BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN041G04

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007027266.1|  Pre-mRNA splicing factor-related                   147   4e-41   
ref|XP_009591253.1|  PREDICTED: protein STABILIZED1                     152   1e-38   Nicotiana tomentosiformis
ref|XP_006357494.1|  PREDICTED: pre-mRNA-processing factor 6-like       151   4e-38   Solanum tuberosum [potatoes]
ref|XP_004243341.1|  PREDICTED: protein STABILIZED1                     151   4e-38   Solanum lycopersicum
gb|KHN27879.1|  Pre-mRNA-processing factor 6                            150   4e-38   Glycine soja [wild soybean]
gb|KHN36627.1|  Pre-mRNA-processing factor 6                            150   5e-38   Glycine soja [wild soybean]
ref|XP_003543338.1|  PREDICTED: pre-mRNA-processing factor 6-like       150   8e-38   Glycine max [soybeans]
ref|XP_003540356.1|  PREDICTED: pre-mRNA-processing factor 6-like       150   8e-38   Glycine max [soybeans]
ref|XP_006447348.1|  hypothetical protein CICLE_v10018370mg             150   1e-37   Citrus clementina [clementine]
ref|XP_009793994.1|  PREDICTED: LOW QUALITY PROTEIN: protein STAB...    149   1e-37   Nicotiana sylvestris
ref|XP_010685372.1|  PREDICTED: protein STABILIZED1                     148   4e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007043553.1|  Pre-mRNA splicing factor-related                   148   4e-37   
ref|XP_007149863.1|  hypothetical protein PHAVU_005G104900g             148   5e-37   Phaseolus vulgaris [French bean]
ref|XP_011085353.1|  PREDICTED: LOW QUALITY PROTEIN: protein STAB...    146   2e-36   
ref|XP_004514211.1|  PREDICTED: pre-mRNA-processing factor 6-like       146   2e-36   Cicer arietinum [garbanzo]
gb|KJB31690.1|  hypothetical protein B456_005G202800                    145   3e-36   Gossypium raimondii
ref|XP_009342654.1|  PREDICTED: protein STABILIZED1-like                145   3e-36   
dbj|BAD94780.1|  putative pre-mRNA splicing factor                      133   5e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CBI28774.3|  unnamed protein product                                143   8e-36   Vitis vinifera
ref|XP_011458494.1|  PREDICTED: LOW QUALITY PROTEIN: protein STAB...    144   1e-35   Fragaria vesca subsp. vesca
gb|EYU26151.1|  hypothetical protein MIMGU_mgv1a000662mg                144   1e-35   Erythranthe guttata [common monkey flower]
gb|AEY85031.1|  putative pre-mRNA splicing factor                       144   1e-35   Camellia sinensis [black tea]
ref|XP_009357821.1|  PREDICTED: protein STABILIZED1-like                144   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_010245311.1|  PREDICTED: protein STABILIZED1                     143   2e-35   Nelumbo nucifera [Indian lotus]
emb|CDP02726.1|  unnamed protein product                                143   3e-35   Coffea canephora [robusta coffee]
emb|CAN65423.1|  hypothetical protein VITISV_024588                     143   3e-35   Vitis vinifera
ref|XP_008342929.1|  PREDICTED: pre-mRNA-processing factor 6-like       143   3e-35   
ref|XP_002267416.1|  PREDICTED: protein STABILIZED1                     143   3e-35   Vitis vinifera
ref|XP_002517947.1|  pre-mRNA splicing factor, putative                 142   4e-35   Ricinus communis
ref|XP_011045503.1|  PREDICTED: protein STABILIZED1-like                142   5e-35   Populus euphratica
gb|ADN34237.1|  pre-mRNA splicing factor                                141   5e-35   Cucumis melo subsp. melo
gb|KDP24152.1|  hypothetical protein JCGZ_25809                         141   1e-34   Jatropha curcas
ref|XP_002319361.2|  hypothetical protein POPTR_0013s13900g             141   1e-34   
ref|XP_009797444.1|  PREDICTED: protein STABILIZED1-like isoform X3     141   1e-34   Nicotiana sylvestris
ref|XP_009797442.1|  PREDICTED: protein STABILIZED1-like isoform X1     141   1e-34   Nicotiana sylvestris
gb|EMT09961.1|  Pre-mRNA-processing factor 6                            141   1e-34   
ref|XP_008459779.1|  PREDICTED: pre-mRNA-processing factor 6            140   1e-34   Cucumis melo [Oriental melon]
gb|EMS45135.1|  Pre-mRNA-processing factor 6                            140   2e-34   Triticum urartu
ref|XP_004140515.1|  PREDICTED: pre-mRNA-processing factor 6-like       140   2e-34   Cucumis sativus [cucumbers]
gb|KEH23176.1|  pre-mRNA splicing factor-like protein                   140   2e-34   Medicago truncatula
gb|AEO72346.2|  Prp1 protein                                            139   3e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00717.1|  predicted protein                                      139   4e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002872777.1|  hypothetical protein ARALYDRAFT_490219             139   4e-34   
gb|EPS73075.1|  hypothetical protein M569_01676                         139   5e-34   Genlisea aurea
ref|XP_010099575.1|  Pre-mRNA-processing factor 6                       139   6e-34   Morus notabilis
ref|XP_009401680.1|  PREDICTED: protein STABILIZED1                     139   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010467412.1|  PREDICTED: protein STABILIZED1-like                137   1e-33   
gb|EMT02936.1|  Pre-mRNA-processing factor 6                            137   2e-33   
ref|XP_006279939.1|  hypothetical protein CARUB_v10025803mg             137   2e-33   
ref|XP_008229166.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    137   2e-33   
ref|XP_010431097.1|  PREDICTED: protein STABILIZED1-like                137   3e-33   
ref|XP_006286978.1|  hypothetical protein CARUB_v10000126mg             137   3e-33   
ref|XP_007214916.1|  hypothetical protein PRUPE_ppa000712mg             137   4e-33   Prunus persica
ref|XP_010455888.1|  PREDICTED: protein STABILIZED1                     136   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010422461.1|  PREDICTED: protein STABILIZED1-like                136   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010035719.1|  PREDICTED: protein STABILIZED1                     135   1e-32   Eucalyptus grandis [rose gum]
tpg|DAA55350.1|  TPA: hypothetical protein ZEAMMB73_415949              135   1e-32   
ref|NP_192252.1|  pre-mRNA-processing factor 6-like protein STA1        135   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008662633.1|  PREDICTED: pre-mRNA-processing factor 6-like       134   3e-32   Zea mays [maize]
ref|NP_001064969.1|  Os10g0498600                                       130   3e-32   
ref|XP_010918430.1|  PREDICTED: protein STABILIZED1                     134   3e-32   Elaeis guineensis
ref|NP_001172269.1|  Os01g0263600                                       125   5e-32   
ref|XP_008809401.1|  PREDICTED: protein STABILIZED1                     133   5e-32   
ref|XP_010234868.1|  PREDICTED: protein STABILIZED1                     133   8e-32   Brachypodium distachyon [annual false brome]
ref|XP_004982722.1|  PREDICTED: pre-mRNA-processing factor 6-like...    131   3e-31   Setaria italica
ref|XP_002442232.1|  hypothetical protein SORBIDRAFT_08g016670          131   3e-31   
emb|CDY21966.1|  BnaC09g00720D                                          130   4e-31   Brassica napus [oilseed rape]
gb|AAL58273.1|AC068923_15  putative pre-mRNA splicing factor            130   5e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51217.1|  hypothetical protein OsJ_32045                          130   5e-31   Oryza sativa Japonica Group [Japonica rice]
emb|CDY48561.1|  BnaA09g01570D                                          130   6e-31   Brassica napus [oilseed rape]
ref|XP_006662478.1|  PREDICTED: pre-mRNA-processing factor 6-like       130   6e-31   Oryza brachyantha
ref|XP_009121844.1|  PREDICTED: protein STABILIZED1                     130   7e-31   Brassica rapa
ref|XP_006396573.1|  hypothetical protein EUTSA_v10028386mg             130   1e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010522629.1|  PREDICTED: protein STABILIZED1                     129   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_007218131.1|  hypothetical protein PRUPE_ppa007130mg             125   2e-30   
gb|EMT28978.1|  Pre-mRNA-processing factor 6                            127   3e-30   
gb|EAZ11333.1|  hypothetical protein OsJ_01197                          126   2e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EAY73400.1|  hypothetical protein OsI_01280                          126   2e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_006442217.1|  hypothetical protein CICLE_v10018758mg             122   3e-28   
ref|XP_002866811.1|  hypothetical protein ARALYDRAFT_912309             122   4e-28   
ref|XP_007200323.1|  hypothetical protein PRUPE_ppa000851mg             122   5e-28   Prunus persica
ref|XP_003588705.1|  Pre-mRNA-processing factor                         119   3e-27   
ref|XP_006857690.1|  hypothetical protein AMTR_s00061p00165040          119   4e-27   Amborella trichopoda
ref|XP_009135950.1|  PREDICTED: protein STABILIZED1-like                116   1e-26   
ref|XP_001755087.1|  predicted protein                                  118   1e-26   
emb|CDX90885.1|  BnaA03g25650D                                          115   2e-26   
ref|XP_001776889.1|  predicted protein                                  116   3e-26   
emb|CDY48448.1|  BnaA08g11570D                                          113   4e-25   Brassica napus [oilseed rape]
ref|XP_002961912.1|  hypothetical protein SELMODRAFT_60593              113   5e-25   
ref|XP_009108789.1|  PREDICTED: protein STABILIZED1-like                113   5e-25   Brassica rapa
ref|XP_002971176.1|  hypothetical protein SELMODRAFT_172051             113   5e-25   Selaginella moellendorffii
ref|XP_005651161.1|  hypothetical protein COCSUDRAFT_27128              112   1e-24   Coccomyxa subellipsoidea C-169
emb|CDY28304.1|  BnaC03g66550D                                          107   4e-23   Brassica napus [oilseed rape]
ref|XP_002987607.1|  hypothetical protein SELMODRAFT_126394             105   4e-22   Selaginella moellendorffii
ref|XP_001692638.1|  splicing factor, component of the U4/U6-U5 s...    105   4e-22   Chlamydomonas reinhardtii
ref|XP_005850880.1|  hypothetical protein CHLNCDRAFT_34097              102   3e-21   Chlorella variabilis
ref|XP_002987646.1|  hypothetical protein SELMODRAFT_126445             102   3e-21   
ref|XP_002952457.1|  hypothetical protein VOLCADRAFT_62457              102   4e-21   Volvox carteri f. nagariensis
ref|XP_011399893.1|  Pre-mRNA-processing factor 6                       101   7e-21   Auxenochlorella protothecoides
ref|XP_004345122.1|  pre-mRNA splicing factor                           100   9e-21   Capsaspora owczarzaki ATCC 30864
gb|KIP06848.1|  hypothetical protein PHLGIDRAFT_72114                   100   1e-20   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_002440334.1|  hypothetical protein SORBIDRAFT_09g029846        92.4    1e-20   
ref|XP_003059661.1|  mRNA splicing protein                              100   2e-20   Micromonas pusilla CCMP1545
ref|XP_004336141.1|  pre-mRNA-splicing factor prp1, putative          93.6    3e-20   Acanthamoeba castellanii str. Neff
gb|EPT05134.1|  hypothetical protein FOMPIDRAFT_1155763               99.4    3e-20   Fomitopsis pinicola FP-58527 SS1
ref|XP_004211508.1|  PREDICTED: pre-mRNA-processing factor 6-like     95.9    3e-20   
ref|XP_007399273.1|  hypothetical protein PHACADRAFT_31805            97.1    2e-19   Phanerochaete carnosa HHB-10118-sp
ref|XP_007864021.1|  hypothetical protein GLOTRDRAFT_115025           96.3    4e-19   Gloeophyllum trabeum ATCC 11539
ref|XP_003050871.1|  predicted protein                                95.9    5e-19   [Nectria] haematococca mpVI 77-13-4
ref|XP_001422607.1|  predicted protein                                95.9    5e-19   Ostreococcus lucimarinus CCE9901
gb|ESA12445.1|  hypothetical protein GLOINDRAFT_323384                94.7    6e-19   
ref|XP_007928062.1|  hypothetical protein MYCFIDRAFT_72157            95.5    6e-19   Pseudocercospora fijiensis CIRAD86
gb|EXX58698.1|  Prp6p                                                 94.4    2e-18   Rhizophagus irregularis DAOM 197198w
ref|XP_009168850.1|  hypothetical protein T265_05545                  94.4    2e-18   Opisthorchis viverrini [Southeast Asian liver fluke]
dbj|GAD98637.1|  pre-mRNA-splicing factor prp1                        94.0    2e-18   Byssochlamys spectabilis No. 5
gb|KFY25220.1|  hypothetical protein V491_01858                       94.0    2e-18   Pseudogymnoascus sp. VKM F-3775
gb|KFY86443.1|  hypothetical protein V500_07632                       94.0    2e-18   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFY09690.1|  hypothetical protein V492_05381                       94.0    2e-18   Pseudogymnoascus sp. VKM F-4246
ref|XP_004339973.1|  PRP1 splicing factor, Nterminal/tetratricope...  94.0    2e-18   Acanthamoeba castellanii str. Neff
gb|KFH47477.1|  Pre-mRNA-splicing factor-like protein                 93.6    3e-18   Acremonium chrysogenum ATCC 11550
ref|XP_001215979.1|  conserved hypothetical protein                   93.6    3e-18   Aspergillus terreus NIH2624
ref|XP_006820857.1|  PREDICTED: pre-mRNA-processing factor 6-like     90.5    4e-18   Saccoglossus kowalevskii
dbj|GAA98462.1|  hypothetical protein E5Q_05148                       93.2    4e-18   Mixia osmundae IAM 14324
ref|XP_001654491.1|  AAEL010387-PA                                    93.2    4e-18   
dbj|GAA37598.2|  pre-mRNA-processing factor 6                         93.2    4e-18   Clonorchis sinensis [oriental liver fluke]
ref|XP_002541419.1|  conserved hypothetical protein                   93.2    4e-18   Uncinocarpus reesii 1704
gb|KFX90591.1|  hypothetical protein V490_06379                       92.8    4e-18   Pseudogymnoascus sp. VKM F-3557
gb|KFY33094.1|  hypothetical protein V495_08436                       92.8    4e-18   Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|EME42147.1|  hypothetical protein DOTSEDRAFT_154718                92.8    6e-18   Dothistroma septosporum NZE10
gb|EMD40178.1|  hypothetical protein CERSUDRAFT_112388                92.8    6e-18   Gelatoporia subvermispora B
gb|KFY56054.1|  hypothetical protein V497_06554                       92.8    6e-18   Pseudogymnoascus sp. VKM F-4516 (FW-969)
gb|KFA66994.1|  hypothetical protein S40285_06268                     92.8    6e-18   Stachybotrys chlorohalonata IBT 40285
gb|KFY26833.1|  hypothetical protein V493_03848                       92.8    6e-18   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|KFX95665.1|  hypothetical protein O988_05708                       92.8    6e-18   Pseudogymnoascus sp. VKM F-3808
gb|KFY62438.1|  hypothetical protein V496_04599                       92.4    6e-18   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|KFZ00816.1|  hypothetical protein V501_10443                       92.4    7e-18   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFY33702.1|  hypothetical protein V494_07399                       92.4    7e-18   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|KFY79538.1|  hypothetical protein V499_01470                       92.4    7e-18   Pseudogymnoascus sp. VKM F-103
gb|EWM28197.1|  pre-mrna-processing factor 6                          92.4    7e-18   Nannochloropsis gaditana
ref|XP_002623897.1|  pre-mRNA splicing factor prp1                    92.4    7e-18   Blastomyces gilchristii SLH14081
gb|EEH38074.2|  pre-mRNA-splicing factor prp1                         92.4    8e-18   Paracoccidioides lutzii Pb01
ref|XP_010759201.1|  hypothetical protein PADG_03832                  92.4    8e-18   Paracoccidioides brasiliensis Pb18
gb|EEH18937.1|  hypothetical protein PABG_01256                       92.4    8e-18   Paracoccidioides brasiliensis Pb03
emb|CBJ28499.1|  conserved unknown protein                            92.0    9e-18   Ectocarpus siliculosus
ref|XP_003661115.1|  hypothetical protein MYCTH_2057284               92.0    9e-18   Thermothelomyces thermophila ATCC 42464
gb|EIT73004.1|  HAT repeat protein                                    92.0    9e-18   Aspergillus oryzae 3.042
gb|ELR10680.1|  pre-mRNA-processing factor 6                          92.0    9e-18   Pseudogymnoascus destructans 20631-21
ref|XP_002382213.1|  mRNA splicing factor (Prp1/Zer1), putative       92.0    9e-18   Aspergillus flavus NRRL3357
ref|XP_001819214.1|  pre-mRNA-splicing factor prp1                    92.0    9e-18   Aspergillus oryzae RIB40
ref|XP_002564821.1|  Pc22g08050                                       92.0    1e-17   Penicillium rubens Wisconsin 54-1255
gb|EFQ29104.1|  PRP1 splicing factor                                  92.0    1e-17   Colletotrichum graminicola M1.001
gb|EMF12502.1|  mRNA splicing factor                                  92.0    1e-17   Sphaerulina musiva SO2202
ref|XP_008612817.1|  hypothetical protein SDRG_08701                  92.0    1e-17   Saprolegnia diclina VS20
gb|KDO29186.1|  hypothetical protein SPRG_05428                       92.0    1e-17   Saprolegnia parasitica CBS 223.65
gb|AAM11188.1|  LD43276p                                              86.3    1e-17   Drosophila melanogaster
ref|XP_009216412.1|  pre-mRNA-splicing factor prp1, variant           91.7    1e-17   Gaeumannomyces tritici R3-111a-1
gb|KEZ38670.1|  Pre-mRNA-splicing factor prp1                         91.7    1e-17   Scedosporium apiospermum
ref|XP_003726277.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  92.0    1e-17   
ref|XP_003648601.1|  hypothetical protein THITE_129437                91.7    1e-17   Thielavia terrestris NRRL 8126
gb|KIW10029.1|  hypothetical protein PV08_11805                       91.7    1e-17   Exophiala spinifera
gb|EJW87682.1|  pre-mRNA-splicing factor prp1                         91.3    1e-17   Wuchereria bancrofti [agent of lymphatic filariasis]
gb|KIW59212.1|  hypothetical protein PV05_03677                       91.3    1e-17   Exophiala xenobiotica
ref|XP_010075747.1|  PREDICTED: pre-mRNA-processing factor 6-like     86.3    1e-17   Pterocles gutturalis
gb|KDN61144.1|  putative PRP1 splicing factor                         91.7    1e-17   Colletotrichum sublineola
ref|XP_007909448.1|  PREDICTED: pre-mRNA-processing factor 6          91.7    1e-17   Callorhinchus milii [Australian ghost shark]
ref|XP_003144592.1|  U5 snRNP-associated protein                      91.7    2e-17   Loa loa
ref|XP_008299806.1|  PREDICTED: pre-mRNA-processing factor 6          91.7    2e-17   Stegastes partitus
ref|XP_007597771.1|  PRP1 splicing factor                             91.3    2e-17   
ref|XP_001866982.1|  pre-mRNA-splicing factor prp1                    91.3    2e-17   Culex quinquefasciatus
gb|ERG86119.1|  pre-mrna-processing factor 6                          91.3    2e-17   
ref|XP_009216411.1|  pre-mRNA-splicing factor prp1                    91.3    2e-17   Gaeumannomyces tritici R3-111a-1
ref|XP_003715425.1|  pre-mRNA-splicing factor prp1, variant           90.9    2e-17   Magnaporthe oryzae 70-15
gb|KEQ71907.1|  hypothetical protein M436DRAFT_49503                  91.3    2e-17   Aureobasidium namibiae CBS 147.97
gb|KFA45952.1|  hypothetical protein S40293_07315                     91.3    2e-17   Stachybotrys chartarum IBT 40293
gb|KEY72006.1|  hypothetical protein S7711_00026                      91.3    2e-17   Stachybotrys chartarum IBT 7711
ref|XP_002505391.1|  mRNA splicing protein                            91.3    2e-17   Micromonas commoda
ref|XP_003236211.1|  pre-mRNA splicing factor prp1                    90.9    2e-17   Trichophyton rubrum CBS 118892
gb|EGE03398.1|  pre-mRNA splicing factor                              90.9    2e-17   Trichophyton equinum CBS 127.97
gb|KGO71586.1|  RNA-processing protein, HAT helix                     90.9    2e-17   Penicillium italicum
ref|XP_003715426.1|  pre-mRNA-splicing factor prp1                    90.9    2e-17   Magnaporthe oryzae 70-15
gb|EGD95302.1|  pre-mRNA splicing factor prp1                         90.9    2e-17   Trichophyton tonsurans CBS 112818
ref|XP_002846911.1|  pre-mRNA splicing factor                         90.9    2e-17   Microsporum canis CBS 113480
gb|EZF28793.1|  hypothetical protein H101_07519                       90.9    2e-17   Trichophyton interdigitale H6
emb|CCF45109.1|  PRP1 splicing factor                                 90.9    2e-17   Colletotrichum higginsianum
ref|XP_003019275.1|  hypothetical protein TRV_06679                   90.9    2e-17   Trichophyton verrucosum HKI 0517
ref|XP_003016780.1|  hypothetical protein ARB_05073                   90.9    3e-17   Trichophyton benhamiae CBS 112371
ref|XP_003174464.1|  hypothetical protein MGYG_01991                  90.5    3e-17   Nannizzia gypsea CBS 118893
ref|XP_001551631.1|  hypothetical protein BC1G_09798                  90.5    3e-17   Botrytis cinerea B05.10
gb|KEQ99567.1|  hypothetical protein AUEXF2481DRAFT_61627             90.5    3e-17   Aureobasidium subglaciale EXF-2481
ref|XP_001876543.1|  predicted protein                                90.5    3e-17   Laccaria bicolor S238N-H82
emb|CCD43254.1|  similar to pre-mRNA-splicing factor prp1             90.5    3e-17   Botrytis cinerea T4
gb|EER43431.1|  pre-mRNA splicing factor                              90.5    4e-17   Histoplasma capsulatum H143
ref|XP_002340974.1|  mRNA splicing factor (Prp1/Zer1), putative       90.5    4e-17   Talaromyces stipitatus ATCC 10500
gb|ETN61203.1|  pre-mrna splicing factor                              90.5    4e-17   Anopheles darlingi [American malaria mosquito]
emb|CDQ05274.1|  Protein BM-PRP-6, isoform f                          90.1    4e-17   Brugia malayi [agent of lymphatic filariasis]
gb|EEH11379.1|  pre-mRNA-splicing factor                              90.5    4e-17   Histoplasma capsulatum G186AR
ref|XP_002291151.1|  RNA splicing factor                              90.1    4e-17   Thalassiosira pseudonana CCMP1335
gb|KGO43527.1|  RNA-processing protein, HAT helix                     90.1    4e-17   Penicillium expansum
gb|EHK25524.1|  hypothetical protein TRIVIDRAFT_62198                 90.1    4e-17   Trichoderma virens Gv29-8
ref|XP_010749961.1|  PREDICTED: pre-mRNA-processing factor 6          90.1    5e-17   
ref|XP_006968422.1|  predicted protein                                90.1    5e-17   Trichoderma reesei QM6a
gb|KFM80330.1|  Pre-mRNA-processing factor 6                          86.7    5e-17   Stegodyphus mimosarum
ref|XP_008077401.1|  TPR-like protein                                 89.7    5e-17   Glarea lozoyensis ATCC 20868
dbj|GAM34034.1|  U4/U6 x U5 tri-snRNP complex subunit                 90.1    5e-17   Talaromyces cellulolyticus
gb|KIJ93573.1|  hypothetical protein K443DRAFT_684462                 89.7    5e-17   Laccaria amethystina LaAM-08-1
ref|XP_001891604.1|  U5 snRNP-associated 102 kDa protein              89.7    5e-17   Brugia malayi [agent of lymphatic filariasis]
emb|CBK23506.2|  unnamed protein product                              89.7    6e-17   Blastocystis hominis
ref|XP_008869866.1|  hypothetical protein H310_06535                  89.7    6e-17   Aphanomyces invadans
ref|XP_003439073.2|  PREDICTED: pre-mRNA-processing factor 6-like     89.7    6e-17   Oreochromis niloticus
ref|XP_007283846.1|  mRNA splicing factor (prp1 zer1)                 89.7    6e-17   
ref|XP_001219749.1|  hypothetical protein CHGG_00528                  89.7    6e-17   Chaetomium globosum CBS 148.51
ref|XP_004070553.1|  PREDICTED: pre-mRNA-processing factor 6          89.7    6e-17   Oryzias latipes [Japanese rice fish]
gb|EWZ90300.1|  hypothetical protein FOWG_07994                       89.7    6e-17   Fusarium oxysporum f. sp. lycopersici MN25
ref|XP_002144562.1|  mRNA splicing factor (Prp1/Zer1), putative       89.7    6e-17   Talaromyces marneffei ATCC 18224
gb|EHK39664.1|  hypothetical protein TRIATDRAFT_47890                 89.7    7e-17   Trichoderma atroviride IMI 206040
gb|EGU82876.1|  hypothetical protein FOXB_06679                       89.7    7e-17   Fusarium oxysporum Fo5176
gb|EMT63359.1|  Pre-mRNA-splicing factor prp1                         89.7    7e-17   Fusarium oxysporum f. sp. cubense race 4
gb|EWG40666.1|  hypothetical protein FVEG_02975                       89.7    7e-17   Fusarium verticillioides 7600
ref|XP_007912541.1|  putative pre-mrna-splicing factor prp1 protein   89.7    7e-17   Phaeoacremonium minimum UCRPA7
gb|KIZ07717.1|  putative Pre-mRNA-processing factor 6                 85.9    7e-17   Monoraphidium neglectum
dbj|GAM82021.1|  hypothetical protein ANO11243_000008                 89.4    7e-17   fungal sp. No.11243
ref|XP_008316164.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  89.4    7e-17   
gb|KEQ83272.1|  hypothetical protein M438DRAFT_356644                 89.4    8e-17   Aureobasidium pullulans EXF-150
gb|KIX03920.1|  hypothetical protein Z518_07473                       89.4    8e-17   Rhinocladiella mackenziei CBS 650.93
