVTRSDTATRRSWRVF  65

Query  161  FNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWL  340
            F++  I LP N+ +A+ R++ NL YFR+NYA+V+LVILFLSL++HPIS+IVF+A+  AW 
Sbjct  66   FDYTIISLPYNYSEAIIRVRRNLNYFRVNYAMVILVILFLSLVYHPISMIVFLAISVAW-  124

Query  341  FLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaF  520
             LY+ R+E ++I G  ++DR+VL+ L + T+V L  T+   N+L++L++G  V+ +HGA 
Sbjct  125  -LYYFREEAIVISGTQLDDRLVLVGLGLVTVVALALTHVGLNVLVALIIGFFVLGIHGAL  183

Query  521  RKTDDLFADEESGA  562
            R T+DLF DE   A
Sbjct  184  RGTEDLFLDENEAA  197



>ref|XP_011087386.1| PREDICTED: PRA1 family protein E [Sesamum indicum]
Length=179

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 121/173 (70%), Gaps = 9/173 (5%)
 Frame = +2

Query  44   TTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKT  223
            + YG +P+     A  + +SR +         RRPWR  F+  +  LP ++ +A+SRI+ 
Sbjct  7    SPYGALPS-----AKPQLVSRARSL----YAARRPWRLFFDISAFSLPFSYAEAMSRIRQ  57

Query  224  NLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRV  403
            N  +FR+NYAL+VL ILF SL++HPIS+IVF+ +  AW+ LYF R++PL++ GR+++DRV
Sbjct  58   NFNHFRVNYALIVLTILFCSLVYHPISMIVFLVVSIAWISLYFSREDPLLLFGRIVDDRV  117

Query  404  VLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGA  562
            VL+VLS+ T+V L+FT+   N+L++L+VG V++ VH AFR T+DLF DE   A
Sbjct  118  VLLVLSLVTVVALVFTHVGLNVLVALIVGVVLIGVHAAFRGTEDLFLDESEAA  170



>ref|XP_008218278.1| PREDICTED: PRA1 family protein E [Prunus mume]
Length=214

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 125/185 (68%), Gaps = 14/185 (8%)
 Frame = +2

Query  50   YGTI----PTSSSAGASLEYISRTKERIKEGL----------GMRRPWREMFNFHSIGLP  187
            YGTI    P +      L + SR   +  + +            RRPW E+F+  S  +P
Sbjct  9    YGTITAANPAAVQTSKDLTFTSRANPQTSQPVYPARISQSVYPTRRPWPELFSLTSFSVP  68

Query  188  SNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEP  367
             N+ DA++RIK N++YFR+NYA+VVL+I+FLSLLWHP+S+IVF+ ++ AWL LYF R  P
Sbjct  69   YNYADAMARIKHNISYFRVNYAMVVLLIVFLSLLWHPVSMIVFLIVLVAWLALYFFRTGP  128

Query  368  LIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFAD  547
            +++  +  +DR+V++VLS+ T+V L+FT+   N+L+SL+VG VVV +H AFR T+DLF D
Sbjct  129  VVLFNQSFDDRLVVVVLSLVTVVALVFTHVGLNVLVSLIVGVVVVGLHAAFRVTEDLFLD  188

Query  548  EESGA  562
            EE+ A
Sbjct  189  EETAA  193



>ref|XP_009614805.1| PREDICTED: PRA1 family protein E-like [Nicotiana tomentosiformis]
Length=206

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 104/141 (74%), Gaps = 2/141 (1%)
 Frame = +2

Query  140  RRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFV  319
            RRPWR  F++    LP N+ +A+SR++ NL YFR+NYA+V+L+I+FLSL+++PIS+IVF+
Sbjct  59   RRPWRVFFDYTLFSLPYNYSEAISRVRRNLNYFRVNYAMVILLIIFLSLIYNPISMIVFL  118

Query  320  ALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavv  499
             +  AW  LY+  +EP++I+G  ++DR+VL+ L + T++ L FT+   N+L++L++G  V
Sbjct  119  VVSIAW--LYYFSEEPIVILGAHLDDRLVLVGLGLVTVIALAFTHVGLNVLVALIIGFCV  176