ref|XP_006462485.1|  hypothetical protein AGABI2DRAFT_193619          89.4    8e-17   Agaricus bisporus var. bisporus H97
gb|EQB58193.1|  PRP1 splicing factor                                  89.4    9e-17   Colletotrichum gloeosporioides Cg-14
gb|EKV04839.1|  MRNA splicing factor (Prp1/Zer1), putative            89.4    9e-17   Penicillium digitatum PHI26
ref|XP_002117163.1|  hypothetical protein TRIADDRAFT_51004            89.0    9e-17   Trichoplax adhaerens
ref|XP_007783240.1|  hypothetical protein W97_07420                   89.0    9e-17   Coniosporium apollinis CBS 100218
ref|XP_001593581.1|  hypothetical protein SS1G_05008                  89.0    9e-17   Sclerotinia sclerotiorum 1980 UF-70
gb|KEQ67970.1|  hypothetical protein M437DRAFT_35817                  89.0    1e-16   Aureobasidium melanogenum CBS 110374
gb|KIW41698.1|  hypothetical protein, variant                         88.6    1e-16   Exophiala oligosperma
ref|XP_011402481.1|  PREDICTED: pre-mRNA-processing factor 6-like     89.0    1e-16   Amphimedon queenslandica
ref|XP_006639651.1|  PREDICTED: pre-mRNA-processing factor 6-like     89.0    1e-16   
emb|CDH55389.1|  pre-mrna-processing factor 6                         89.0    1e-16   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005740593.1|  PREDICTED: pre-mRNA-processing factor 6-like     88.6    1e-16   
gb|EPE04968.1|  pre-mrna-splicing factor prp1                         88.6    1e-16   Ophiostoma piceae UAMH 11346
ref|XP_004546042.1|  PREDICTED: pre-mRNA-processing factor 6-like     88.6    1e-16   
gb|ERS99164.1|  hypothetical protein HMPREF1624_04360                 88.6    1e-16   Sporothrix schenckii ATCC 58251
ref|XP_006796391.1|  PREDICTED: pre-mRNA-processing factor 6-like     88.6    1e-16   Neolamprologus brichardi [lyretail cichlid]
emb|CDM36399.1|  Pre-mRNA-splicing factor prp1                        88.6    1e-16   Penicillium roqueforti FM164
ref|XP_007801510.1|  hypothetical protein EPUS_04223                  88.6    1e-16   Endocarpon pusillum Z07020
gb|EKC35667.1|  Pre-mRNA-processing factor 6                          86.7    1e-16   Crassostrea gigas
ref|XP_003374769.1|  Pre-mRNA-processing factor 6                     88.6    2e-16   Trichinella spiralis
gb|KIH94211.1|  pre-mRNA-processing factor 6                          88.6    2e-16   Sporothrix brasiliensis 5110
gb|KHN88451.1|  Pre-mRNA-processing factor 6                          88.6    2e-16   Toxocara canis
gb|KIN06332.1|  hypothetical protein OIDMADRAFT_112324                88.6    2e-16   Oidiodendron maius Zn
gb|KIW22129.1|  hypothetical protein PV07_12450                       88.2    2e-16   Cladophialophora immunda
ref|XP_007329932.1|  hypothetical protein AGABI1DRAFT_113788          88.2    2e-16   Agaricus bisporus var. burnettii JB137-S8
ref|XP_010777270.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  88.6    2e-16   Notothenia coriiceps [yellowbelly rockcod]
gb|KIW41697.1|  hypothetical protein PV06_07229                       88.2    2e-16   Exophiala oligosperma
dbj|GAN05126.1|  pre-mRNA-processing factor 6-like                    88.2    2e-16   Mucor ambiguus
ref|XP_003851965.1|  hypothetical protein MYCGRDRAFT_72776            88.2    2e-16   Zymoseptoria tritici IPO323
gb|KIX96441.1|  hypothetical protein Z520_07707                       88.2    2e-16   Fonsecaea multimorphosa CBS 102226
ref|XP_010874125.1|  PREDICTED: pre-mRNA-processing factor 6          88.2    2e-16   Esox lucius
emb|CCT68420.1|  probable pre-mRNA splicing factor prp1               88.2    2e-16   Fusarium fujikuroi IMI 58289
emb|CEJ91679.1|  Putative PRP1 splicing factor                        88.2    2e-16   Torrubiella hemipterigena
gb|EPS31237.1|  hypothetical protein PDE_06192                        88.2    2e-16   Penicillium oxalicum 114-2
ref|XP_001275225.1|  mRNA splicing factor (Prp1/Zer1), putative       87.8    2e-16   Aspergillus clavatus NRRL 1
ref|XP_008731009.1|  hypothetical protein G647_08476                  87.8    3e-16   Cladophialophora carrionii CBS 160.54
ref|XP_006665547.1|  pre-mRNA splicing factor                         87.8    3e-16   Cordyceps militaris CM01
gb|AAW24649.1|  SJCHGC09396 protein                                   86.7    3e-16   Schistosoma japonicum
gb|KIV92081.1|  hypothetical protein, variant 2                       87.4    3e-16   Exophiala mesophila
emb|CEI93859.1|  hypothetical protein RMCBS344292_08085               87.8    3e-16   Rhizopus microsporus
ref|XP_005801720.1|  PREDICTED: pre-mRNA-processing factor 6-like     87.8    3e-16   
ref|XP_008596733.1|  PRP1 splicing factor                             87.8    3e-16   Beauveria bassiana ARSEF 2860
emb|CEG81837.1|  Putative Pre-mRNA splicing factor prp1               87.0    3e-16   Rhizopus microsporus
ref|XP_001247216.1|  pre-mRNA splicing factor                         87.4    3e-16   Coccidioides immitis RS
ref|XP_006678543.1|  hypothetical protein BATDEDRAFT_29905            87.4    3e-16   Batrachochytrium dendrobatidis JAM81
emb|CDQ84134.1|  unnamed protein product                              87.4    3e-16   Oncorhynchus mykiss
ref|XP_003066140.1|  pre-mRNA-splicing factor prp1, putative          87.4    3e-16   Coccidioides posadasii C735 delta SOWgp
ref|XP_009161109.1|  hypothetical protein, variant                    87.4    3e-16   Exophiala dermatitidis NIH/UT8656
emb|CAG11265.1|  unnamed protein product                              87.4    4e-16   Tetraodon nigroviridis
emb|CCM03564.1|  predicted protein                                    87.4    4e-16   Fibroporia radiculosa
gb|KFP45705.1|  Pre-mRNA-processing factor 6                          86.3    4e-16   Chlamydotis macqueenii
gb|EAW75175.1|  chromosome 20 open reading frame 14, isoform CRA_b    86.7    4e-16   Homo sapiens [man]
ref|XP_010126560.1|  PREDICTED: pre-mRNA-processing factor 6          86.3    4e-16   Chlamydotis macqueenii
dbj|GAA84205.1|  mRNA splicing factor (Prp1/Zer1)                     87.4    4e-16   Aspergillus kawachii IFO 4308
ref|XP_002589073.1|  hypothetical protein BRAFLDRAFT_120892           87.4    4e-16   Branchiostoma floridae
emb|CCU75618.1|  pre-mRNA splicing factor                             87.4    4e-16   
gb|KIV92080.1|  hypothetical protein, variant 1                       87.4    4e-16   
ref|XP_001997359.1|  GH23803                                          87.4    4e-16   
emb|CEG68489.1|  hypothetical protein RMATCC62417_04740               87.4    4e-16   
ref|XP_007761984.1|  hypothetical protein A1O7_09809                  87.4    4e-16   
ref|XP_001400594.1|  pre-mRNA-splicing factor prp1                    87.4    4e-16   
gb|KIV92079.1|  hypothetical protein PV10_06548                       87.4    4e-16   
emb|CAB70695.1|  hypothetical protein                                 86.3    4e-16   
ref|XP_011424711.1|  PREDICTED: uncharacterized protein LOC105326398  87.4    4e-16   
ref|XP_010016636.1|  PREDICTED: pre-mRNA-processing factor 6          87.0    4e-16   
ref|XP_007839839.1|  Pre-mRNA-splicing factor prp1                    87.0    4e-16   
ref|XP_009161108.1|  hypothetical protein HMPREF1120_08599            87.0    4e-16   
ref|XP_680716.1|  hypothetical protein AN7447.2                       87.0    5e-16   
ref|XP_011394663.1|  pre-mRNA splicing factor, variant                86.7    5e-16   
gb|ESZ91559.1|  putative mRNA splicing factor (Prp1/Zer1)             87.0    5e-16   
emb|CDS07580.1|  hypothetical protein LRAMOSA01529                    87.0    5e-16   
gb|EPB84496.1|  hypothetical protein HMPREF1544_08732                 87.0    5e-16   
ref|XP_002095685.1|  GE19576                                          85.5    5e-16   
gb|EPQ61793.1|  Splicing factor component of the U4-U6-U5 snRNP c...  87.0    5e-16   
gb|KIW62718.1|  hypothetical protein PV04_10861                       86.7    5e-16   
ref|XP_002047585.1|  GJ11852                                          86.7    6e-16   
ref|XP_008994545.1|  PREDICTED: pre-mRNA-processing factor 6          86.7    6e-16   
gb|KIV83424.1|  hypothetical protein, variant 1                       86.3    6e-16   
ref|XP_001973282.1|  GG16015                                          86.7    6e-16   
ref|XP_011394664.1|  pre-mRNA splicing factor                         86.7    6e-16   
ref|XP_011170398.1|  PREDICTED: pre-mRNA-processing factor 6-like     84.7    6e-16   
ref|XP_001625285.1|  predicted protein                                86.7    6e-16   
emb|CEP09115.1|  hypothetical protein                                 86.7    6e-16   
ref|XP_008412127.1|  PREDICTED: pre-mRNA-processing factor 6          86.7    6e-16   
ref|XP_007734795.1|  hypothetical protein A1O3_06486                  86.7    7e-16   
ref|XP_010567787.1|  PREDICTED: pre-mRNA-processing factor 6          86.7    7e-16   
ref|XP_011151002.1|  PREDICTED: pre-mRNA-processing factor 6          86.7    7e-16   
ref|XP_009575883.1|  PREDICTED: pre-mRNA-processing factor 6          86.7    7e-16   
ref|XP_009325174.1|  PREDICTED: pre-mRNA-processing factor 6          86.7    7e-16   
ref|XP_007557713.1|  PREDICTED: pre-mRNA-processing factor 6          86.7    7e-16   
ref|XP_003345968.1|  hypothetical protein SMAC_06522                  86.7    7e-16   
ref|XP_010341579.1|  PREDICTED: pre-mRNA-processing factor 6          86.3    7e-16   
ref|XP_009512228.1|  PREDICTED: pre-mRNA-processing factor 6          86.3    8e-16   
gb|EKG21160.1|  RNA-processing protein HAT helix                      85.1    8e-16   
gb|KIK61680.1|  hypothetical protein GYMLUDRAFT_58738                 86.3    8e-16   
ref|XP_007795623.1|  putative mrna splicing factor (prp1 zer1) pr...  86.3    8e-16   
ref|XP_009649684.1|  pre-mRNA-splicing factor prp1                    86.3    8e-16   
ref|XP_007722982.1|  hypothetical protein A1O1_03892                  86.3    8e-16   
gb|KID98941.1|  PRP1 splicing factor                                  86.3    8e-16   
gb|KID87844.1|  PRP1 splicing factor                                  86.3    8e-16   
gb|EAW75177.1|  chromosome 20 open reading frame 14, isoform CRA_d    86.3    8e-16   
ref|XP_008718432.1|  hypothetical protein HMPREF1541_05873            86.3    8e-16   
ref|XP_010287290.1|  PREDICTED: pre-mRNA-processing factor 6          86.3    9e-16   
gb|KFQ67669.1|  Pre-mRNA-processing factor 6                          86.3    9e-16   
ref|XP_009435945.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  86.3    9e-16   
ref|XP_007524499.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  86.3    9e-16   
gb|KIV83423.1|  hypothetical protein PV11_05452                       86.3    9e-16   
gb|KGQ09769.1|  Pre-mRNA-splicing factor prp1                         86.3    9e-16   
ref|XP_002068166.1|  GK10384                                          86.3    9e-16   
ref|XP_007524498.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  86.3    9e-16   
gb|EAW75178.1|  chromosome 20 open reading frame 14, isoform CRA_e    86.3    9e-16   
ref|XP_001113447.2|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_007233071.1|  PREDICTED: pre-mRNA-processing factor 6-like     85.9    1e-15   
ref|XP_001260230.1|  mRNA splicing factor (Prp1/Zer1), putative       86.3    1e-15   
ref|XP_008019876.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_002085426.1|  GD14782                                          85.9    1e-15   
gb|AAD01798.1|  putative mitochondrial outer membrane protein imp...  85.9    1e-15   
ref|XP_002042635.1|  GM15004                                          85.9    1e-15   
dbj|BAG50938.1|  unnamed protein product                              85.9    1e-15   
ref|XP_005044943.1|  PREDICTED: pre-mRNA-processing factor 6-like     85.9    1e-15   
ref|XP_003280219.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  85.9    1e-15   
ref|XP_005240002.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_009900078.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_004062614.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  85.9    1e-15   
ref|XP_005569690.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|NP_649073.1|  CG6841                                              85.9    1e-15   
ref|XP_009931643.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_005491364.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_003280218.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  85.9    1e-15   
ref|NP_036601.2|  pre-mRNA-processing factor 6                        85.9    1e-15   
ref|XP_001152053.3|  PREDICTED: pre-mRNA-processing factor 6 isof...  85.9    1e-15   
dbj|BAG36962.1|  unnamed protein product                              85.9    1e-15   
ref|XP_009491956.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_010176712.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
gb|KFZ52735.1|  Pre-mRNA-processing factor 6                          85.9    1e-15   
ref|XP_009272205.1|  PREDICTED: pre-mRNA-processing factor 6          86.3    1e-15   
gb|KFW74778.1|  Pre-mRNA-processing factor 6                          85.9    1e-15   
ref|XP_009072246.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_004530580.1|  PREDICTED: pre-mRNA-processing factor 6-like     85.9    1e-15   
ref|XP_005422323.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_002197944.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_005524836.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
gb|KFZ67166.1|  Pre-mRNA-processing factor 6                          85.9    1e-15   
ref|XP_008944238.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_005057356.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_010135070.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  85.9    1e-15   
ref|XP_009864597.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
gb|KFQ99062.1|  Pre-mRNA-processing factor 6                          85.9    1e-15   
ref|XP_007584016.1|  putative mrna splicing factor (prp1 zer1) pr...  85.9    1e-15   
ref|XP_006723832.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  85.9    1e-15   
gb|KFP04021.1|  Pre-mRNA-processing factor 6                          85.9    1e-15   
ref|XP_008922828.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_011186388.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_009669925.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_010363595.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_008496174.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_011199499.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_010395389.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
ref|XP_009997015.1|  PREDICTED: pre-mRNA-processing factor 6          85.9    1e-15   
gb|KFV68328.1|  Pre-mRNA-processing factor 6                          85.9    1e-15   
gb|KGL81570.1|  Pre-mRNA-processing factor 6                          85.9    1e-15   
gb|KFV72907.1|  Pre-mRNA-processing factor 6                          85.9    1e-15   
ref|XP_002095677.1|  GE19580                                          85.9    1e-15   
ref|XP_007746150.1|  hypothetical protein A1O5_07371                  85.9    1e-15   
ref|XP_002008426.1|  GI13491                                          85.5    1e-15   
ref|XP_007346107.1|  hypothetical protein AURDEDRAFT_114005           85.5    1e-15   
ref|XP_010219146.1|  PREDICTED: pre-mRNA-processing factor 6          85.5    1e-15   
ref|XP_008634309.1|  PREDICTED: pre-mRNA-processing factor 6          85.5    1e-15   
gb|AAH05801.1|  Prpf6 protein                                         84.7    1e-15   
gb|KIL59658.1|  hypothetical protein M378DRAFT_14683                  85.5    1e-15   
ref|XP_009633092.1|  PREDICTED: pre-mRNA-processing factor 6          85.5    1e-15   
ref|XP_004282421.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  85.5    2e-15   
gb|KEF52217.1|  hypothetical protein A1O9_11844                       85.5    2e-15   
ref|XP_005146915.1|  PREDICTED: pre-mRNA-processing factor 6          85.5    2e-15   
ref|XP_004998404.1|  PRP6 pre-mRNA processing factor 6                85.5    2e-15   
emb|CCE32039.1|  probable pre-mRNA splicing factor prp1               85.5    2e-15   
ref|XP_004282420.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  85.5    2e-15   
gb|KFP29002.1|  Pre-mRNA-processing factor 6                          85.5    2e-15   
ref|XP_010193482.1|  PREDICTED: pre-mRNA-processing factor 6          85.5    2e-15   
ref|XP_004325264.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  85.5    2e-15   
ref|XP_007104018.1|  PREDICTED: pre-mRNA-processing factor 6          85.1    2e-15   
ref|XP_011331797.1|  PREDICTED: pre-mRNA-processing factor 6          85.5    2e-15   
ref|XP_003963386.1|  PREDICTED: pre-mRNA-processing factor 6-like     85.5    2e-15   
ref|XP_009891871.1|  PREDICTED: pre-mRNA-processing factor 6          85.5    2e-15   
ref|XP_009471707.1|  PREDICTED: pre-mRNA-processing factor 6          85.5    2e-15   
gb|ELV11349.1|  Pre-mRNA-processing factor 6                          85.5    2e-15   
ref|XP_006873392.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  85.1    2e-15   
ref|XP_006167182.1|  PREDICTED: pre-mRNA-processing factor 6          85.1    2e-15   
ref|XP_009049099.1|  hypothetical protein LOTGIDRAFT_141173           85.1    2e-15   
ref|XP_002026575.1|  GL21701                                          85.1    2e-15   
gb|EGW10560.1|  Pre-mRNA-processing factor 6                          84.3    2e-15   
gb|KIL96497.1|  pre-mrna-splicing factor prp1                         85.1    2e-15   
ref|XP_006873391.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  85.1    2e-15   
ref|XP_003757601.1|  PREDICTED: pre-mRNA-processing factor 6          85.1    2e-15   
ref|XP_009842686.1|  hypothetical protein H257_16064                  85.1    2e-15   
ref|XP_006132536.1|  PREDICTED: pre-mRNA-processing factor 6          85.1    2e-15   
ref|XP_001793637.1|  hypothetical protein SNOG_03048                  85.1    2e-15   
ref|XP_006695449.1|  pre-mRNA splicing factor prp1-like protein       85.1    2e-15   
ref|XP_004716112.1|  PREDICTED: pre-mRNA-processing factor 6          85.1    2e-15   
ref|XP_007062619.1|  PREDICTED: pre-mRNA-processing factor 6          85.1    2e-15   
ref|XP_009985480.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  85.1    2e-15   
ref|XP_001352910.2|  GA19898                                          85.1    2e-15   
ref|XP_001958184.1|  GF23653                                          85.1    2e-15   
emb|CEG02177.1|  Tetratricopeptide repeat                             85.1    2e-15   
gb|EYE93851.1|  hypothetical protein EURHEDRAFT_413847                85.1    2e-15   
ref|XP_007677008.1|  hypothetical protein BAUCODRAFT_71901            85.1    2e-15   
gb|EMP33297.1|  Pre-mRNA-processing factor 6                          85.1    2e-15   
ref|XP_003904514.1|  PREDICTED: pre-mRNA-processing factor 6          85.1    2e-15   
ref|XP_002128772.2|  PREDICTED: pre-mRNA-processing factor 6          85.1    2e-15   
ref|XP_009854843.1|  hypothetical protein NEUTE1DRAFT_88617           84.7    2e-15   
emb|CDW55092.1|  Pre mRNA processing factor 6                         85.1    2e-15   
ref|XP_009560968.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  84.7    2e-15   
ref|XP_003302030.1|  hypothetical protein PTT_13701                   84.7    2e-15   
ref|XP_009546139.1|  hypothetical protein HETIRDRAFT_383832           84.7    3e-15   
gb|KII86740.1|  hypothetical protein PLICRDRAFT_93409                 84.7    3e-15   
ref|XP_002414072.1|  pre-mRNA splicing factor, putative               84.7    3e-15   
gb|EOA93860.1|  Pre-mRNA-processing factor 6                          84.0    3e-15   
ref|XP_007309231.1|  hypothetical protein STEHIDRAFT_149847           84.7    3e-15   
ref|XP_005499760.1|  PREDICTED: pre-mRNA-processing factor 6          84.7    3e-15   
gb|EMC83474.1|  Pre-mRNA-processing factor 6                          84.7    3e-15   
ref|XP_006021718.1|  PREDICTED: pre-mRNA-processing factor 6          84.7    3e-15   
ref|XP_005309929.1|  PREDICTED: pre-mRNA-processing factor 6          84.7    3e-15   
ref|XP_007808922.1|  pre-mRNA-splicing factor prp1, putative          84.7    3e-15   
ref|XP_006273121.1|  PREDICTED: pre-mRNA-processing factor 6          84.7    3e-15   
ref|XP_003512405.2|  PREDICTED: pre-mRNA-processing factor 6 isof...  84.3    3e-15   
gb|KGB36525.1|  Pre-mRNA-processing factor 6                          84.7    3e-15   
ref|XP_005030258.1|  PREDICTED: pre-mRNA-processing factor 6-like     84.0    3e-15   
gb|EYC28110.1|  hypothetical protein Y032_0008g345                    83.6    3e-15   
gb|EFX80606.1|  hypothetical protein DAPPUDRAFT_303888                84.3    3e-15   
ref|XP_005095991.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  84.3    3e-15   
ref|XP_003691902.1|  PREDICTED: pre-mRNA-processing factor 6-like     84.3    3e-15   
ref|XP_003487820.1|  PREDICTED: pre-mRNA-processing factor 6-like     84.3    4e-15   
ref|XP_007380624.1|  hypothetical protein PUNSTDRAFT_118653           84.3    4e-15   
ref|XP_623891.2|  PREDICTED: pre-mRNA-processing factor 6-like        84.3    4e-15   
gb|KDR18974.1|  Pre-mRNA-processing factor 6                          84.3    4e-15   
ref|XP_006896967.1|  PREDICTED: pre-mRNA-processing factor 6          84.3    4e-15   
gb|KFD51604.1|  hypothetical protein M513_07483                       84.3    4e-15   
ref|XP_003083104.1|  putative pre-mRNA splicing factor (ISS)          84.7    4e-15   
ref|XP_006621619.1|  PREDICTED: pre-mRNA-processing factor 6-like     84.3    4e-15   
gb|KIO29724.1|  hypothetical protein M407DRAFT_14470                  84.0    4e-15   
ref|NP_001125315.1|  pre-mRNA-processing factor 6                     84.3    4e-15   
ref|XP_008841539.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  84.0    4e-15   
gb|KHJ41259.1|  tetratricopeptide repeat protein                      84.3    4e-15   
ref|XP_008841540.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  84.0    4e-15   
gb|KDR68393.1|  hypothetical protein GALMADRAFT_78691                 84.0    5e-15   
gb|EFX03542.1|  mRNA splicing factor                                  84.0    5e-15   
gb|KDB13762.1|  putative pre-mRNA-splicing factor prp1                84.0    5e-15   
emb|CDJ01474.1|  pre mRNA processing factor 6                         84.0    5e-15   
emb|CDS18417.1|  pre mRNA processing factor 6                         84.0    5e-15   
ref|XP_007296755.1|  pre-mRNA-splicing factor                         84.0    5e-15   
gb|KIW93338.1|  hypothetical protein Z519_05943                       84.0    5e-15   
ref|XP_007608741.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  84.0    5e-15   
gb|EUB62279.1|  Pre-mRNA-processing factor 6                          84.0    5e-15   
gb|KIW74101.1|  hypothetical protein Z517_12511                       84.0    5e-15   
ref|XP_004370209.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  84.0    5e-15   
ref|XP_005074613.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  84.0    5e-15   
ref|XP_005362727.1|  PREDICTED: pre-mRNA-processing factor 6          84.0    5e-15   
ref|NP_001073234.1|  pre-mRNA-processing factor 6                     84.0    5e-15   
ref|XP_005074612.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  84.0    5e-15   
ref|XP_004464990.1|  PREDICTED: pre-mRNA-processing factor 6          84.0    5e-15   
ref|NP_598462.1|  pre-mRNA-processing factor 6                        84.0    5e-15   
ref|XP_006994647.1|  PREDICTED: pre-mRNA-processing factor 6          84.0    5e-15   
ref|XP_007462288.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  84.0    5e-15   
ref|XP_008841538.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  84.0    5e-15   
ref|XP_004370208.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  84.0    5e-15   
dbj|BAE26451.1|  unnamed protein product                              84.0    6e-15   
gb|EYC28111.1|  hypothetical protein Y032_0008g345                    84.0    6e-15   
gb|KIH58717.1|  tetratricopeptide repeat protein                      84.0    6e-15   
ref|XP_007462289.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  83.6    6e-15   
ref|XP_315659.1|  AGAP005640-PA                                       83.6    6e-15   
gb|ENH81916.1|  pre-mRNA-splicing factor                              83.6    6e-15   
gb|ERE70722.1|  pre-mRNA-processing factor 6                          83.6    6e-15   
ref|XP_008250773.1|  PREDICTED: pre-mRNA-processing factor 6          83.6    7e-15   
gb|KHJ35160.1|  putative pre-mrna-splicing factor                     83.6    7e-15   
ref|XP_004586019.1|  PREDICTED: pre-mRNA-processing factor 6 isof...  83.6    7e-15   
ref|NP_001025642.1|  pre-mRNA processing factor 6                     83.6    7e-15   



>ref|XP_007027266.1| Pre-mRNA splicing factor-related [Theobroma cacao]
 gb|EOY07768.1| Pre-mRNA splicing factor-related [Theobroma cacao]
Length=116

 Score =   147 bits (370),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q GSE+ + DV+++CVAAEPKHGEKWQAI
Sbjct  22   KVDKARTWLNRAVTLAPDIGDFWALYYKFELQRGSEENQKDVMKRCVAAEPKHGEKWQAI  81

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
            +K+VENSH+PT+ IL++VV AL KEE+AAE N
Sbjct  82   SKAVENSHQPTEAILKKVVVALGKEESAAENN  113



>ref|XP_009591253.1| PREDICTED: protein STABILIZED1 [Nicotiana tomentosiformis]
Length=1024

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+WF+RAVTLAPDIGDFWAL+ +FE+Q G+E+ RNDVL++C+AAEPKHGEKWQA 
Sbjct  931   KVDKARNWFNRAVTLAPDIGDFWALYLKFEQQHGTEEQRNDVLKRCIAAEPKHGEKWQAT  990

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             AK+VENSH+PT+ IL++VVA LKKEEN AE N
Sbjct  991   AKAVENSHEPTESILKKVVATLKKEENLAENN  1022



>ref|XP_006357494.1| PREDICTED: pre-mRNA-processing factor 6-like [Solanum tuberosum]
Length=1019

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+WF+RAVTLAPDIGDFWAL+++FE+Q G+E+ R+DVL++CVAAEPKHGEKWQA 
Sbjct  926   KVDKARNWFNRAVTLAPDIGDFWALYFKFEQQHGAEEQRSDVLKRCVAAEPKHGEKWQAT  985

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             +K+VENSH+PT+ IL++VVA LKKEEN AE N
Sbjct  986   SKAVENSHEPTESILKKVVATLKKEENLAENN  1017



>ref|XP_004243341.1| PREDICTED: protein STABILIZED1 [Solanum lycopersicum]
Length=1019

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+WF+RAVTLAPDIGDFWAL+++FE+Q G+E+ R+DVL++CVAAEPKHGEKWQA 
Sbjct  926   KVDKARNWFNRAVTLAPDIGDFWALYFKFEQQHGAEEQRSDVLKRCVAAEPKHGEKWQAT  985

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             +K+VENSH+PT+ IL++VVA LKKEEN AE N
Sbjct  986   SKAVENSHEPTESILKKVVATLKKEENLAENN  1017



>gb|KHN27879.1| Pre-mRNA-processing factor 6 [Glycine soja]
Length=835

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR+W SRAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQAI
Sbjct  742  KVDKARTWLSRAVTLAPDIGDFWALLYKFELQHGTEENQKDVLKRCIAAEPKHGEKWQAI  801

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
            +K+VENSH+PT+ IL++VV AL KEENAAE N+
Sbjct  802  SKAVENSHQPTESILKKVVVALGKEENAAENNK  834



>gb|KHN36627.1| Pre-mRNA-processing factor 6 [Glycine soja]
Length=1008

 Score =   150 bits (380),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W SRAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQAI
Sbjct  915   KVDKARTWLSRAVTLAPDIGDFWALLYKFELQHGTEENQKDVLKRCIAAEPKHGEKWQAI  974

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VENSH+PT+ IL++VV AL KEENAAE N+
Sbjct  975   SKAVENSHQPTESILKKVVVALGKEENAAENNK  1007



>ref|XP_003543338.1| PREDICTED: pre-mRNA-processing factor 6-like [Glycine max]
Length=1034

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W SRAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQAI
Sbjct  941   KVDKARTWLSRAVTLAPDIGDFWALLYKFELQHGTEENQKDVLKRCIAAEPKHGEKWQAI  1000

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VENSH+PT+ IL++VV AL KEENAAE N+
Sbjct  1001  SKAVENSHQPTESILKKVVVALGKEENAAENNK  1033



>ref|XP_003540356.1| PREDICTED: pre-mRNA-processing factor 6-like [Glycine max]
Length=1041

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W SRAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQAI
Sbjct  948   KVDKARTWLSRAVTLAPDIGDFWALLYKFELQHGTEENQKDVLKRCIAAEPKHGEKWQAI  1007

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VENSH+PT+ IL++VV AL KEENAAE N+
Sbjct  1008  SKAVENSHQPTESILKKVVVALGKEENAAENNK  1040



>ref|XP_006447348.1| hypothetical protein CICLE_v10018370mg [Citrus clementina]
 ref|XP_006491644.1| PREDICTED: pre-mRNA-processing factor 6-like [Citrus sinensis]
 gb|ESR60588.1| hypothetical protein CICLE_v10018370mg [Citrus clementina]
Length=1027

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q GSED + DVL++CVAAEPKHGEKWQA+
Sbjct  934   KVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGSEDNQKDVLKRCVAAEPKHGEKWQAV  993

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             +K+VENSH+PT+ IL++VV AL KEE AAE N
Sbjct  994   SKAVENSHQPTEAILKKVVLALGKEETAAESN  1025



>ref|XP_009793994.1| PREDICTED: LOW QUALITY PROTEIN: protein STABILIZED1-like [Nicotiana 
sylvestris]
Length=974

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KAR+WF+RAVTLAPDIGDFWAL+++FE+Q G+E+ RNDVL++CVAAEPKHGEKWQA 
Sbjct  881  KVEKARNWFNRAVTLAPDIGDFWALYFKFEQQHGTEEQRNDVLKRCVAAEPKHGEKWQAT  940

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             K+VENSH+PT+ IL++VVA+LK+EEN AE N
Sbjct  941  EKAVENSHEPTESILKKVVASLKEEENLAENN  972



>ref|XP_010685372.1| PREDICTED: protein STABILIZED1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010685373.1| PREDICTED: protein STABILIZED1 [Beta vulgaris subsp. vulgaris]
Length=1024

 Score =   148 bits (373),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ED + DVLR+CVAAEPKHGEKWQ I
Sbjct  930   KVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGTEDLQKDVLRRCVAAEPKHGEKWQPI  989

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             AK+VEN+H+PT+ IL++VV AL KEENAA  N
Sbjct  990   AKAVENAHQPTEAILKKVVIALGKEENAAGNN  1021



>ref|XP_007043553.1| Pre-mRNA splicing factor-related [Theobroma cacao]
 gb|EOX99384.1| Pre-mRNA splicing factor-related [Theobroma cacao]
Length=1033

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q GSE+ + DV+++CVAAEPKHGEKWQAI
Sbjct  939   KVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGSEENQKDVMKRCVAAEPKHGEKWQAI  998

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             +K+VENSH+PT+ IL++VV AL KEE+AAE N
Sbjct  999   SKAVENSHQPTEAILKKVVVALGKEESAAENN  1030



>ref|XP_007149863.1| hypothetical protein PHAVU_005G104900g [Phaseolus vulgaris]
 gb|ESW21857.1| hypothetical protein PHAVU_005G104900g [Phaseolus vulgaris]
Length=1041

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQAI
Sbjct  948   KVDKARTWLNRAVTLAPDIGDFWALCYKFELQHGTEENQKDVLKRCIAAEPKHGEKWQAI  1007

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VENSH+PT+ IL++VV AL KEENAAE N+
Sbjct  1008  SKAVENSHQPTESILKKVVVALGKEENAAENNK  1040



>ref|XP_011085353.1| PREDICTED: LOW QUALITY PROTEIN: protein STABILIZED1 [Sesamum 
indicum]
Length=1007

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKARSWF+RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL +CVAAEPKHGEKWQAI
Sbjct  914   KVDKARSWFNRAVTLAPDIGDFWALYYKFELQHGTEETQKDVLNRCVAAEPKHGEKWQAI  973

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH+PT+ IL++VV A+ KEE+AAE
Sbjct  974   SKAVENSHQPTEFILKKVVVAIGKEEHAAE  1003



>ref|XP_004514211.1| PREDICTED: pre-mRNA-processing factor 6-like [Cicer arietinum]
Length=1043

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL Y+FE Q G+E+ + DVL++CVAAEPKHGEKWQA+
Sbjct  950   KVDKARTWLNRAVTLAPDIGDFWALCYKFELQHGTEENQKDVLKRCVAAEPKHGEKWQAV  1009

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH+PT+ IL++VV AL KEENAAE
Sbjct  1010  SKAVENSHQPTESILKKVVIALGKEENAAE  1039



>gb|KJB31690.1| hypothetical protein B456_005G202800 [Gossypium raimondii]
Length=1033

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DV+++CVAAEPKHGEKWQAI
Sbjct  939   KVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVMKRCVAAEPKHGEKWQAI  998

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             +K+VENSH+PT+ IL++VV  L KEE+AAE N
Sbjct  999   SKAVENSHQPTEAILKKVVVVLGKEESAAENN  1030



>ref|XP_009342654.1| PREDICTED: protein STABILIZED1-like [Pyrus x bretschneideri]
Length=998

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQ I
Sbjct  905  KVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVLKRCIAAEPKHGEKWQPI  964

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
            +K+VENSH+PT+ +L++VV AL KEE+AAE N+
Sbjct  965  SKAVENSHQPTEAVLKKVVVALGKEESAAENNK  997



>dbj|BAD94780.1| putative pre-mRNA splicing factor [Arabidopsis thaliana]
Length=109

 Score =   133 bits (335),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KAR+WF RAVT+ PDIGDFWALFY+FE Q GS++ R +V+ KCVA EPKHGEKWQAI
Sbjct  21   KVEKARAWFERAVTVGPDIGDFWALFYKFELQHGSDEDRKEVVAKCVACEPKHGEKWQAI  80

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAA  347
            +K+VEN+H+P + IL++VV AL KEEN+A
Sbjct  81   SKAVENAHQPIEVILKRVVNALSKEENSA  109



>emb|CBI28774.3| unnamed protein product [Vitis vinifera]
Length=747

 Score =   143 bits (361),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q GSE+ + DVLR+CVAAEPKHGEKWQ I
Sbjct  586  KVDKARTWLNRAVTLAPDIGDFWALYYKFEVQHGSEENQKDVLRRCVAAEPKHGEKWQVI  645

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAE  344
            +K+VENSH PT+ IL++ V AL KEE+ AE
Sbjct  646  SKAVENSHLPTEAILKKAVVALGKEESVAE  675



>ref|XP_011458494.1| PREDICTED: LOW QUALITY PROTEIN: protein STABILIZED1-like [Fragaria 
vesca subsp. vesca]
Length=1024

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+++ + DVL++C+AAEPKHGEKWQ I
Sbjct  931   KVDKARTWLNRAVTLAPDIGDFWALYYKFELQNGTDENQKDVLKRCIAAEPKHGEKWQPI  990

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             +K+VENSH+PT+ IL++VV AL KEE+AAE N
Sbjct  991   SKAVENSHQPTEAILKKVVVALGKEESAAENN  1022



>gb|EYU26151.1| hypothetical protein MIMGU_mgv1a000662mg [Erythranthe guttata]
 gb|EYU26152.1| hypothetical protein MIMGU_mgv1a000662mg [Erythranthe guttata]
Length=1027