Query  500  vlvhgaFRKTDDLFADEESGA  562
            + +HG+ R T DLF DE   A
Sbjct  177  LGLHGSLRGTGDLFLDENEAA  197



>ref|XP_006489511.1| PREDICTED: PRA1 family protein D-like [Citrus sinensis]
Length=188

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 108/166 (65%), Gaps = 0/166 (0%)
 Frame = +2

Query  68   SSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMN  247
            S +A +   ++SR K   +     RRPW +  +  +  LP +  DA +RI  NL +FR N
Sbjct  2    SFTAASDTGFLSRVKRTTQSINATRRPWSDFLDLSAFNLPLSLSDATTRITQNLTHFRSN  61

Query  248  YAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLINDRVVLIVLSVA  427
            YA++ L+ LFLSL++HP+S+IVF+  + AW FLYF RD+PL ++G  ++DRVV+  L   
Sbjct  62   YAVITLLALFLSLIYHPVSIIVFLLTLVAWFFLYFARDDPLTVLGFQVDDRVVIGALFAV  121

Query  428  TIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEESGAF  565
            T+  L+ T+   N+L+S++VGAV+V++H  FR TDDL  D++   F
Sbjct  122  TVTGLVLTHVWVNVLVSVVVGAVLVILHAWFRSTDDLVMDDQESPF  167



>gb|KJB44891.1| hypothetical protein B456_007G278100 [Gossypium raimondii]
Length=187

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 116/193 (60%), Gaps = 16/193 (8%)
 Frame = +2

Query  32   PENMTTYGTIPTSSSAGASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVS  211
            P   TTYGTI ++ +      + S  K         RRPW E+F+  S  LP +  DA +
Sbjct  2    PPTSTTYGTITSNPTT-----FPSHAKH-------TRRPWPELFSLSSFCLPISAGDAKA  49

Query  212  RIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGRLI  391
            RIK NL+YFR+NY ++ L ILFL+LLWHP S+IVF+     W FLY   D P++I  R +
Sbjct  50   RIKLNLSYFRVNYVIIALTILFLTLLWHPTSMIVFLITFIFWWFLYLFNDNPVVIFNRPV  109

Query  392  NDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLF--ADEESGAF  565
            +  VVL VLS AT++LL+ T+   N+L+ L++G VVV +H AFR T+DL    +EE    
Sbjct  110  DGNVVLGVLSFATVLLLVLTHVGINVLVGLIIGVVVVGIHAAFRGTEDLGFPGEEEENGL  169

Query  566  LA--GHAPSAPSS  598
            L+  G  P  P+S
Sbjct  170  LSVVGSQPLRPTS  182



>ref|XP_006828134.1| hypothetical protein AMTR_s00023p00056460 [Amborella trichopoda]
 gb|ERM95550.1| hypothetical protein AMTR_s00023p00056460 [Amborella trichopoda]
Length=200

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 108/184 (59%), Gaps = 7/184 (4%)
 Frame = +2

Query  41   MTTYGTIPTSSSAG-----ASLEYISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDA  205
            M T   +P S         A+  + +R  +  +  L  RRPW E+ + + +  P    +A
Sbjct  1    MATQSPLPVSQGTAIATTPAARAFFARLSDGARASLAQRRPWMELLDRNQLSKPDTLSEA  60

Query  206  VSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEPLIIVGR  385
             +RI+ N  YFR+NY +++   L +SL+ HP+SL + V L+A W+FLYF R EPLI+  R
Sbjct  61   TARIRKNWTYFRINYLILLCGALAISLVSHPVSLFMLVCLLAGWIFLYFFRTEPLILFNR  120

Query  386  LINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFADEE--SG  559
              +DR VL ++ + T++++  T+  + ++ +L+ G  +V  HGAFR  +DLF DE+  SG
Sbjct  121  SFSDREVLGIMVLLTVIVVFLTSVGSLLISALMFGLAIVCAHGAFRVPEDLFLDEQESSG  180

Query  560  AFLA  571
             FL+
Sbjct  181  GFLS  184



>ref|XP_007205894.1| hypothetical protein PRUPE_ppa011351mg [Prunus persica]
 gb|EMJ07093.1| hypothetical protein PRUPE_ppa011351mg [Prunus persica]
Length=214

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 123/184 (67%), Gaps = 14/184 (8%)
 Frame = +2