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKARSWF+RAVTL+PDIGDFWAL+Y+FE Q G+E+ + DVL +CV AEPKHGEKWQAI
Sbjct  934   KVDKARSWFNRAVTLSPDIGDFWALYYKFELQHGTEETQRDVLNRCVTAEPKHGEKWQAI  993

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH+PT+ IL++VV A+ KEE+AAE
Sbjct  994   SKAVENSHQPTEFILKKVVVAIGKEEHAAE  1023



>gb|AEY85031.1| putative pre-mRNA splicing factor [Camellia sinensis]
Length=1023

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGD+WAL+Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQAI
Sbjct  930   KVDKARNWLNRAVTLAPDIGDYWALYYKFELQHGTEENQKDVLKRCIAAEPKHGEKWQAI  989

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH+PT+ IL++VV AL KEE++AE
Sbjct  990   SKAVENSHQPTEAILKKVVIALGKEESSAE  1019



>ref|XP_009357821.1| PREDICTED: protein STABILIZED1-like [Pyrus x bretschneideri]
Length=1026

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+++ + DVL++C++AEPKHGEKWQ I
Sbjct  933   KVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGTDENQKDVLKRCISAEPKHGEKWQPI  992

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VENSH+PT+ IL++VV AL KEE+AAE N+
Sbjct  993   SKAVENSHQPTEAILKKVVVALGKEESAAENNK  1025



>ref|XP_010245311.1| PREDICTED: protein STABILIZED1 [Nelumbo nucifera]
Length=1020

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL++C+AAEPKHGE+WQAI
Sbjct  928   KVDKARNWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVLKRCIAAEPKHGERWQAI  987

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH+P + IL++ V AL KEENAAE
Sbjct  988   SKAVENSHQPIEAILKKAVVALGKEENAAE  1017



>emb|CDP02726.1| unnamed protein product [Coffea canephora]
Length=1024

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKARS+ +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DV+++CVAAEPKHGEKWQAI
Sbjct  931   KVDKARSYLNRAVTLAPDIGDFWALYYKFELQHGNEETQKDVIKRCVAAEPKHGEKWQAI  990

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH+PT+ IL++VV +L KEEN+AE
Sbjct  991   SKAVENSHQPTEAILKKVVVSLGKEENSAE  1020



>emb|CAN65423.1| hypothetical protein VITISV_024588 [Vitis vinifera]
Length=1023

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q GSE+ + DVLR+CVAAEPKHGEKWQ I
Sbjct  930   KVDKARTWLNRAVTLAPDIGDFWALYYKFEVQHGSEENQKDVLRRCVAAEPKHGEKWQVI  989

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH PT+ IL++ V AL KEE+ AE
Sbjct  990   SKAVENSHLPTEAILKKAVVALGKEESVAE  1019



>ref|XP_008342929.1| PREDICTED: pre-mRNA-processing factor 6-like [Malus domestica]
Length=1026

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL++C+AA+P HGEKWQ I
Sbjct  933   KVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVLKRCIAADPXHGEKWQPI  992

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VENSH+PT+ IL++VV AL KEE+AAE N+
Sbjct  993   SKAVENSHQPTEAILKKVVVALGKEESAAENNK  1025



>ref|XP_002267416.1| PREDICTED: protein STABILIZED1 [Vitis vinifera]
Length=1023

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q GSE+ + DVLR+CVAAEPKHGEKWQ I
Sbjct  930   KVDKARTWLNRAVTLAPDIGDFWALYYKFEVQHGSEENQKDVLRRCVAAEPKHGEKWQVI  989

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH PT+ IL++ V AL KEE+ AE
Sbjct  990   SKAVENSHLPTEAILKKAVVALGKEESVAE  1019



>ref|XP_002517947.1| pre-mRNA splicing factor, putative [Ricinus communis]
 gb|EEF44465.1| pre-mRNA splicing factor, putative [Ricinus communis]
Length=1031

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQAI
Sbjct  938   KVDKARTWLNRAVTLAPDIGDFWALYYKFELQHGTEENQRDVLKRCIAAEPKHGEKWQAI  997

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VEN+H+ T+ IL++VV  L KEENAAE N+
Sbjct  998   SKAVENAHQQTEAILKKVVIVLGKEENAAENNK  1030



>ref|XP_011045503.1| PREDICTED: protein STABILIZED1-like [Populus euphratica]
 ref|XP_011045504.1| PREDICTED: protein STABILIZED1-like [Populus euphratica]
 ref|XP_011045506.1| PREDICTED: protein STABILIZED1-like [Populus euphratica]
 ref|XP_011015402.1| PREDICTED: protein STABILIZED1-like isoform X1 [Populus euphratica]
 ref|XP_011015403.1| PREDICTED: protein STABILIZED1-like isoform X2 [Populus euphratica]
Length=1024

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKARSW +RAVTLAPDIGDFWA +Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQ I
Sbjct  931   KVDKARSWLNRAVTLAPDIGDFWAYYYKFELQHGTEEDQKDVLKRCIAAEPKHGEKWQTI  990

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VENSH+PT+ IL++VV  L KEE+A+E N+
Sbjct  991   SKAVENSHQPTEAILKKVVVVLGKEESASENND  1023



>gb|ADN34237.1| pre-mRNA splicing factor [Cucumis melo subsp. melo]
Length=727

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPD+GDFWAL+Y+FE Q G+++ + DVL++C+AAEPKHGEKWQ I
Sbjct  634  KVDKARSWLNRAVTLAPDVGDFWALYYKFELQHGADENQKDVLKRCIAAEPKHGEKWQTI  693

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAE  344
            +K+VENSH+PT+ IL++VV AL KE+ A E
Sbjct  694  SKAVENSHQPTESILKKVVVALGKEDGAVE  723



>gb|KDP24152.1| hypothetical protein JCGZ_25809 [Jatropha curcas]
Length=1025

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPD GDFWAL+Y+FE Q G+E+ + DVL++CVAAEPKHGEKWQAI
Sbjct  927   KVDKARTWLNRAVTLAPDTGDFWALYYKFELQHGTEENQKDVLKRCVAAEPKHGEKWQAI  986

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             +K+V+N+H+ T+ IL++VV AL KEENAAE N
Sbjct  987   SKAVDNAHQQTEAILKKVVLALGKEENAAENN  1018



>ref|XP_002319361.2| hypothetical protein POPTR_0013s13900g [Populus trichocarpa]
 gb|EEE95284.2| hypothetical protein POPTR_0013s13900g [Populus trichocarpa]
Length=945

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPDIGDFWA +Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQ I
Sbjct  852  KVDKARSWLNRAVTLAPDIGDFWAYYYKFELQHGNEEDQKDVLKRCIAAEPKHGEKWQTI  911

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
            +K+VENSH+PT+ IL++VV  L KEE+A+E N+
Sbjct  912  SKAVENSHQPTEAILKKVVVVLGKEESASENND  944



>ref|XP_009797444.1| PREDICTED: protein STABILIZED1-like isoform X3 [Nicotiana sylvestris]
Length=1024

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+WF+RAVTLAPDIGDFWAL+ +FE+Q G+E+ RNDVL++CVAAEPKHG KWQA 
Sbjct  931   KVDKARNWFNRAVTLAPDIGDFWALYLKFEQQHGTEEQRNDVLKRCVAAEPKHGGKWQAT  990

Query  433   AKSVENSHKPTDEILRQVVAALKK  362
             AK+VENSH+PT+ IL++VVA LKK
Sbjct  991   AKAVENSHEPTESILKKVVATLKK  1014



>ref|XP_009797442.1| PREDICTED: protein STABILIZED1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009797443.1| PREDICTED: protein STABILIZED1-like isoform X2 [Nicotiana sylvestris]
Length=1024

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+WF+RAVTLAPDIGDFWAL+ +FE+Q G+E+ RNDVL++CVAAEPKHG KWQA 
Sbjct  931   KVDKARNWFNRAVTLAPDIGDFWALYLKFEQQHGTEEQRNDVLKRCVAAEPKHGGKWQAT  990

Query  433   AKSVENSHKPTDEILRQVVAALKK  362
             AK+VENSH+PT+ IL++VVA LKK
Sbjct  991   AKAVENSHEPTESILKKVVATLKK  1014



>gb|EMT09961.1| Pre-mRNA-processing factor 6 [Aegilops tauschii]
Length=946

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL++C+AAEPKHGE+WQAI
Sbjct  854  KVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQRDVLKRCIAAEPKHGERWQAI  913

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VENSH+P D ILR+VV AL  EEN
Sbjct  914  SKAVENSHQPVDAILRKVVLALGAEEN  940



>ref|XP_008459779.1| PREDICTED: pre-mRNA-processing factor 6 [Cucumis melo]
Length=1023

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKARSW +RAVTLAPD+GDFWAL+Y+FE Q G+++ + DVL++C+AAEPKHGEKWQ I
Sbjct  930   KVDKARSWLNRAVTLAPDVGDFWALYYKFELQHGADENQKDVLKRCIAAEPKHGEKWQTI  989

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH+PT+ IL++VV AL KE+ A E
Sbjct  990   SKAVENSHQPTESILKKVVVALGKEDGAVE  1019



>gb|EMS45135.1| Pre-mRNA-processing factor 6 [Triticum urartu]
Length=1063

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL++C+AAEPKHGE+WQAI
Sbjct  971   KVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQRDVLKRCIAAEPKHGERWQAI  1030

Query  433   AKSVENSHKPTDEILRQVVAALKKEEN  353
             +K+VENSH+P D ILR+VV AL  EEN
Sbjct  1031  SKAVENSHQPVDAILRKVVLALGAEEN  1057



>ref|XP_004140515.1| PREDICTED: pre-mRNA-processing factor 6-like [Cucumis sativus]
 ref|XP_004164455.1| PREDICTED: pre-mRNA-processing factor 6-like [Cucumis sativus]
 gb|KGN46502.1| hypothetical protein Csa_6G104100 [Cucumis sativus]
Length=1023

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPD+GDFWAL+Y+FE Q G ++ + DVL++C+AAEPKHGEKWQ I
Sbjct  930   KVDKARNWLNRAVTLAPDVGDFWALYYKFELQHGGDENQKDVLKRCIAAEPKHGEKWQTI  989

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH+PT+ IL++VV AL KEE A E
Sbjct  990   SKAVENSHQPTESILKKVVVALGKEEGAVE  1019



>gb|KEH23176.1| pre-mRNA splicing factor-like protein [Medicago truncatula]
Length=1054

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W ++AVTLAPD+GDFWAL Y+FE Q G+E+ + DVL++CVAAEPKHGEKWQ +
Sbjct  961   KVDKARNWLNKAVTLAPDVGDFWALLYKFELQHGTEENQKDVLKRCVAAEPKHGEKWQPV  1020

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH+PT+ IL++VV AL KEE AAE
Sbjct  1021  SKAVENSHQPTESILKKVVIALGKEEKAAE  1050



>gb|AEO72346.2| Prp1 protein [Hordeum vulgare subsp. vulgare]
Length=955

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL++C+AAEPKHGE+WQAI
Sbjct  863  KVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQKDVLKRCIAAEPKHGERWQAI  922

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VENSH P D ILR+VV AL  EEN
Sbjct  923  SKAVENSHLPVDAILRKVVLALGAEEN  949



>dbj|BAK00717.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=955

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL++C+AAEPKHGE+WQAI
Sbjct  863  KVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQKDVLKRCIAAEPKHGERWQAI  922

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VENSH P D ILR+VV AL  EEN
Sbjct  923  SKAVENSHLPVDAILRKVVLALGAEEN  949



>ref|XP_002872777.1| hypothetical protein ARALYDRAFT_490219 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49036.1| hypothetical protein ARALYDRAFT_490219 [Arabidopsis lyrata subsp. 
lyrata]
Length=1004

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KV+KARSWF RAVTL PDIGDFWAL+Y+FE Q GS++ R +V+ KCVA+EPKHGEKWQAI
Sbjct  916   KVEKARSWFERAVTLGPDIGDFWALYYKFELQHGSDENRKEVVAKCVASEPKHGEKWQAI  975

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAA  347
             +K+VEN+H+P + IL++VV+AL KEENAA
Sbjct  976   SKAVENAHQPIEVILKRVVSALSKEENAA  1004



>gb|EPS73075.1| hypothetical protein M569_01676 [Genlisea aurea]
Length=1022

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKARSWF+RAVTLAPDIGDFWA++Y+FE Q G+E+ + DVL +CVAAEPKHGEKWQA+
Sbjct  931   KVDKARSWFNRAVTLAPDIGDFWAVYYKFELQHGNEETQRDVLSRCVAAEPKHGEKWQAV  990

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             +K+VENSH+P + IL++VV AL KEE AA+
Sbjct  991   SKAVENSHQPPEFILKKVVLALGKEEIAAD  1020



>ref|XP_010099575.1| Pre-mRNA-processing factor 6 [Morus notabilis]
 gb|EXB79641.1| Pre-mRNA-processing factor 6 [Morus notabilis]
Length=1024

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTL PDIGDFWAL Y+FE Q G+E+ + DVL+KC+AAEPKHGEKWQA+
Sbjct  931   KVDKARTWLNRAVTLGPDIGDFWALCYKFELQHGNEETQKDVLKKCIAAEPKHGEKWQAV  990

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VENSH+P + +L++VV A  KEE+AAE N+
Sbjct  991   SKAVENSHQPIEAVLKKVVVAFGKEESAAENNK  1023



>ref|XP_009401680.1| PREDICTED: protein STABILIZED1 [Musa acuminata subsp. malaccensis]
Length=1035

 Score =   139 bits (349),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+WF+RAV LAPD+GDFWAL+Y+FE Q G+E+ + DVL++C+AAEPKHGEKWQAI
Sbjct  940   KVDKARNWFNRAVILAPDVGDFWALYYKFELQHGTEETQKDVLKRCMAAEPKHGEKWQAI  999

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
             +K+VENSH PT+ +L++ V AL KEEN   I+
Sbjct  1000  SKAVENSHLPTEALLKKAVVALGKEENPTVID  1031



>ref|XP_010467412.1| PREDICTED: protein STABILIZED1-like [Camelina sativa]
Length=798

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KARSWF RAVTLAP+IGDFWAL+Y+FE Q GSE+ + +V+ KCVA EPKHGEKWQAI
Sbjct  710  KVEKARSWFKRAVTLAPNIGDFWALYYKFEHQHGSEENQKEVIAKCVACEPKHGEKWQAI  769

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAA  347
            +K+VEN+H+P + IL++VV+A+ KEE AA
Sbjct  770  SKAVENAHQPIETILKRVVSAMSKEEKAA  798



>gb|EMT02936.1| Pre-mRNA-processing factor 6 [Aegilops tauschii]
Length=918

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAV+LAPDIGDFWAL+Y+FE Q G+ D + DVL++C+AAEPKHGE+WQA 
Sbjct  826  KVDKARSWLNRAVSLAPDIGDFWALYYKFELQHGNADTQRDVLKRCIAAEPKHGERWQAT  885

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAEINEP  332
            +K+VENSH+P D ILR+VV AL  EEN   + EP
Sbjct  886  SKAVENSHQPIDAILRRVVLALGVEEN-PNVTEP  918



>ref|XP_006279939.1| hypothetical protein CARUB_v10025803mg [Capsella rubella]
 gb|EOA12837.1| hypothetical protein CARUB_v10025803mg [Capsella rubella]
Length=1021

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KV+KARSWF RAVTL+PDIGDFWAL+Y+FE Q GSE+ + +V+ KCVA+EPKHGEKWQAI
Sbjct  933   KVEKARSWFKRAVTLSPDIGDFWALYYKFEHQHGSEENQKEVIAKCVASEPKHGEKWQAI  992

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAA  347
             +KSVEN+H+P + IL++V+ A+ KEE AA
Sbjct  993   SKSVENAHQPIETILKRVMLAMNKEEKAA  1021



>ref|XP_008229166.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6 
[Prunus mume]
Length=1026

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL++C AAEPKHGEKWQ I
Sbjct  933   KVDKARNWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVLKRCEAAEPKHGEKWQPI  992

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VENSH+  + IL++VV AL KEE+AAE N+
Sbjct  993   SKAVENSHQSIEAILKKVVVALGKEESAAENNK  1025



>ref|XP_010431097.1| PREDICTED: protein STABILIZED1-like [Camelina sativa]
Length=1021

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KV+KARSWF RAVTLAP+IGDFWAL+Y+FE Q GSE+ + +V+ KCVA EPKHGEKWQAI
Sbjct  933   KVEKARSWFKRAVTLAPNIGDFWALYYKFEHQHGSEENQKEVIAKCVACEPKHGEKWQAI  992

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAA  347
             +K+VEN+H+P + IL++VV+A+ KEE AA
Sbjct  993   SKAVENAHQPIETILKRVVSAMSKEEKAA  1021



>ref|XP_006286978.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
 ref|XP_006286979.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
 ref|XP_006286980.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
 gb|EOA19876.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
 gb|EOA19877.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
 gb|EOA19878.1| hypothetical protein CARUB_v10000126mg [Capsella rubella]
Length=1018

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KV+KARSWF RAVTLAP+IGDFWAL+Y+FE Q GSE+ + +V+ KCVA+EPKHGEKWQAI
Sbjct  930   KVEKARSWFKRAVTLAPNIGDFWALYYKFEHQHGSEENQKEVIAKCVASEPKHGEKWQAI  989

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAA  347
             +KSVEN+H+P + IL++V+ A+ KEE AA
Sbjct  990   SKSVENAHQPIETILKRVMLAMNKEEKAA  1018



>ref|XP_007214916.1| hypothetical protein PRUPE_ppa000712mg [Prunus persica]
 gb|EMJ16115.1| hypothetical protein PRUPE_ppa000712mg [Prunus persica]
Length=1026

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL++C AAEPKHGEKWQ I
Sbjct  933   KVDKARNWLNRAVTLAPDIGDFWALYYKFELQHGTEENQKDVLKRCEAAEPKHGEKWQPI  992

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAEINE  335
             +K+VENSH+  + IL++VV AL KEE+AAE N+
Sbjct  993   SKAVENSHQSFEAILKKVVVALGKEESAAENNK  1025



>ref|XP_010455888.1| PREDICTED: protein STABILIZED1 [Camelina sativa]
Length=1021

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KV+KARSWF RAVT+AP+IGDFWAL+Y+FE Q GSE+ + +V+ KCVA EPKHGEKWQAI
Sbjct  933   KVEKARSWFKRAVTIAPNIGDFWALYYKFEHQHGSEENQKEVIAKCVACEPKHGEKWQAI  992

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAA  347
             +K+VEN+H+P + IL++VV+A+ KEE AA
Sbjct  993   SKAVENAHQPIETILKRVVSAMSKEEKAA  1021



>ref|XP_010422461.1| PREDICTED: protein STABILIZED1-like [Camelina sativa]
Length=1021

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KV+KARSWF RAVT+AP+IGDFWAL+Y+FE Q GSE+ + +V+ KCVA EPKHGEKWQAI
Sbjct  933   KVEKARSWFKRAVTIAPNIGDFWALYYKFEHQHGSEENQKEVIAKCVACEPKHGEKWQAI  992

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAA  347
             +K+VEN+H+P + IL++VV+A+ KEE AA
Sbjct  993   SKAVENAHQPIETILKRVVSAMSKEEKAA  1021



>ref|XP_010035719.1| PREDICTED: protein STABILIZED1 [Eucalyptus grandis]
 gb|KCW47157.1| hypothetical protein EUGRSUZ_K00962 [Eucalyptus grandis]
Length=1030

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+W +RAVTL PD+GDFWAL+Y+FE Q G+ED + DVL +CVAAEPK+GEKWQ I
Sbjct  939   KVDKARTWLNRAVTLKPDVGDFWALYYKFELQHGTEDTQKDVLMRCVAAEPKYGEKWQVI  998

Query  433   AKSVENSHKPTDEILRQVVAALKKEE  356
             +K+VENSH+PT+ IL++VV AL KEE
Sbjct  999   SKAVENSHQPTEAILKKVVVALGKEE  1024



>tpg|DAA55350.1| TPA: hypothetical protein ZEAMMB73_415949 [Zea mays]
Length=962

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPD+GDFWAL+Y+FE Q G+ D + DVL++CVAAEPKHGEKWQAI
Sbjct  870  KVDKARSWLNRAVTLAPDVGDFWALYYKFELQHGNVDTQKDVLKRCVAAEPKHGEKWQAI  929

Query  433  AKSVENSHKPTDEILRQVVAALKKEENA  350
            +KSVENSH P + +L++ V  L  EENA
Sbjct  930  SKSVENSHLPVEALLKKAVVVLDVEENA  957



>ref|NP_192252.1| pre-mRNA-processing factor 6-like protein STA1 [Arabidopsis thaliana]
 sp|Q9ZT71.1|STA1_ARATH RecName: Full=Protein STABILIZED1; AltName: Full=Pre-mRNA processing 
factor 6-like protein; AltName: Full=Protein EMBRYO 
DEFECTIVE 2770 [Arabidopsis thaliana]
 gb|AAD11585.1| putative pre-mRNA splicing factor [Arabidopsis thaliana]
 emb|CAB77828.1| putative pre-mRNA splicing factor [Arabidopsis thaliana]
 gb|AAL24077.1| putative pre-mRNA splicing factor [Arabidopsis thaliana]
 gb|AAN13111.1| putative pre-mRNA splicing factor [Arabidopsis thaliana]
 gb|AEE82320.1| pre-mRNA-processing factor 6-like protein [Arabidopsis thaliana]
Length=1029

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KV+KAR+WF RAVT+ PDIGDFWALFY+FE Q GS++ R +V+ KCVA EPKHGEKWQAI
Sbjct  941   KVEKARAWFERAVTVGPDIGDFWALFYKFELQHGSDEDRKEVVAKCVACEPKHGEKWQAI  1000

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAA  347
             +K+VEN+H+P + IL++VV AL KEEN+A
Sbjct  1001  SKAVENAHQPIEVILKRVVNALSKEENSA  1029



>ref|XP_008662633.1| PREDICTED: pre-mRNA-processing factor 6-like [Zea mays]
 gb|AFW56581.1| hypothetical protein ZEAMMB73_917811 [Zea mays]
Length=956

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL++CVAAEPKHGEKWQAI
Sbjct  864  KVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNVDTQKDVLKRCVAAEPKHGEKWQAI  923

Query  433  AKSVENSHKPTDEILRQVVAALKKEENA  350
             K+VENSH P + +L++ V  L  EENA
Sbjct  924  TKAVENSHLPVEALLKKAVVVLDVEENA  951



>ref|NP_001064969.1| Os10g0498600 [Oryza sativa Japonica Group]
 dbj|BAF26883.1| Os10g0498600, partial [Oryza sativa Japonica Group]
Length=428

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL++CVAAEPKHGE+WQAI
Sbjct  336  KVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQKDVLQRCVAAEPKHGERWQAI  395

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
             K+VENSH   + +L++ V AL +EEN
Sbjct  396  TKAVENSHLSIEALLKKAVLALGQEEN  422



>ref|XP_010918430.1| PREDICTED: protein STABILIZED1 [Elaeis guineensis]
 ref|XP_010918431.1| PREDICTED: protein STABILIZED1 [Elaeis guineensis]
Length=1036

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+WF+RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL++C++AEPKHGE+WQAI
Sbjct  941   KVDKARNWFNRAVTLAPDIGDFWALYYKFELQHGTEEQQKDVLKRCISAEPKHGERWQAI  1000

Query  433   AKSVENSHKPTDEILRQVVAALKKEE  356
             +K+VENSH P + +L++ V AL KEE
Sbjct  1001  SKAVENSHLPIEALLKKAVVALGKEE  1026



>ref|NP_001172269.1| Os01g0263600 [Oryza sativa Japonica Group]
 dbj|BAH90999.1| Os01g0263600, partial [Oryza sativa Japonica Group]
Length=181

 Score =   125 bits (314),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K DKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D   DV+++CVA+EPKHGE+WQAI
Sbjct  89   KFDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTHKDVVQRCVASEPKHGERWQAI  148

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
            AK+VENSH   + +L++ V AL ++EN   ++
Sbjct  149  AKAVENSHLSIEALLKKAVVALGQDENPNAVD  180



>ref|XP_008809401.1| PREDICTED: protein STABILIZED1 [Phoenix dactylifera]
Length=1035

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKAR+WF+RAVTLAPDIGDFWAL+Y+FE Q G+E+ + DVL++C++AEPKHGE+WQAI
Sbjct  940   KVDKARNWFNRAVTLAPDIGDFWALYYKFELQHGTEEQQKDVLKRCISAEPKHGERWQAI  999

Query  433   AKSVENSHKPTDEILRQVVAALKKEENA  350
             +K+VENSH P + +L++ V  L KEE++
Sbjct  1000  SKAVENSHLPIEAVLKKAVVVLGKEESS  1027



>ref|XP_010234868.1| PREDICTED: protein STABILIZED1 [Brachypodium distachyon]
Length=960

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR+W  +AVTLAPDIGDFWA  Y+FE Q G+ D + +VL+KC+AAEPKHGE+WQ++
Sbjct  868  KVDKARTWLDKAVTLAPDIGDFWAFLYKFELQHGNADTQKEVLKKCIAAEPKHGERWQSV  927

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VENSH+P D ILR+VV AL  EEN
Sbjct  928  SKAVENSHQPVDAILRKVVLALGAEEN  954



>ref|XP_004982722.1| PREDICTED: pre-mRNA-processing factor 6-like isoform X1 [Setaria 
italica]
 ref|XP_004982723.1| PREDICTED: pre-mRNA-processing factor 6-like isoform X2 [Setaria 
italica]
Length=955

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR WF+RAVTLAPDIGDFWAL+Y+FE Q G+ + + DVL++CVAAEPKHGEKWQAI
Sbjct  863  KVDKARIWFNRAVTLAPDIGDFWALYYKFELQHGNAETQKDVLKRCVAAEPKHGEKWQAI  922

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VENSH+P + +L++ V AL  +E 
Sbjct  923  SKAVENSHQPVEALLKKAVVALDADET  949



>ref|XP_002442232.1| hypothetical protein SORBIDRAFT_08g016670 [Sorghum bicolor]
 gb|EES16070.1| hypothetical protein SORBIDRAFT_08g016670 [Sorghum bicolor]
Length=963

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL++CVAAEPKHGEKWQ +
Sbjct  871  KVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGTVDTQKDVLKRCVAAEPKHGEKWQEV  930

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VENSH P + +L++ V  L  EEN
Sbjct  931  SKAVENSHLPVEALLKKAVVGLHVEEN  957



>emb|CDY21966.1| BnaC09g00720D [Brassica napus]
Length=931

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KA +W  RAVTLAPDIGDFWAL+Y+FE Q G+E+ + +VL KCVA EPKHGEKWQ I
Sbjct  842  KVEKAGAWLKRAVTLAPDIGDFWALYYKFELQHGTEESQKEVLAKCVACEPKHGEKWQTI  901

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAA  347
            +K+VEN+H+P D IL++VV AL KE+ AA
Sbjct  902  SKAVENAHQPIDVILKKVVIALSKEQKAA  930



>gb|AAL58273.1|AC068923_15 putative pre-mRNA splicing factor [Oryza sativa Japonica Group]
 gb|AAP54456.1| U5 snRNP-associated 102 kDa protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|EAY79087.1| hypothetical protein OsI_34194 [Oryza sativa Indica Group]
Length=1039

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL++CVAAEPKHGE+WQAI
Sbjct  947   KVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQKDVLQRCVAAEPKHGERWQAI  1006

Query  433   AKSVENSHKPTDEILRQVVAALKKEEN  353
              K+VENSH   + +L++ V AL +EEN
Sbjct  1007  TKAVENSHLSIEALLKKAVLALGQEEN  1033



>gb|EEE51217.1| hypothetical protein OsJ_32045 [Oryza sativa Japonica Group]
Length=1004

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D + DVL++CVAAEPKHGE+WQAI
Sbjct  912  KVDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTQKDVLQRCVAAEPKHGERWQAI  971

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
             K+VENSH   + +L++ V AL +EEN
Sbjct  972  TKAVENSHLSIEALLKKAVLALGQEEN  998



>emb|CDY48561.1| BnaA09g01570D [Brassica napus]
Length=956

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KA +W  RAVTLAPDIGDFWAL+Y+FE Q G+E+ + +VL KCVA EPKHGEKWQAI
Sbjct  867  KVEKAGAWLKRAVTLAPDIGDFWALYYKFELQHGTEESQKEVLAKCVACEPKHGEKWQAI  926

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAA  347
            +K+VEN+H+P + IL++VV AL KE+ AA
Sbjct  927  SKAVENAHQPIEVILKKVVIALSKEQKAA  955



>ref|XP_006662478.1| PREDICTED: pre-mRNA-processing factor 6-like, partial [Oryza 
brachyantha]
Length=896

 Score =   130 bits (327),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTL+PDIGDFWAL+Y+FE Q G+ D + DVL++CVAAEPKHGE+WQAI
Sbjct  804  KVDKARSWLNRAVTLSPDIGDFWALYYKFELQHGNADTQKDVLQRCVAAEPKHGERWQAI  863

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
             K+VENSH   + +L++ V AL +EEN
Sbjct  864  TKAVENSHLSVEALLKKAVVALGQEEN  890



>ref|XP_009121844.1| PREDICTED: protein STABILIZED1 [Brassica rapa]
 ref|XP_009121855.1| PREDICTED: protein STABILIZED1 [Brassica rapa]
Length=1015

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KV+KA +W  RAVTLAPDIGDFWAL+Y+FE Q G+E+ + +VL KCVA EPKHGEKWQAI
Sbjct  926   KVEKAGAWLKRAVTLAPDIGDFWALYYKFELQHGTEESQKEVLAKCVACEPKHGEKWQAI  985

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAA  347
             +K+VEN+H+P + IL++VV AL KE+ AA
Sbjct  986   SKAVENAHQPIEVILKKVVIALSKEQKAA  1014



>ref|XP_006396573.1| hypothetical protein EUTSA_v10028386mg [Eutrema salsugineum]
 gb|ESQ38026.1| hypothetical protein EUTSA_v10028386mg [Eutrema salsugineum]
Length=1021

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KV+KARSW  RAVTLAPDIGD WAL+Y+FE Q GSE+ + +V+ KCVA EPKHGEKWQAI
Sbjct  933   KVEKARSWLKRAVTLAPDIGDIWALYYKFELQHGSEENQKEVVAKCVACEPKHGEKWQAI  992

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAA  347
             AK+VEN+H+P + IL +V  A+ KEE AA
Sbjct  993   AKAVENAHQPVEVILIRVAVAMSKEEKAA  1021



>ref|XP_010522629.1| PREDICTED: protein STABILIZED1 [Tarenaya hassleriana]
Length=1021

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             KVDKARSW  RAVTLAPD+GDFWAL+Y+FE Q GS++ + +VL  C  AEPK+GEKWQ I
Sbjct  932   KVDKARSWLKRAVTLAPDVGDFWALYYKFELQHGSDENQKEVLANCAVAEPKYGEKWQPI  991

Query  433   AKSVENSHKPTDEILRQVVAALKKEENAAE  344
             AK+VEN+H+  + IL++VV AL +EENAAE
Sbjct  992   AKAVENAHQTVEVILKKVVVALGREENAAE  1021



>ref|XP_007218131.1| hypothetical protein PRUPE_ppa007130mg [Prunus persica]
 gb|EMJ19330.1| hypothetical protein PRUPE_ppa007130mg [Prunus persica]
Length=381

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +V +AR+W  RAVT+APDIGDFWAL+++FE Q G+++ + DVLR+C+A++PK+GEKWQ I
Sbjct  282  EVKRARTWLDRAVTIAPDIGDFWALYFKFELQHGTDENQKDVLRRCIASQPKYGEKWQPI  341

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAE  344
            +K++ NSH+PT+ IL QVVA L KEE++ +
Sbjct  342  SKALHNSHQPTEAILHQVVAVLGKEESSQQ  371



>gb|EMT28978.1| Pre-mRNA-processing factor 6 [Aegilops tauschii]
Length=646

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSWF+RA +LAPDIGDF AL+Y+ E Q G+ D + DVL++C+AAEPKHGE+WQA 
Sbjct  472  KVDKARSWFNRAASLAPDIGDFRALYYKSELQHGNADTQRDVLKRCIAAEPKHGERWQAT  531

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K+VENSH+PTD ILR+VV AL
Sbjct  532  SKAVENSHQPTDAILRRVVLAL  553



>gb|EAZ11333.1| hypothetical protein OsJ_01197 [Oryza sativa Japonica Group]
Length=867

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K DKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D   DV+++CVA+EPKHGE+WQAI
Sbjct  775  KFDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTHKDVVQRCVASEPKHGERWQAI  834

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            AK+VENSH   + +L++ V AL ++EN
Sbjct  835  AKAVENSHLSIEALLKKAVVALGQDEN  861



>gb|EAY73400.1| hypothetical protein OsI_01280 [Oryza sativa Indica Group]
Length=892

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K DKARSW +RAVTLAPDIGDFWAL+Y+FE Q G+ D   DV+++CVA+EPKHGE+WQAI
Sbjct  800  KFDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTHKDVVQRCVASEPKHGERWQAI  859

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAEIN  338
            AK+VENSH   + +L++ V AL ++EN   ++
Sbjct  860  AKAVENSHLSIEALLKKAVVALGQDENPNAVD  891



>ref|XP_006442217.1| hypothetical protein CICLE_v10018758mg [Citrus clementina]
 gb|ESR55457.1| hypothetical protein CICLE_v10018758mg [Citrus clementina]
Length=915

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR+WF++AV+L PD GDFWAL+Y+FE Q GS + + +VL +C+AAEPKHGEKWQAI
Sbjct  821  KVDKARNWFNKAVSLDPDTGDFWALYYKFELQQGSVENQKEVLNRCIAAEPKHGEKWQAI  880

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K+VENSH PT+ IL +VV AL
Sbjct  881  SKAVENSHCPTEAILMKVVNAL  902



>ref|XP_002866811.1| hypothetical protein ARALYDRAFT_912309 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43070.1| hypothetical protein ARALYDRAFT_912309 [Arabidopsis lyrata subsp. 
lyrata]
Length=805

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR WF R V + PD GDFWAL+Y+FE + GSE+ + +VL KCVA+EPKHGEKWQAI
Sbjct  716  KVDKARLWFQRTVNVDPDNGDFWALYYKFELEHGSEEKQKEVLTKCVASEPKHGEKWQAI  775

Query  433  AKSVENSHKPTDEILRQVVAALKKEE  356
            +K++EN+H+P + IL++VV AL +EE
Sbjct  776  SKALENAHQPVEVILKRVVVALTREE  801



>ref|XP_007200323.1| hypothetical protein PRUPE_ppa000851mg [Prunus persica]
 gb|EMJ01522.1| hypothetical protein PRUPE_ppa000851mg [Prunus persica]
Length=982

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKAR+W + AV  APDIGDFWAL+Y+FE Q G+E+ + DVL +C+AA PKHGEKWQ I
Sbjct  896  KLDKARNWLNMAVMFAPDIGDFWALYYKFELQHGTEENQKDVLNRCIAAGPKHGEKWQPI  955

Query  433  AKSVENSHKPTDEILRQVVAA  371
            +K+VENSH+P + IL++VVAA
Sbjct  956  SKAVENSHQPIEAILKKVVAA  976



>ref|XP_003588705.1| Pre-mRNA-processing factor [Medicago truncatula]
 gb|AES58956.1| pre-mRNA splicing factor-like protein [Medicago truncatula]
Length=895

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KAR+  + AVTLAPDIGDFW L Y+FE Q G+E+ + DVL++CVAAEPKHGEKWQA+
Sbjct  811  KVEKARTLLNTAVTLAPDIGDFWVLCYKFELQHGTEENQKDVLKRCVAAEPKHGEKWQAV  870

Query  433  AKSVENSHKPTDEILRQVV  377
            +K++EN+H+PT+ IL++VV
Sbjct  871  SKALENAHQPTESILKKVV  889



>ref|XP_006857690.1| hypothetical protein AMTR_s00061p00165040 [Amborella trichopoda]
 gb|ERN19157.1| hypothetical protein AMTR_s00061p00165040 [Amborella trichopoda]
Length=1032

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -3

Query  610   VDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAIA  431
             +DKAR+WF+RAVT  PDIGD WAL+Y+FE Q G+ED + DVL +CV+AEP+HG +W  ++
Sbjct  939   IDKARTWFNRAVTHDPDIGDSWALYYKFELQHGTEDSQKDVLDRCVSAEPRHGPRWTQVS  998

Query  430   KSVENSHKPTDEILRQVVAALKKEEN  353
             K++ENSH+P + IL++VV AL K+E 
Sbjct  999   KAIENSHQPIEAILKKVVVALGKDEG  1024



>ref|XP_009135950.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
Length=574

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KAR+W  RAVTL  DIGD WAL+Y+FE Q G+E  +  +L KCVA EPK GEKWQAI
Sbjct  486  KVEKARAWLKRAVTLNQDIGDHWALYYKFELQHGTEVRQKQILAKCVACEPKRGEKWQAI  545

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAA  347
            +K+VEN+H+P + IL +V+ AL KEE A 
Sbjct  546  SKAVENAHQPIEAILNKVLIALSKEEKAT  574



>ref|XP_001755087.1| predicted protein [Physcomitrella patens]
 gb|EDQ80031.1| predicted protein [Physcomitrella patens]
Length=938

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPDIGDFWA  Y+FE Q   ED + DV+++C AAEP+HGEKW   
Sbjct  851  KVDKARSWLNRAVTLAPDIGDFWAQLYKFELQHSGEDLQQDVIQRCTAAEPRHGEKWTKF  910

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VEN+H  T EIL+++V A K EE 
Sbjct  911  SKAVENAHFSTKEILKKIVLAAKDEET  937



>emb|CDX90885.1| BnaA03g25650D [Brassica napus]
Length=508

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K +KAR+W  RAVTL  DIGD WAL+Y+FE Q G+E  +N +L KCVA EPK GEKWQAI
Sbjct  420  KGEKARAWLKRAVTLNQDIGDHWALYYKFELQHGTEVRQNAILAKCVACEPKRGEKWQAI  479

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAA  347
            +K+VEN+H+P + IL +V+ AL KEE A 
Sbjct  480  SKAVENAHQPIEAILNKVLIALSKEEKAT  508



>ref|XP_001776889.1| predicted protein [Physcomitrella patens]
 gb|EDQ58292.1| predicted protein [Physcomitrella patens]
Length=946

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAVTLAPDIGDFWA  Y+FE Q   ED + DV+++C AAEP+HGEKW  +
Sbjct  859  KVDKARSWLNRAVTLAPDIGDFWAQLYKFELQHSGEDVQQDVIQRCSAAEPRHGEKWTKV  918

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VEN+H  T+ IL+++V A K EE 
Sbjct  919  SKAVENAHFSTEAILKKLVLAAKDEET  945



>emb|CDY48448.1| BnaA08g11570D [Brassica napus]
Length=911

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR +F R V L PD GDFWAL+Y+FE Q GSE+ + +VL +CV +EPKHGEKWQA+
Sbjct  822  KVDKARKYFERTVKLNPDNGDFWALYYKFEVQHGSEERQKEVLNRCVVSEPKHGEKWQAV  881

Query  433  AKSVENSHKPTDEILRQVVAALKKE  359
            +K++ENSH+  + IL++V  AL +E
Sbjct  882  SKALENSHQSVEVILKKVAIALNRE  906



>ref|XP_002961912.1| hypothetical protein SELMODRAFT_60593, partial [Selaginella moellendorffii]
 gb|EFJ37172.1| hypothetical protein SELMODRAFT_60593, partial [Selaginella moellendorffii]
Length=802

 Score =   113 bits (282),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KAR+W +RAVT APD+GDFWAL Y+FE+Q GSE    +V+ +C AAEPKHGE+W  +
Sbjct  717  KVEKARNWMNRAVTFAPDVGDFWALLYKFEQQHGSEAQLQEVVERCKAAEPKHGERWIRV  776

Query  433  AKSVENSHKPTDEILRQVVAALKKEE  356
            +K+VEN+H+ T+ IL++VVA   K+E
Sbjct  777  SKAVENAHQTTEFILKKVVAGFGKDE  802



>ref|XP_009108789.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
 ref|XP_009108790.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
 ref|XP_009108791.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
 ref|XP_009108792.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
 ref|XP_009108793.1| PREDICTED: protein STABILIZED1-like [Brassica rapa]
Length=962

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR +F R V L PD GDFWAL+Y+FE Q GSE+ + +VL +CV +EPKHGEKWQA+
Sbjct  873  KVDKARKYFERTVKLNPDNGDFWALYYKFEVQHGSEERQKEVLNRCVVSEPKHGEKWQAV  932

Query  433  AKSVENSHKPTDEILRQVVAALKKE  359
            +K++ENSH+  + IL++V  AL +E
Sbjct  933  SKALENSHQSVEVILKKVAIALNRE  957



>ref|XP_002971176.1| hypothetical protein SELMODRAFT_172051 [Selaginella moellendorffii]
 gb|EFJ27774.1| hypothetical protein SELMODRAFT_172051 [Selaginella moellendorffii]
Length=966

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KAR+W +RAVT APD+GDFWAL Y+FE+Q GSE    +V+ +C AAEPKHGE+W  +
Sbjct  872  KVEKARNWMNRAVTFAPDVGDFWALLYKFEQQHGSEAQLQEVVERCKAAEPKHGERWIRV  931

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VEN+H+ T+ IL++VVA   K+E 
Sbjct  932  SKAVENAHQTTEFILKKVVAGFGKDEG  958



>ref|XP_005651161.1| hypothetical protein COCSUDRAFT_27128 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26617.1| hypothetical protein COCSUDRAFT_27128 [Coccomyxa subellipsoidea 
C-169]
Length=947