Query  50   YGTI----PTSSSAGASLEYISRTKERIKEGL----------GMRRPWREMFNFHSIGLP  187
            YGTI    P ++     L + SR   +  + +            RRPW E+F+  S  +P
Sbjct  9    YGTITATNPAAAQTSKDLTFTSRANPQTSQPVHPARISQSVYPTRRPWPELFSLTSFSVP  68

Query  188  SNFHDAVSRIKTNLAYFRMNYAlvvlvilflsllWHPISLIVFVALMAAWLFLYFLRDEP  367
             N+ DA++RIK N+ YFR+NYA+ VL+I+FLSLLWHP+S+IVF+ ++ AWL LYF R  P
Sbjct  69   YNYADAMARIKHNIGYFRVNYAMAVLLIVFLSLLWHPVSMIVFLIVLVAWLALYFFRTGP  128

Query  368  LIIVGRLINDRVVLIVLSVATIVLLLFTNATANILISllvgavvvlvhgaFRKTDDLFAD  547
            +++  +  +DR+V++VLS+ T+V L+FT+   N+L+SL+VG VVV +H AFR T+DLF D
Sbjct  129  VVLFNQSFDDRLVVVVLSLVTVVALVFTHVGLNVLVSLIVGVVVVGLHAAFRVTEDLFLD  188

Query  548  EESG  559
            EE+ 
Sbjct  189  EETA  192



>ref|XP_008369306.1| PREDICTED: PRA1 family protein B1-like [Malus domestica]
Length=211

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 105/174 (60%), Gaps = 10/174 (6%)
 Frame = +2

Query  95   YISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvil  274
            +ISR    ++ G   RRPW E+ +  ++  P +  DA SRI+ N  YFR+NY  ++ ++L
Sbjct  32   FISRLSSSVRNGFSQRRPWYELVDRSALARPDSLTDAYSRIRKNFTYFRVNYVSLLTLVL  91

Query  275  flsllWHPISLIVFVALMAAWLFLYFLR--DEPLIIVGRLINDRVVLIVLSVATIVLLLF  448
             LSLL HP SLIV ++L+ AW FLY  R  D+PL+I+GR  +D   LI L V T+V ++F
Sbjct  92   ALSLLTHPFSLIVLLSLLGAWAFLYLFRASDQPLVILGRTFSDAETLIGLVVLTVV-VIF  150

Query  449  TNATANILISllvgavvvlvh-gaFRKTDDLFADEESGA------FLAGHAPSA  589
             ++  ++LIS L+    ++   GAFR  DDLF D++  A      FL G   SA
Sbjct  151  MSSVGSLLISGLLIGFAIVCAHGAFRVPDDLFLDDQEPANAGFLSFLGGATSSA  204



>ref|XP_004249063.1| PREDICTED: PRA1 family protein B4-like [Solanum lycopersicum]
Length=224

 Score =   108 bits (271),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 107/173 (62%), Gaps = 8/173 (5%)
 Frame = +2

Query  95   YISRTKERIKEGLGMRRPWREMFNFHSIGLPSNFHDAVSRIKTNLAYFRMNYAlvvlvil  274
            +I+R  E ++ GL  RRPW E+ +  +   P +  DA  RI+ N +YFR NY  ++ V+L
Sbjct  43   FINRISETVQGGLSNRRPWAELVDRSAFAKPESVSDATLRIRKNYSYFRTNYLSLLAVVL  102

Query  275  flsllWHPISLIVFVALMAAWLFLYFLR--DEPLIIVGRLINDRVVLIVLSVATIVLLLF  448
              SL+ +P SLI+   L+AAWLFLY  R  D PL++ GR  ++R  L VL V+T+V++  
Sbjct  103  AFSLITNPFSLILLTGLLAAWLFLYLFRPSDPPLVLFGRQFSERETLGVLIVSTVVVIFL  162

Query  449  TNATANILISllvgavvvlvhgaFRKTDDLFADEESG------AFLAGHAPSA  589
            T+  + ++ +L++G  +V  H AFR  +DLF D++        +FLAG AP++
Sbjct  163  TSVGSVLVSALMIGLAIVCTHAAFRVPEDLFLDDQESPATGFLSFLAGAAPTS  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125