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KARSWF+RA+ L PDIGDFWAL Y+FE QFG+ + +  V+ +C  A+P+HGE+WQ +
Sbjct  860  KVEKARSWFNRALLLKPDIGDFWALLYKFECQFGTPELQAAVVERCKKADPRHGERWQRM  919

Query  433  AKSVENSHKPTDEILRQVVAALKKE  359
            +K+ EN+HKPTD IL++VV  L KE
Sbjct  920  SKNPENAHKPTDFILKKVVLDLDKE  944



>emb|CDY28304.1| BnaC03g66550D [Brassica napus]
Length=902

 Score =   107 bits (268),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKAR +F R V L PD GDFWAL+Y+FE Q GSE+ + +VL +CV +EPKHGEKWQA+
Sbjct  793  KVDKARKYFERTVKLNPDNGDFWALYYKFEVQHGSEEKQKEVLNRCVVSEPKHGEKWQAV  852

Query  433  AKSVENSHKPTDEILRQ  383
            +K++ENSH+  + IL++
Sbjct  853  SKALENSHQSVEVILKK  869



>ref|XP_002987607.1| hypothetical protein SELMODRAFT_126394 [Selaginella moellendorffii]
 gb|EFJ11443.1| hypothetical protein SELMODRAFT_126394 [Selaginella moellendorffii]
Length=938

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW  RAV  APDIGDFWA+ YRFE++ GS +   +V+ +C AAEPKHGE+W  +
Sbjct  844  KVDKARSWIKRAVAAAPDIGDFWAVLYRFEQEHGSAEAIEEVVERCKAAEPKHGERWIRV  903

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VEN+H+  + +L +V A  +++++
Sbjct  904  SKAVENAHQGVEFVLGKVAAGFRRDDS  930



>ref|XP_001692638.1| splicing factor, component of the U4/U6-U5 snRNP complex [Chlamydomonas 
reinhardtii]
 gb|EDP03657.1| splicing factor, component of the U4/U6-U5 snRNP complex [Chlamydomonas 
reinhardtii]
Length=947

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KARSWF+RAVTL PDIGD WA FY+FE QFG+ + + DV  +C AAEP HGE+W  +
Sbjct  860  KVEKARSWFNRAVTLNPDIGDHWAQFYKFECQFGTPEQQADVSSRCAAAEPHHGERWCRV  919

Query  433  AKSVENSHKPTDEILRQVVA  374
            +K   N+H+P + +LR+ VA
Sbjct  920  SKDTRNAHQPPEVLLRRTVA  939



>ref|XP_005850880.1| hypothetical protein CHLNCDRAFT_34097 [Chlorella variabilis]
 gb|EFN58778.1| hypothetical protein CHLNCDRAFT_34097 [Chlorella variabilis]
Length=932

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSWF+RAVTL PD+GDFWA + +FE QFGS + +  V+++ +AAEP HGE+WQ +
Sbjct  847  KVDKARSWFNRAVTLNPDVGDFWASYLKFETQFGSPEQQEGVVKRFLAAEPHHGERWQRV  906

Query  433  AKSVENSHKPTDEILRQVVAALKKE  359
            AK    +H+ ++ +L++VV  L KE
Sbjct  907  AKDAACAHQKSEVVLKRVVLDLDKE  931



>ref|XP_002987646.1| hypothetical protein SELMODRAFT_126445 [Selaginella moellendorffii]
 gb|EFJ11221.1| hypothetical protein SELMODRAFT_126445 [Selaginella moellendorffii]
Length=938

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW  RAV  APDIGDFWA+ YRFE+  GS +   +V+ +C AAEPKHGE+W  +
Sbjct  844  KVDKARSWIKRAVAAAPDIGDFWAVLYRFEQGHGSTEAIEEVVERCKAAEPKHGEQWIRV  903

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            +K+VEN+H+  + +L +V A   +++ 
Sbjct  904  SKAVENAHQGVEFVLGKVAAGFGRDDG  930



>ref|XP_002952457.1| hypothetical protein VOLCADRAFT_62457 [Volvox carteri f. nagariensis]
 gb|EFJ46600.1| hypothetical protein VOLCADRAFT_62457 [Volvox carteri f. nagariensis]
Length=914

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +V+KARSWF+RAVTL PDIGD WA FY+FE QFG+ + + DV  +C AAEP HGE+W  +
Sbjct  827  QVEKARSWFNRAVTLNPDIGDHWAHFYKFECQFGTPEQQADVSSRCAAAEPHHGERWCRV  886

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K   N+H+P + +LR+ V  L
Sbjct  887  SKDPRNAHQPVEVLLRRTVQDL  908



>ref|XP_011399893.1| Pre-mRNA-processing factor 6 [Auxenochlorella protothecoides]
 gb|KFM26937.1| Pre-mRNA-processing factor 6 [Auxenochlorella protothecoides]
Length=761

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KARSWF RAVTL PD+GD WAL+ RFE   G+ +    VL + VAAEP+HGE+WQA+
Sbjct  674  KVEKARSWFDRAVTLDPDVGDHWALYLRFEAAHGTPEAAAAVLERAVAAEPRHGERWQAL  733

Query  433  AKSVENSHKPTDEILRQVVAALKKE  359
            AK   N+H+P   +L+++   ++K+
Sbjct  734  AKDPVNAHQPLGTLLKKLAQTIEKD  758



>ref|XP_004345122.1| pre-mRNA splicing factor [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95997.1| pre-mRNA splicing factor [Capsaspora owczarzaki ATCC 30864]
Length=916

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KA  WF RA+   PD+GD WA FY+F+ Q G+ + + DVL+KCVAAEP+HGE W  +
Sbjct  834  KVEKAAEWFRRAIGADPDLGDAWATFYKFQLQHGTANDQQDVLQKCVAAEPRHGEHWTRV  893

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +KS+EN +KPT E+L Q+V+AL
Sbjct  894  SKSIENWNKPTAELL-QLVSAL  914



>gb|KIP06848.1| hypothetical protein PHLGIDRAFT_72114 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=923

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KAR WF RAV + PD+GD W  + +FE Q G  + + D++R+CVAAEP HG  WQAI
Sbjct  841  KIEKARQWFERAVNINPDLGDVWGWWLKFERQHGVPERQEDIIRRCVAAEPHHGATWQAI  900

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK V N+ K   EIL  VVAALK
Sbjct  901  AKDVTNTGKTATEILELVVAALK  923



>ref|XP_002440334.1| hypothetical protein SORBIDRAFT_09g029846 [Sorghum bicolor]
 gb|EES18764.1| hypothetical protein SORBIDRAFT_09g029846 [Sorghum bicolor]
Length=72

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -3

Query  550  FWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAIAKSVENSHKPTDEILRQVVAA  371
            FWAL+Y+FE + G+ D + DVL++CVA+EPKHGEKWQAI+K+VENSH P + +L++ V  
Sbjct  1    FWALYYKFELEHGNADTQKDVLKRCVASEPKHGEKWQAISKTVENSHLPVEALLKKAVVV  60

Query  370  LKKEEN  353
            L  EEN
Sbjct  61   LDVEEN  66



>ref|XP_003059661.1| mRNA splicing protein [Micromonas pusilla CCMP1545]
 gb|EEH55613.1| mRNA splicing protein [Micromonas pusilla CCMP1545]
Length=939

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKAR WF+RAVTL PD+GD WA +++FE + G ED  N V+++C  A PKHGE W  +
Sbjct  854  KMDKARGWFNRAVTLNPDVGDHWAAYFKFETRHGDEDAVNAVVKRCAEAAPKHGEAWCRV  913

Query  433  AKSVENSHKPTDEILRQ  383
            AK VEN H+P D +LR+
Sbjct  914  AKRVENWHEPVDALLRK  930



>ref|XP_004336141.1| pre-mRNA-splicing factor prp1, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR14128.1| pre-mRNA-splicing factor prp1, putative [Acanthamoeba castellanii 
str. Neff]
Length=144

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAV L PD+GD WA FY+FE+Q G+E    +++ +CV  +P+HG  W  +
Sbjct  60   KVDKARSWLNRAVVLNPDLGDTWAYFYKFEKQQGTEQSLAELVARCVRTDPRHGRYWTRV  119

Query  433  AKSVENSHKPTDEILRQVVAAL  368
             K+ EN+   TDE+L+ V A+L
Sbjct  120  RKAPENARLKTDEVLKLVAASL  141



>gb|EPT05134.1| hypothetical protein FOMPIDRAFT_1155763 [Fomitopsis pinicola 
FP-58527 SS1]
Length=922

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KAR WF RA+T  PD+GD W  + +FE Q G+ + + +V+RKCVA EP HG  WQ+I
Sbjct  840  KIEKARQWFERAITANPDLGDNWGWWLKFERQHGNPEQQEEVVRKCVAIEPHHGPTWQSI  899

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK+++NS K T+EIL  VV ALK
Sbjct  900  AKALKNSRKSTNEILELVVDALK  922



>ref|XP_004211508.1| PREDICTED: pre-mRNA-processing factor 6-like, partial [Hydra 
vulgaris]
Length=281

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KAR WF+R V + PD GD WA FY+FE   G+E  +  ++ +CV +EP+HGE W  I
Sbjct  194  KLNKAREWFNRTVKIDPDFGDAWAYFYKFELAHGTEANQKSIMERCVKSEPRHGEMWNQI  253

Query  433  AKSVENSHKPTDEILRQVVAALKKEEN  353
            AKS +N  K TDEIL  V   LK  EN
Sbjct  254  AKSTKNWRKKTDEILPIVARTLKPVEN  280



>ref|XP_007399273.1| hypothetical protein PHACADRAFT_31805 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM52026.1| hypothetical protein PHACADRAFT_31805 [Phanerochaete carnosa 
HHB-10118-sp]
Length=922

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KAR WF RAV + PD+GD WA + +FE Q G+ + + +V+++CVAAEP HG+ WQA+
Sbjct  840  KIEKARQWFERAVKINPDLGDVWAWWLKFERQHGTREHQEEVIKRCVAAEPHHGQIWQAL  899

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK +EN+ K T ++L  V A LK
Sbjct  900  AKDMENTGKSTRDVLELVAAELK  922



>ref|XP_007864021.1| hypothetical protein GLOTRDRAFT_115025 [Gloeophyllum trabeum 
ATCC 11539]
 gb|EPQ56815.1| hypothetical protein GLOTRDRAFT_115025 [Gloeophyllum trabeum 
ATCC 11539]
Length=926

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KAR WF RAV    D+GD WA +Y+FE Q G+++ + +V+++CVAAEP HG  WQA 
Sbjct  844  KIEKARQWFERAVKTNEDLGDIWAWWYKFELQHGTKEHQEEVVKRCVAAEPHHGPVWQAT  903

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK ++N+ K T+EIL+ V AAL
Sbjct  904  AKDIKNTGKTTEEILKLVAAAL  925



>ref|XP_003050871.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU45158.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=927

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA++WF +A+ L  D GD WA +YRF  Q G+E+ R DV+ KCV  EP+HGE WQA+
Sbjct  845  KLDKAQNWFEKALVLDSDCGDSWAWYYRFLCQHGTEEKRADVVTKCVLNEPRHGEAWQAV  904

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  EN+ K  +EIL+ V A L+
Sbjct  905  AKKPENARKSCEEILKMVAAELE  927



>ref|XP_001422607.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00924.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=847

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKARSW++RAVT+APDIGD WA +Y+FE Q   E     V  +C  A P+HGE W A+
Sbjct  758  KLDKARSWWNRAVTIAPDIGDHWASYYKFELQTAGEQAAQAVAERCARAAPRHGENWSAM  817

Query  433  AKSVENSHKPTDEILRQVVAA  371
             K VEN H P  EIL++V A 
Sbjct  818  RKRVENWHDPVIEILKKVAAG  838



>gb|ESA12445.1| hypothetical protein GLOINDRAFT_323384 [Rhizophagus irregularis 
DAOM 181602]
Length=527

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDK R+WF +AV + PD GD WA FY+FE Q G+E  + DV+ +CV AEP HGE+WQ +
Sbjct  445  KVDKGRTWFEKAVKVDPDRGDSWAWFYKFECQHGTEQQQQDVITRCVTAEPHHGEQWQIV  504

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK ++N  K  +EIL+ V   L
Sbjct  505  AKDMKNVGKSIEEILKLVSNVL  526



>ref|XP_007928062.1| hypothetical protein MYCFIDRAFT_72157 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME81264.1| hypothetical protein MYCFIDRAFT_72157 [Pseudocercospora fijiensis 
CIRAD86]
Length=934

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA SWF +AVTL PD+GD WA +Y+F  Q G+E+ +  ++++C A EPKHGE WQ +
Sbjct  852  KLDKADSWFLKAVTLDPDLGDSWAWWYKFLVQHGTEEKQEQIIKQCTANEPKHGEVWQTV  911

Query  433  AKSVENSHKPTDEILRQVVAAL  368
             K+ ENS K T+E+L+ V  A+
Sbjct  912  RKAPENSRKTTEEVLKLVAKAM  933



>gb|EXX58698.1| Prp6p [Rhizophagus irregularis DAOM 197198w]
Length=893

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDK R+WF +AV + PD GD WA FY+FE Q G+E  + DV+ +CV AEP HGE+WQ +
Sbjct  811  KVDKGRTWFEKAVKVDPDRGDSWAWFYKFECQHGTEQQQQDVITRCVTAEPHHGEQWQIV  870

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK ++N  K  +EIL+ V   L
Sbjct  871  AKDMKNVGKSIEEILKLVSNVL  892



>ref|XP_009168850.1| hypothetical protein T265_05545 [Opisthorchis viverrini]
 gb|KER27364.1| hypothetical protein T265_05545 [Opisthorchis viverrini]
Length=937

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -3

Query  610  VDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAIA  431
            V KAR+WF+R V L PD+GD WA FY+FE Q G+ED + +VLR+CV+AEP HGE W  IA
Sbjct  853  VSKARNWFTRTVKLEPDLGDAWAYFYKFELQHGTEDQQKEVLRRCVSAEPHHGEAWCRIA  912

Query  430  KSVENSHKPTDEILRQVVAAL  368
            K+  N    T E+L +V  A+
Sbjct  913  KAPCNWRLKTKEVLARVAEAV  933



>dbj|GAD98637.1| pre-mRNA-splicing factor prp1 [Byssochlamys spectabilis No. 5]
Length=940

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+E+ R DV+ KCVA EPKHGE WQ++
Sbjct  858  RLEKAMTWFEKAIVANSDLGDAWAWYYKFLLQHGTEEKRADVMSKCVATEPKHGEVWQSV  917

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK   N++K T+EIL+ VV  L
Sbjct  918  AKDPANAYKTTEEILKMVVERL  939



>gb|KFY25220.1| hypothetical protein V491_01858 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=932

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  850  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  909

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VVA L+
Sbjct  910  AKDPKNASKKTVEILKSVVARLE  932



>gb|KFY86443.1| hypothetical protein V500_07632 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=932

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  850  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  909

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VVA L+
Sbjct  910  AKDPKNASKKTIEILKTVVARLE  932



>gb|KFY09690.1| hypothetical protein V492_05381 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=932

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  850  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  909

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VVA L+
Sbjct  910  AKDPKNASKKTVEILKTVVARLE  932



>ref|XP_004339973.1| PRP1 splicing factor, Nterminal/tetratricopeptide repeat domain 
containing protein [Acanthamoeba castellanii str. Neff]
 gb|ELR17957.1| PRP1 splicing factor, Nterminal/tetratricopeptide repeat domain 
containing protein [Acanthamoeba castellanii str. Neff]
Length=946

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSW +RAV L PD+GD WA FY+FE+Q G+E    +++ +CV  +P+HG  W  +
Sbjct  862  KVDKARSWLNRAVVLNPDLGDTWAYFYKFEKQQGTEQSLAELVARCVRTDPRHGRYWTRV  921

Query  433  AKSVENSHKPTDEILRQVVAAL  368
             K+ EN+   TDE+L+ V A+L
Sbjct  922  RKAPENARLKTDEVLKLVAASL  943



>gb|KFH47477.1| Pre-mRNA-splicing factor-like protein [Acremonium chrysogenum 
ATCC 11550]
Length=927

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA+SWF +A+ L  D GD WA +YRF  Q G+E+ R DV+ KCV  EP+HGE WQ +
Sbjct  844  KLDKAQSWFEKALVLDSDQGDSWAWYYRFLCQHGTEEKRADVVTKCVLNEPRHGEVWQTV  903

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK  +N+ K T+EIL+ V A L++
Sbjct  904  AKDPKNARKGTEEILKLVAAELEE  927



>ref|XP_001215979.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU33345.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=936

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+E+ R DV+ KCVA EPKHGE WQ++
Sbjct  854  RLEKAMTWFEKAIVSDSDLGDGWAWYYKFLLQHGTEEKRADVISKCVATEPKHGEVWQSV  913

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK   N+HK T+EIL+ V + +
Sbjct  914  AKDPANAHKSTEEILKMVASQI  935



>ref|XP_006820857.1| PREDICTED: pre-mRNA-processing factor 6-like, partial [Saccoglossus 
kowalevskii]
Length=351

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF+R V + PD+GD WA FY+FE Q G+E+ + DV +KC+ AEP+HGE W ++
Sbjct  266  KLSKAREWFNRTVKIEPDLGDAWAYFYKFELQNGNEEQQEDVRKKCINAEPRHGELWCSV  325

Query  433  AKSVENSHKPTDEIL  389
            AK + N  K T+E+L
Sbjct  326  AKDIVNWRKKTEELL  340



>dbj|GAA98462.1| hypothetical protein E5Q_05148 [Mixia osmundae IAM 14324]
 gb|KEI40380.1| hypothetical protein L969DRAFT_87027 [Mixia osmundae IAM 14324]
Length=907

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKAR+WF RAV   PD+GD WA F RFE+Q GS++ +  V+ +C+AAEP H E WQ +
Sbjct  824  KLDKARAWFERAVNANPDLGDVWAWFLRFEQQHGSKEQQESVVSRCIAAEPHHAEAWQRV  883

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K   N+   T E+LR V A L
Sbjct  884  SKDPANARLRTGEVLRLVAAEL  905



>ref|XP_001654491.1| AAEL010387-PA [Aedes aegypti]
 gb|EAT37642.1| AAEL010387-PA [Aedes aegypti]
Length=931

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ K R WF+R + + PD GD WA FY+FE Q G+E  + D+L +CVAAEPKHGE+W  +
Sbjct  846  KIQKCRDWFNRTIKIDPDFGDAWAYFYKFELQHGTEQQQKDLLERCVAAEPKHGEEWCRV  905

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K + N    TDE+L+ VV  L
Sbjct  906  SKDIANWCFKTDEVLKAVVKIL  927



>dbj|GAA37598.2| pre-mRNA-processing factor 6 [Clonorchis sinensis]
Length=937

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -3

Query  610  VDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAIA  431
            V KAR+WF+R V L PD+GD WA FY+FE Q G+ED + +VLR+CV AEP HGE W  IA
Sbjct  853  VSKARNWFTRTVKLEPDLGDAWAYFYKFELQHGTEDQQKEVLRRCVNAEPHHGEAWCRIA  912

Query  430  KSVENSHKPTDEILRQVVAAL  368
            K+  N    T E+L +V  A+
Sbjct  913  KAPCNWRLKTKEVLARVAEAV  933



>ref|XP_002541419.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gb|EEP76086.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
Length=920

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+E+ R DV+ KC+A+EPKHGE WQ I
Sbjct  838  RLEKAMTWFEKAIVADSDLGDVWAWYYKFLMQHGTEEKREDVINKCIASEPKHGEIWQTI  897

Query  433  AKSVENSHKPTDEILR  386
            AK   N+HK T+EIL+
Sbjct  898  AKDPVNAHKSTEEILK  913



>gb|KFX90591.1| hypothetical protein V490_06379, partial [Pseudogymnoascus pannorum 
VKM F-3557]
Length=803

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  721  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  780

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VV  L+
Sbjct  781  AKDPKNASKKTVEILKTVVTLLE  803



>gb|KFY33094.1| hypothetical protein V495_08436, partial [Pseudogymnoascus pannorum 
VKM F-4514 (FW-929)]
Length=812

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  730  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  789

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VV  L+
Sbjct  790  AKDPKNASKKTVEILKTVVTLLE  812



>gb|EME42147.1| hypothetical protein DOTSEDRAFT_154718 [Dothistroma septosporum 
NZE10]
Length=934

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA +WF +AV L PD GD WA +Y+F  Q G+E+ R DV+ KCVA +PKHGE WQ I
Sbjct  852  KLDKADTWFQKAVILDPDYGDTWAWWYKFLLQHGTEEKRGDVVSKCVANDPKHGEVWQRI  911

Query  433  AKSVENSHKPTDEILRQVVAALK  365
             K+ EN+ K T+E+L  V   L+
Sbjct  912  RKAPENAGKTTEEVLMIVAKTLE  934



>gb|EMD40178.1| hypothetical protein CERSUDRAFT_112388 [Ceriporiopsis subvermispora 
B]
Length=922

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KAR WF RAV   PD+GD W  + +FE Q G+ + + DV++KCVAAEP H   WQ+I
Sbjct  840  KIEKARQWFERAVAANPDLGDTWGWWLKFERQHGTPEYQEDVIKKCVAAEPHHSSTWQSI  899

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK ++N+ K T EIL  V  AL
Sbjct  900  AKDMKNTGKSTSEILELVANAL  921



>gb|KFY56054.1| hypothetical protein V497_06554 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=932

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  850  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  909

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VV  L+
Sbjct  910  AKDPKNASKKTVEILKTVVTLLE  932



>gb|KFA66994.1| hypothetical protein S40285_06268 [Stachybotrys chlorohalonata 
IBT 40285]
Length=925

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA++WF +A+ L  D GD WA +YRF +Q G+E+ R +V+ KCV  EP+HGE WQA+
Sbjct  842  KLDKAQNWFEKALVLDSDNGDTWAWYYRFLKQHGTEEKRAEVVSKCVLNEPRHGEVWQAV  901

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK+  N+ K T+E+L  V A L++
Sbjct  902  AKNPRNAMKSTEELLHLVAAELEQ  925



>gb|KFY26833.1| hypothetical protein V493_03848 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=932

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  850  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  909

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VV  L+
Sbjct  910  AKDPKNASKKTIEILKTVVGRLE  932



>gb|KFX95665.1| hypothetical protein O988_05708 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=932

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  850  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  909

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VV  L+
Sbjct  910  AKDPKNASKKTVEILKTVVTLLE  932



>gb|KFY62438.1| hypothetical protein V496_04599 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY96555.1| hypothetical protein V498_02611 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=932

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EPKHGE WQ++
Sbjct  850  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPKHGEIWQSV  909

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VV  L+
Sbjct  910  AKDPKNASKKTIEILKIVVTRLE  932



>gb|KFZ00816.1| hypothetical protein V501_10443 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=910

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  828  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  887

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VV  L+
Sbjct  888  AKDPKNASKKTVEILKTVVTRLE  910



>gb|KFY33702.1| hypothetical protein V494_07399 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=932

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  850  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  909

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VV  L+
Sbjct  910  AKDPKNASKKTVEILKTVVTRLE  932



>gb|KFY79538.1| hypothetical protein V499_01470 [Pseudogymnoascus pannorum VKM 
F-103]
Length=932

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  850  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  909

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VV  L+
Sbjct  910  AKDPKNASKKTVEILKTVVTRLE  932



>gb|EWM28197.1| pre-mrna-processing factor 6 [Nannochloropsis gaditana]
Length=870

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K  KAR WF+++V L PD+GD WA +Y FE + GSE  +++VL+ C+ A+P HGE W A+
Sbjct  760  KYAKARKWFNQSVELNPDLGDSWAYYYAFELRHGSETDKSEVLKNCLEADPTHGEIWTAV  819

Query  433  AKSVENSHKPTDEILRQVVAALKKEENAAEINEP  332
            +KSVEN     + IL++VVA L +E    E +EP
Sbjct  820  SKSVENWRLSKESILKKVVAKL-QESAVEETSEP  852



>ref|XP_002623897.1| pre-mRNA splicing factor prp1 [Blastomyces dermatitidis SLH14081]
 gb|EEQ70412.1| pre-mRNA splicing factor prp1 [Blastomyces dermatitidis SLH14081]
 gb|EEQ87723.1| pre-mRNA splicing factor prp1 [Blastomyces dermatitidis ER-3]
 gb|EGE77679.1| pre-mRNA-splicing factor [Blastomyces dermatitidis ATCC 18188]
 gb|EQL32655.1| hypothetical protein BDFG_05198 [Blastomyces dermatitidis ATCC 
26199]
Length=941

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA +WF +A+    D+GD WA +Y+F  Q G+++ R DV+ KC++ EPKHGE WQ I
Sbjct  859  RLDKAMTWFEKAIVSNSDLGDVWAWYYKFLLQHGTDEKREDVISKCISNEPKHGEVWQFI  918

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK   N+HK T+EIL+   A L+
Sbjct  919  AKDPANAHKSTEEILKLTAARLE  941



>gb|EEH38074.2| pre-mRNA-splicing factor prp1 [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=941

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA +WF +A+    D+GD WA +Y+F  Q G+++ R DV+ KCV++EPKHGE WQ+I
Sbjct  859  KLDKAMTWFEKAIVSNNDLGDVWAWYYKFLLQHGTDEKREDVISKCVSSEPKHGEIWQSI  918

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK   N+ K T+EIL+   A L+
Sbjct  919  AKDPANADKSTEEILKLTAARLE  941



>ref|XP_010759201.1| hypothetical protein PADG_03832 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH47748.2| hypothetical protein PADG_03832 [Paracoccidioides brasiliensis 
Pb18]
Length=941

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA +WF +A+    D+GD WA +Y+F  Q G+++ R DV+ KCV++EPKHGE WQ+I
Sbjct  859  KLDKAMTWFEKAIVSNNDLGDVWAWYYKFLLQHGTDEKREDVISKCVSSEPKHGEIWQSI  918

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK   N+ K T+EIL+   A L+
Sbjct  919  AKDPANADKSTEEILKLTAARLE  941



>gb|EEH18937.1| hypothetical protein PABG_01256 [Paracoccidioides brasiliensis 
Pb03]
Length=941

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA +WF +A+    D+GD WA +Y+F  Q G+++ R DV+ KCV++EPKHGE WQ+I
Sbjct  859  KLDKAMTWFEKAIVSNNDLGDVWAWYYKFLLQHGTDEKREDVISKCVSSEPKHGEIWQSI  918

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK   N+ K T+EIL+   A L+
Sbjct  919  AKDPANADKSTEEILKLTAARLE  941



>emb|CBJ28499.1| conserved unknown protein [Ectocarpus siliculosus]
Length=827

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K  KAR WF+RA+TL P++GD WA +Y FE Q G+E  + DVL +CVAAEP HGE W ++
Sbjct  729  KYAKARKWFNRAITLDPNMGDAWAAYYAFELQQGTEVEQKDVLDRCVAAEPAHGELWTSV  788

Query  433  AKSVENSHKPTDEILRQVVAA  371
            +K+ EN       IL++VVAA
Sbjct  789  SKTTENRRLDKASILKKVVAA  809



>ref|XP_003661115.1| hypothetical protein MYCTH_2057284 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO55870.1| hypothetical protein MYCTH_2057284 [Myceliophthora thermophila 
ATCC 42464]
Length=894

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+D+A++WF RA+ L  D+GD WA +Y+F  Q G+E+ R +++ KCV  +P+HGE WQAI
Sbjct  812  KLDRAQNWFERALLLDRDMGDTWAWYYKFLSQHGTEEKRAELVAKCVLNDPRHGEHWQAI  871

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK  +N+ K T+EIL+ V A+L
Sbjct  872  AKDPKNAGKKTEEILKLVAASL  893



>gb|EIT73004.1| HAT repeat protein [Aspergillus oryzae 3.042]
 gb|KDE85493.1| HAT repeat protein [Aspergillus oryzae 100-8]
Length=938

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+E+ R DV+ KC++ EPKHGE WQ++
Sbjct  856  RLEKAMTWFEKAIVSDSDLGDGWAWYYKFLLQHGTEEKRADVVSKCISTEPKHGEVWQSV  915

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK+  N+HK T+EIL+ V   L
Sbjct  916  AKNPANAHKSTEEILKMVAERL  937



>gb|ELR10680.1| pre-mRNA-processing factor 6 [Pseudogymnoascus destructans 20631-21]
Length=932

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF R + L PD+GD WA +Y+F  Q G+++ R DV  KC+ +EP+HGE WQ++
Sbjct  850  KLEKAQNWFERGIALDPDLGDTWAWYYKFLMQHGTDEKRADVEAKCILSEPRHGEIWQSV  909

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K T EIL+ VV  L+
Sbjct  910  AKDPKNASKKTVEILKAVVTRLE  932



>ref|XP_002382213.1| mRNA splicing factor (Prp1/Zer1), putative [Aspergillus flavus 
NRRL3357]
 gb|EED48797.1| mRNA splicing factor (Prp1/Zer1), putative [Aspergillus flavus 
NRRL3357]
Length=938

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+E+ R DV+ KC++ EPKHGE WQ++
Sbjct  856  RLEKAMTWFEKAIVSDSDLGDGWAWYYKFLLQHGTEEKRADVVSKCISTEPKHGEVWQSV  915

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK+  N+HK T+EIL+ V   L
Sbjct  916  AKNPANAHKSTEEILKMVAERL  937



>ref|XP_001819214.1| pre-mRNA-splicing factor prp1 [Aspergillus oryzae RIB40]
 dbj|BAE57212.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=938

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+E+ R DV+ KC++ EPKHGE WQ++
Sbjct  856  RLEKAMTWFEKAIVSDSDLGDGWAWYYKFLLQHGTEEKRADVVSKCISTEPKHGEVWQSV  915

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK+  N+HK T+EIL+ V   L
Sbjct  916  AKNPANAHKSTEEILKMVAERL  937



>ref|XP_002564821.1| Pc22g08050 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP98093.1| Pc22g08050 [Penicillium rubens Wisconsin 54-1255]
Length=937

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+ L  D GD WA +Y+F  Q G+E+ R+DV+ KC++ EPKHGE WQ+I
Sbjct  855  RLEKAMTWFEKAIVLDSDYGDGWAWYYKFLMQHGTEEKRSDVVSKCISMEPKHGEVWQSI  914

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK   N++K T+EIL+ V + +
Sbjct  915  AKDPVNAYKTTEEILKLVASTI  936



>gb|EFQ29104.1| PRP1 splicing factor [Colletotrichum graminicola M1.001]
Length=925

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF +A+ L  D GD WA +YRF  Q G+++ R DV+ KCV  EP+HGE WQAI
Sbjct  842  KLEKAQNWFEKALVLDSDNGDTWAWYYRFLLQHGTDEKRADVINKCVLNEPRHGEYWQAI  901

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK   N+ K T+E+L  V  AL+K
Sbjct  902  AKQPVNARKGTEEVLEMVADALEK  925



>gb|EMF12502.1| mRNA splicing factor [Sphaerulina musiva SO2202]
Length=946

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA +WF +AVTL PD GD WA +Y+F  Q G+E+    V+  CV  EPKHGEKW AI
Sbjct  864  KLDKADTWFKKAVTLDPDYGDSWAWWYKFLLQHGTEEKVRQVVESCVENEPKHGEKWAAI  923

Query  433  AKSVENSHKPTDEILRQVVAALK  365
             K+ EN  K T+E+L+ V  AL+
Sbjct  924  RKAPENGGKTTEEVLKMVAKALE  946



>ref|XP_008612817.1| hypothetical protein SDRG_08701 [Saprolegnia diclina VS20]
 gb|EQC33594.1| hypothetical protein SDRG_08701 [Saprolegnia diclina VS20]
Length=953

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR W  R V L PD GD WA +Y FE + G+E  R+ VL +CV AEP+HGE W AI
Sbjct  865  KITKARKWLERTVQLNPDFGDGWATYYAFELKDGNESQRSSVLERCVQAEPRHGELWCAI  924

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K      KPT E+L+ VVA+L
Sbjct  925  SKQTAYRKKPTRELLKLVVASL  946



>gb|KDO29186.1| hypothetical protein SPRG_05428 [Saprolegnia parasitica CBS 223.65]
Length=952

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR W  R V L PD GD WA +Y FE + G+E  R+ VL +CV AEP+HGE W AI
Sbjct  864  KITKARKWLERTVQLNPDFGDGWATYYAFELKDGNESQRSSVLERCVQAEPRHGELWCAI  923

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K      KPT E+L+ VVA+L
Sbjct  924  SKQTAYRKKPTRELLKLVVASL  945



>gb|AAM11188.1| LD43276p [Drosophila melanogaster]
Length=143

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 54/82 (66%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K  K R WF+R V + PD+GD WA FY+FE   G+E  + +VL +C++AEP HGE W  +
Sbjct  58   KFSKCRDWFNRTVKIDPDLGDAWAYFYKFELLHGTEAQQQEVLDRCISAEPTHGESWCRV  117

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K+++N    T E+LR VV  L
Sbjct  118  SKNIQNWQFKTPEVLRAVVREL  139



>ref|XP_009216412.1| pre-mRNA-splicing factor prp1, variant [Gaeumannomyces graminis 
var. tritici R3-111a-1]
 gb|EJT80402.1| pre-mRNA-splicing factor prp1, variant [Gaeumannomyces graminis 
var. tritici R3-111a-1]
Length=864

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+++A+SWF +A+ L  D+GD WA +YRF  Q G+++ R DV+ KCV+ +P+HGE+WQA+
Sbjct  781  KLERAQSWFEKALVLDADVGDSWAWYYRFLMQHGTDEKRVDVVAKCVSNDPRHGERWQAV  840

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK   N+ K  +++L+ V A+L+
Sbjct  841  AKDPRNARKSVEDVLKLVAASLQ  863



>gb|KEZ38670.1| Pre-mRNA-splicing factor prp1 [Scedosporium apiospermum]
Length=927

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA+SWF +A+ L  D GD WA +Y+F  Q G+E+ R +V+ KC+  EP+HGE WQ I
Sbjct  844  KLDKAQSWFEKALVLDSDNGDTWAWYYKFLLQHGTEEKRGEVISKCIMNEPRHGEYWQRI  903

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK  +N+ K  +EIL+ V AAL +
Sbjct  904  AKDPKNARKGIEEILKLVAAALDR  927



>ref|XP_003726277.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6-like 
[Strongylocentrotus purpuratus]
Length=1066

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             K+ KAR WF+R V + PD+GD WA FYRFE  +G+E+ +  V  +C+ AEP HGE W A+
Sbjct  982   KLTKAREWFTRTVKIEPDLGDAWAYFYRFELLYGNEEQQKTVRDRCILAEPHHGETWCAV  1041

Query  433   AKSVENSHKPTDEIL  389
             +K +EN  K TDEIL
Sbjct  1042  SKGIENWRKKTDEIL  1056



>ref|XP_003648601.1| hypothetical protein THITE_129437 [Thielavia terrestris NRRL 
8126]
 gb|AEO62265.1| hypothetical protein THITE_129437 [Thielavia terrestris NRRL 
8126]
Length=1045

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             K+D+A++WF RA+ L  D+GD WA +YRF  Q G+++ R +++ KCV  +P+HGE WQA+
Sbjct  963   KLDRAQNWFERALLLDRDLGDTWAWYYRFLSQHGTDEKRAELVAKCVLNDPRHGEHWQAV  1022

Query  433   AKSVENSHKPTDEILRQVVAAL  368
             AK  +N+ K T+EIL+ V A+L
Sbjct  1023  AKDPKNAGKSTEEILKLVAASL  1044



>gb|KIW10029.1| hypothetical protein PV08_11805 [Exophiala spinifera]
Length=945

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA SWF +A+ L PD+GD WA + +F  Q G+E+ R DV+ KC+A EPKHGE WQ +
Sbjct  858  RLDKAMSWFEKAIVLDPDLGDTWAWYLKFLMQHGTEEKREDVINKCIATEPKHGEVWQRV  917

Query  433  AKSVENSHKPTDEILRQVVAALKKEENA  350
             K  +N++  T E+L +V   L+ ++ A
Sbjct  918  RKDPKNAYLSTKEVLMEVTKKLEAKDIA  945



>gb|EJW87682.1| pre-mRNA-splicing factor prp1, partial [Wuchereria bancrofti]
Length=629

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD GD WA FY+FE   GS++ ++ V +KC+ AEP+HGE WQ +
Sbjct  544  KIRKAREWFQRTVKIDPDFGDAWAFFYKFELLHGSQEEQDLVKKKCLQAEPRHGELWQEV  603

Query  433  AKSVENSHKPTDEILRQV  380
            +K VEN  K TDEIL ++
Sbjct  604  SKDVENWRKRTDEILAEL  621



>gb|KIW59212.1| hypothetical protein PV05_03677 [Exophiala xenobiotica]
Length=725

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA SWF +A+ L PD+GD WA + +F  Q G+++ R DV+ KCV+AEPKHGE WQ +
Sbjct  637  RLDKAMSWFEKAIVLDPDLGDTWAWYLKFVMQHGTDEKREDVISKCVSAEPKHGEVWQRV  696

Query  433  AKSVENSHKPTDEILRQVVAALKKEE  356
             K  +N++  T E+L +V+  L+ ++
Sbjct  697  RKDPKNAYLSTKEVLMEVMKQLETKD  722



>ref|XP_010075747.1| PREDICTED: pre-mRNA-processing factor 6-like [Pterocles gutturalis]
Length=142

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V +  D+GD WA FY+FE Q G+E+ + +V ++C  AEP+HGE W  +
Sbjct  57   KITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCDV  116

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K +EN  K   EIL  V A LK
Sbjct  117  SKDIENWQKKIGEILVLVAAKLK  139



>gb|KDN61144.1| putative PRP1 splicing factor [Colletotrichum sublineola]
Length=925

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF +A+ L  D GD WA +Y+F  Q G+++ R DV+ KCV  EP+HGE WQAI
Sbjct  842  KLEKAQNWFEKALVLDSDNGDTWAWYYKFLLQHGTDEKRADVINKCVMNEPRHGEYWQAI  901

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK   N+ K T+E+L  V  AL+K
Sbjct  902  AKQPANARKGTEEVLMMVAEALEK  925



>ref|XP_007909448.1| PREDICTED: pre-mRNA-processing factor 6 [Callorhinchus milii]
Length=959

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD+GD WALFY+FE Q G+ED + DV ++C  AEP+HGE W  +
Sbjct  874  KITKAREWFHRTVKIDPDLGDAWALFYKFELQHGTEDQQEDVKKRCENAEPRHGELWCEV  933

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K ++N  +   EIL  V A +K
Sbjct  934  SKDIKNWQRKIGEILMLVAAQIK  956



>ref|XP_003144592.1| U5 snRNP-associated protein [Loa loa]
 gb|EFO19478.1| U5 snRNP-associated protein [Loa loa]
Length=970

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD GD WA FY+FE   GS++ ++ V +KC+ AEP+HGE WQ +
Sbjct  885  KIRKAREWFQRTVKIDPDFGDAWAFFYKFELLHGSQEEQDLVKKKCLQAEPRHGELWQEV  944

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K VEN  K TDEIL ++   L+
Sbjct  945  SKDVENWRKRTDEILAELAEKLE  967



>ref|XP_008299806.1| PREDICTED: pre-mRNA-processing factor 6 [Stegastes partitus]
Length=969

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD+GD WALFY+FE Q G+E+ + +V ++C  AEP+HGE W A 
Sbjct  884  KITKAREWFLRTVKIEPDLGDAWALFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAE  943

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K V N  K T EIL QV + +K
Sbjct  944  SKHVLNWQKKTGEILAQVASKIK  966



>ref|XP_007597771.1| PRP1 splicing factor [Colletotrichum fioriniae PJ7]
 gb|EXF78606.1| PRP1 splicing factor [Colletotrichum fioriniae PJ7]
Length=925

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF +A+ L  D GD WA +Y+F  Q G+++ R DV+ KCV  EP+HGE WQAI
Sbjct  842  KLEKAQNWFEKALVLDSDNGDTWAWYYKFLLQHGTDEKRADVINKCVLNEPRHGEHWQAI  901

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK   N+ K T+EIL+ V   L+K
Sbjct  902  AKQPTNARKGTEEILKLVAEVLEK  925



>ref|XP_001866982.1| pre-mRNA-splicing factor prp1 [Culex quinquefasciatus]
 gb|EDS44272.1| pre-mRNA-splicing factor prp1 [Culex quinquefasciatus]
Length=931

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ K R WF+R + + PD GD WA +Y+FE Q G+E  + ++L +CV AEPKHGE+W  +
Sbjct  846  KIQKCRDWFNRTIKIDPDFGDSWAYYYKFELQHGTEQQQKELLERCVVAEPKHGEEWCRV  905

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K + N    TDE+LR VV  L
Sbjct  906  SKDIANWCLKTDEVLRAVVKVL  927



>gb|ERG86119.1| pre-mrna-processing factor 6 [Ascaris suum]
Length=931

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV KAR WF R V + PD GD WA FY+FE   G+ED +  V +KC+ AEP+HGE+WQ +
Sbjct  846  KVKKAREWFQRTVKIDPDFGDAWAYFYKFELLHGTEDEQEHVKKKCMQAEPRHGERWQEV  905

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K V N  K T+EIL ++   L+
Sbjct  906  SKDVRNWRKRTEEILVELANHLE  928



>ref|XP_009216411.1| pre-mRNA-splicing factor prp1 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT80403.1| pre-mRNA-splicing factor prp1 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=987

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+++A+SWF +A+ L  D+GD WA +YRF  Q G+++ R DV+ KCV+ +P+HGE+WQA+
Sbjct  904  KLERAQSWFEKALVLDADVGDSWAWYYRFLMQHGTDEKRVDVVAKCVSNDPRHGERWQAV  963

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK   N+ K  +++L+ V A+L+
Sbjct  964  AKDPRNARKSVEDVLKLVAASLQ  986



>ref|XP_003715425.1| pre-mRNA-splicing factor prp1, variant [Magnaporthe oryzae 70-15]
 gb|EHA55618.1| pre-mRNA-splicing factor prp1, variant [Magnaporthe oryzae 70-15]
Length=730

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+D+A++WF +A+ L  D+GD WA +Y+F  Q G+E+ R DV+ KCVA +P+HGE WQ +
Sbjct  646  KLDRAQTWFEKALLLDGDVGDSWAWYYKFLLQHGTEEKRADVVAKCVAVDPRHGEHWQPV  705

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK  +N+ K  +EIL  V A+L
Sbjct  706  AKDPKNAKKSVEEILTLVAASL  727



>gb|KEQ71907.1| hypothetical protein M436DRAFT_49503 [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=929

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA +WF +A+ L PDIGD WA + +F  Q G+ED + +++ KCV +EPKHGE WQ+I
Sbjct  847  RLDKAVTWFEKAIVLDPDIGDSWAWYLKFLRQHGTEDKQEEIINKCVLSEPKHGEVWQSI  906

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK+ EN+    +EIL+ V   L
Sbjct  907  AKAPENAKLGIEEILKLVATRL  928



>gb|KFA45952.1| hypothetical protein S40293_07315 [Stachybotrys chartarum IBT 
40293]
Length=925

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA++WF +A+ L  D GD WA +YRF +Q G+E+ R +V+ KCV  EP+HGE WQA+
Sbjct  842  KLDKAQNWFEKALVLDSDNGDTWAWYYRFLKQHGTEEKRAEVVSKCVLNEPRHGEVWQAV  901

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
             K+  N+ K T+E+L  V A L++
Sbjct  902  TKNPRNAMKSTEELLHLVAAELEQ  925



>gb|KEY72006.1| hypothetical protein S7711_00026 [Stachybotrys chartarum IBT 
7711]
 gb|KFA73815.1| hypothetical protein S40288_07851 [Stachybotrys chartarum IBT 
40288]
Length=925

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA++WF +A+ L  D GD WA +YRF +Q G+E+ R +V+ KCV  EP+HGE WQA+
Sbjct  842  KLDKAQNWFEKALVLDSDNGDTWAWYYRFLKQHGTEEKRAEVVSKCVLNEPRHGEVWQAV  901

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
             K+  N+ K T+E+L  V A L++
Sbjct  902  TKNPRNAMKSTEELLHLVAAELEQ  925



>ref|XP_002505391.1| mRNA splicing protein [Micromonas sp. RCC299]
 gb|ACO66649.1| mRNA splicing protein [Micromonas sp. RCC299]
Length=930

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSWF+R+ T+ PDIGD WA +YRFE Q G +     V ++C  A+PKHGE WQ +
Sbjct  844  KVDKARSWFNRSCTIDPDIGDHWAAYYRFELQHGGDAAAAAVAKRCREADPKHGELWQRV  903

Query  433  AKSVENSHKPTDEILRQVVAAL  368
             K+V+N H   + +L++ VA +
Sbjct  904  GKNVKNWHDDAETLLKKCVAEM  925



>ref|XP_003236211.1| pre-mRNA splicing factor prp1 [Trichophyton rubrum CBS 118892]
 gb|EGD87006.1| hypothetical protein TERG_03261 [Trichophyton rubrum CBS 118892]
 gb|EZF16874.1| hypothetical protein H100_05541 [Trichophyton rubrum MR850]
 gb|EZF40473.1| hypothetical protein H102_05509 [Trichophyton rubrum CBS 100081]
 gb|EZF51158.1| hypothetical protein H103_05532 [Trichophyton rubrum CBS 288.86]
 gb|EZF61697.1| hypothetical protein H104_05523 [Trichophyton rubrum CBS 289.86]
 gb|EZF72372.1| hypothetical protein H105_05550 [Trichophyton soudanense CBS 
452.61]
 gb|EZF82833.1| hypothetical protein H110_05531 [Trichophyton rubrum MR1448]
 gb|EZF93754.1| hypothetical protein H113_05579 [Trichophyton rubrum MR1459]
 gb|EZG04450.1| hypothetical protein H106_05372 [Trichophyton rubrum CBS 735.88]
 gb|EZG14997.1| hypothetical protein H107_05673 [Trichophyton rubrum CBS 202.88]
 gb|KDB32240.1| hypothetical protein H112_05524 [Trichophyton rubrum D6]
Length=938

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+++ R DVL KC+A EPKHGE WQ +
Sbjct  856  RLEKAMTWFEKAIVANSDLGDVWAWYYKFLLQHGTDEKREDVLTKCIATEPKHGEIWQTV  915

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K   N+HK T+EIL+  +  L+
Sbjct  916  SKDPANAHKTTEEILKITLNRLE  938



>gb|EGE03398.1| pre-mRNA splicing factor [Trichophyton equinum CBS 127.97]
Length=851

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+++ R DVL KC+A EPKHGE WQ +
Sbjct  769  RLEKAMTWFEKAIVANSDLGDVWAWYYKFLLQHGTDEKREDVLTKCIATEPKHGEIWQTV  828

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K   N+HK T+EIL+  +  L+
Sbjct  829  SKDPANAHKTTEEILKITLNRLE  851



>gb|KGO71586.1| RNA-processing protein, HAT helix [Penicillium italicum]
Length=937

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+ L  D GD WA +Y+F  Q G+E+ R+DV+ KC++ EPKHGE WQ+I
Sbjct  855  RLEKAMTWFEKAIVLDSDYGDGWAWYYKFLLQHGTEEKRSDVVSKCISMEPKHGEVWQSI  914

Query  433  AKSVENSHKPTDEILRQV  380
            AK   N++K T+EIL+ V
Sbjct  915  AKDPANAYKTTEEILKLV  932



>ref|XP_003715426.1| pre-mRNA-splicing factor prp1 [Magnaporthe oryzae 70-15]
 gb|EHA55619.1| pre-mRNA-splicing factor prp1 [Magnaporthe oryzae 70-15]
 gb|ELQ35572.1| pre-mRNA-splicing factor prp1 [Magnaporthe oryzae Y34]
 gb|ELQ60626.1| pre-mRNA-splicing factor prp1 [Magnaporthe oryzae P131]
Length=924

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+D+A++WF +A+ L  D+GD WA +Y+F  Q G+E+ R DV+ KCVA +P+HGE WQ +
Sbjct  840  KLDRAQTWFEKALLLDGDVGDSWAWYYKFLLQHGTEEKRADVVAKCVAVDPRHGEHWQPV  899

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK  +N+ K  +EIL  V A+L
Sbjct  900  AKDPKNAKKSVEEILTLVAASL  921



>gb|EGD95302.1| pre-mRNA splicing factor prp1 [Trichophyton tonsurans CBS 112818]
Length=937

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+++ R DVL KC+A EPKHGE WQ +
Sbjct  855  RLEKAMTWFEKAIVANSDLGDVWAWYYKFLLQHGTDEKREDVLTKCIATEPKHGEIWQTV  914

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K   N+HK T+EIL+  +  L+
Sbjct  915  SKDPANAHKTTEEILKITLNRLE  937



>ref|XP_002846911.1| pre-mRNA splicing factor [Arthroderma otae CBS 113480]
 gb|EEQ31829.1| pre-mRNA splicing factor [Arthroderma otae CBS 113480]
Length=887

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+++ R DVL KC+A EPKHGE WQ +
Sbjct  805  RLEKAMTWFEKAIVANSDLGDVWAWYYKFLLQHGTDEKREDVLTKCIATEPKHGEIWQTV  864

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K   N+HK T+EIL+  +  L+
Sbjct  865  SKDPANAHKTTEEILKITLNRLE  887



>gb|EZF28793.1| hypothetical protein H101_07519 [Trichophyton interdigitale H6]
Length=938

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+++ R DVL KC+A EPKHGE WQ +
Sbjct  856  RLEKAMTWFEKAIVANSDLGDVWAWYYKFLLQHGTDEKREDVLTKCIATEPKHGEIWQTV  915

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K   N+HK T+EIL+  +  L+
Sbjct  916  SKDPANAHKTTEEILKITLNRLE  938



>emb|CCF45109.1| PRP1 splicing factor [Colletotrichum higginsianum]
Length=925

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF +A+ L  D GD WA +Y+F  Q G+++ R DV+ KCV  EP+HGE WQAI
Sbjct  842  KLEKAQNWFEKALVLDSDNGDTWAWYYKFLLQHGTDEKRADVINKCVLNEPRHGEYWQAI  901

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK   N+ K T+EIL+ V   L+K
Sbjct  902  AKQPANARKGTEEILKMVAERLEK  925



>ref|XP_003019275.1| hypothetical protein TRV_06679 [Trichophyton verrucosum HKI 0517]
 gb|EFE38630.1| hypothetical protein TRV_06679 [Trichophyton verrucosum HKI 0517]
Length=938

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+++ R DVL KC+A EPKHGE WQ +
Sbjct  856  RLEKAMTWFEKAIVANSDLGDVWAWYYKFLLQHGTDEKREDVLTKCIATEPKHGEIWQTV  915

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K   N+HK T+EIL+  +  L+
Sbjct  916  SKDPANAHKTTEEILKITLNRLE  938



>ref|XP_003016780.1| hypothetical protein ARB_05073 [Arthroderma benhamiae CBS 112371]
 gb|EFE36135.1| hypothetical protein ARB_05073 [Arthroderma benhamiae CBS 112371]
Length=938

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+++ R DVL KC+A EPKHGE WQ +
Sbjct  856  RLEKAMTWFEKAIVANSDLGDVWAWYYKFLLQHGTDEKREDVLTKCIATEPKHGEIWQTV  915

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K   N+HK T+EIL+  +  L+
Sbjct  916  SKDPANAHKTTEEILKITLNRLE  938



>ref|XP_003174464.1| hypothetical protein MGYG_01991 [Microsporum gypseum CBS 118893]
 gb|EFQ98981.1| hypothetical protein MGYG_01991 [Microsporum gypseum CBS 118893]
Length=916

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D+GD WA +Y+F  Q G+++ R DVL KC+A EPKHGE WQ +
Sbjct  834  RLEKAMTWFEKAIVANSDLGDVWAWYYKFLLQHGTDEKREDVLTKCIATEPKHGEIWQTV  893

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K   N+HK T+EIL+  +  L
Sbjct  894  SKDPANAHKTTEEILKITLNRL  915



>ref|XP_001551631.1| hypothetical protein BC1G_09798 [Botrytis cinerea B05.10]
Length=927

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA++WF +A+ L  D+GD WA +Y+F  Q G+E+ R DV++KC+ +EP+HGE WQA+
Sbjct  845  RLEKAQNWFEKAILLDSDLGDTWAWYYKFLLQHGTEEKRADVIQKCILSEPRHGEYWQAV  904

Query  433  AKSVENSHKPTDEILRQVV  377
            AK  +N+ K  +EIL+ VV
Sbjct  905  AKDPKNAGKGIEEILKLVV  923



>gb|KEQ99567.1| hypothetical protein AUEXF2481DRAFT_61627 [Aureobasidium subglaciale 
EXF-2481]
Length=929

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA +WF +A+ L PDIGD WA + +F  Q G+E+ + + + KCV +EPKHGE WQ+I
Sbjct  847  RLDKAVTWFEKAIVLDPDIGDSWAYYLKFLRQHGTEEKQEETINKCVLSEPKHGEVWQSI  906

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK+ EN+    +EIL+ V + L
Sbjct  907  AKAPENAKMGIEEILKLVASKL  928



>ref|XP_001876543.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR12279.1| predicted protein [Laccaria bicolor S238N-H82]
Length=918

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KAR WF RAV   PD+GD W  + +FE Q G+E+ R +V  KC+AAEP H   WQ+I
Sbjct  836  KIEKARQWFGRAVATDPDLGDSWGWWLKFERQHGTEEHREEVRNKCIAAEPHHSPTWQSI  895

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK V++S K   EIL  V  AL+
Sbjct  896  AKDVKSSGKSVKEILEMVADALQ  918



>emb|CCD43254.1| similar to pre-mRNA-splicing factor prp1 [Botrytis cinerea T4]
 gb|EMR90319.1| putative pre-mrna-splicing factor protein [Botrytis cinerea BcDW1]
Length=959

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA++WF +A+ L  D+GD WA +Y+F  Q G+E+ R DV++KC+ +EP+HGE WQA+
Sbjct  877  RLEKAQNWFEKAILLDSDLGDTWAWYYKFLLQHGTEEKRADVIQKCILSEPRHGEYWQAV  936

Query  433  AKSVENSHKPTDEILRQVV  377
            AK  +N+ K  +EIL+ VV
Sbjct  937  AKDPKNAGKGIEEILKLVV  955



>gb|EER43431.1| pre-mRNA splicing factor [Histoplasma capsulatum H143]
 gb|EGC46366.1| pre-mRNA-splicing factor [Histoplasma capsulatum H88]
Length=941

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA +WF +A+    D+GD WA +Y+F  Q G+++ R DV+ KC+++EP+HGE WQ++
Sbjct  859  RLDKAMTWFEKAIVSNSDLGDVWAWYYKFLLQHGTDEKREDVISKCISSEPRHGEVWQSV  918

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK   N+ K T+EIL+   A L+
Sbjct  919  AKDPANAQKSTEEILKLTAARLE  941



>ref|XP_002340974.1| mRNA splicing factor (Prp1/Zer1), putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED23587.1| mRNA splicing factor (Prp1/Zer1), putative [Talaromyces stipitatus 
ATCC 10500]
Length=941

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+    D GD WA +Y+F  Q G+E+ R DV+ KCV +EPKHGE WQ++
Sbjct  858  RLEKAMTWFEKAILADSDQGDSWAWYYKFLMQHGTEEKRQDVISKCVISEPKHGEIWQSV  917

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK   N HK T+EIL+ VV  L
Sbjct  918  AKDPVNFHKTTEEILKLVVEQL  939



>gb|ETN61203.1| pre-mrna splicing factor [Anopheles darlingi]
Length=931

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ K R WF+R + + PD GD WA FY+FE+Q G+E  +N+++ +C+AAEPKHGE+W  +
Sbjct  846  KLQKCRDWFNRTIKIDPDFGDAWAYFYKFEQQHGTEQQQNELMERCIAAEPKHGEEWCKV  905

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K + N    T+++L+ V+  L
Sbjct  906  SKDIANWCFKTEDVLKAVIRNL  927



>emb|CDQ05274.1| Protein BM-PRP-6, isoform f [Brugia malayi]
Length=774

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD GD WA FY+FE   GS++ ++ V +KC+ AEP+HGE WQ +
Sbjct  689  KIRKAREWFQRTVKIDPDFGDAWAFFYKFELLHGSQEEQDLVKKKCLQAEPRHGELWQEV  748

Query  433  AKSVENSHKPTDEIL  389
            +K VEN  K TDEIL
Sbjct  749  SKDVENWRKRTDEIL  763



>gb|EEH11379.1| pre-mRNA-splicing factor [Histoplasma capsulatum G186AR]
Length=941

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA +WF +A+    D+GD WA +Y+F  Q G+++ R DV+ KC+++EP+HGE WQ++
Sbjct  859  RLDKAMTWFEKAIVSNSDLGDVWAWYYKFLLQHGTDEKREDVISKCISSEPRHGEVWQSV  918

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK   N+ K T+EIL+   A L+
Sbjct  919  AKDPANAQKSTEEILKLTAARLE  941



>ref|XP_002291151.1| RNA splicing factor [Thalassiosira pseudonana CCMP1335]
 gb|EED91258.1| RNA splicing factor [Thalassiosira pseudonana CCMP1335]
Length=935

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K DKAR WF RAV L PD+GD WA FY FE+  G+++ R +V ++C+AAEPKHGE W  +
Sbjct  846  KHDKARKWFERAVILDPDMGDSWAKFYAFEQDAGTKEARENVKQRCIAAEPKHGELWCQV  905

Query  433  AKSVENSHKPTDEILRQV  380
            AK++ N  K T E L  V
Sbjct  906  AKAMPNRRKTTAEHLEAV  923



>gb|KGO43527.1| RNA-processing protein, HAT helix [Penicillium expansum]
 gb|KGO52623.1| RNA-processing protein, HAT helix [Penicillium expansum]
 gb|KGO64336.1| RNA-processing protein, HAT helix [Penicillium expansum]
Length=971

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+ L  D GD WA +Y+F  Q G+E+ R+DV+ KC++ EPKHGE WQ+I
Sbjct  889  RLEKAMTWFEKAIVLDSDYGDGWAWYYKFLLQHGTEEKRSDVVSKCISMEPKHGEFWQSI  948

Query  433  AKSVENSHKPTDEILRQV  380
            AK   N++K T+EIL+ V
Sbjct  949  AKDPANAYKTTEEILKLV  966



>gb|EHK25524.1| hypothetical protein TRIVIDRAFT_62198 [Trichoderma virens Gv29-8]
Length=928

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA+SWF +A+ L  D GD WA +YRF  Q G+++ R DV+ KCV  EP+HGE WQ++
Sbjct  845  KLEKAQSWFEKALVLDGDCGDSWAWYYRFLVQHGTDEKRADVVTKCVLNEPRHGEVWQSV  904

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK+ +N+ K  +EIL+ V A L++
Sbjct  905  AKNPKNAKKNAEEILKLVAAELEQ  928



>ref|XP_010749961.1| PREDICTED: pre-mRNA-processing factor 6 [Larimichthys crocea]
Length=937

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD+GD WALFY+FE Q G+E+ + +V ++C  AEP+HGE W A 
Sbjct  852  KITKAREWFLRTVKIEPDLGDAWALFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAE  911

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K V N  K T EIL +V + +K
Sbjct  912  SKHVLNWQKKTGEILAEVASKIK  934



>ref|XP_006968422.1| predicted protein [Trichoderma reesei QM6a]
 gb|EGR45600.1| predicted protein [Trichoderma reesei QM6a]
 gb|ETR98808.1| hypothetical protein M419DRAFT_103094 [Trichoderma reesei RUT 
C-30]
Length=928

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA+SWF +A+ L  D GD WA +Y+F  Q G+E+ R D++ KCV  EP+HGE WQA+
Sbjct  845  KLEKAQSWFEKALVLDADRGDSWAWYYKFLVQHGTEEKRADMVTKCVLNEPRHGEVWQAV  904

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK+ +N+ K  +EIL+ V A L++
Sbjct  905  AKNPKNAKKSVEEILKLVAAELEQ  928



>gb|KFM80330.1| Pre-mRNA-processing factor 6, partial [Stegodyphus mimosarum]
Length=263

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K  KAR WF++ V + PD+GD WA +Y+FE   G+E+ + DV ++CV AEP+HGE W  +
Sbjct  178  KTIKARDWFNKTVKIDPDLGDAWAYYYKFELIHGTEEQQEDVKKRCVHAEPRHGENWCKV  237

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K++ N  K T++IL    A+L
Sbjct  238  SKNINNWRKKTEQILIMTAASL  259



>ref|XP_008077401.1| TPR-like protein [Glarea lozoyensis ATCC 20868]
 gb|EHL01223.1| putative Pre-mRNA-splicing factor prp1 [Glarea lozoyensis 74030]
 gb|EPE35322.1| TPR-like protein [Glarea lozoyensis ATCC 20868]
Length=928

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA++WF +AV L  D+GD WA +++F  Q G+++ R DV+ KC+ +EP+HGE WQAI
Sbjct  846  RLEKAQNWFEKAVVLDSDLGDTWAWYFKFLMQHGTDEKRADVIAKCILSEPRHGEFWQAI  905

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+   T+E+L+ VVA L+
Sbjct  906  AKDPKNAKMGTEEVLKAVVARLE  928



>dbj|GAM34034.1| U4/U6 x U5 tri-snRNP complex subunit [Talaromyces cellulolyticus]
Length=1322

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  613   KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
             +++KA +WF +A+    D GD WA +Y+F  Q G+E+ R DV+ KCV +EPKHGE WQ++
Sbjct  1239  RLEKAMTWFEKAILADSDQGDSWAWYYKFLIQHGTEEKRQDVISKCVISEPKHGEIWQSV  1298

Query  433   AKSVENSHKPTDEILRQVVAALKK  362
             AK   N HK T+EIL+ VV  L +
Sbjct  1299  AKDPVNFHKSTEEILKLVVEQLPR  1322



>gb|KIJ93573.1| hypothetical protein K443DRAFT_684462 [Laccaria amethystina LaAM-08-1]
Length=923

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KAR WF RAV   PD+GD W  + +FE Q G+E+ R +V  KC+AAEP H   WQ+I
Sbjct  841  KIEKARQWFGRAVATDPDLGDSWGWWLKFERQHGTEEHREEVRSKCIAAEPHHSPTWQSI  900

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +NS K   EIL  V  AL+
Sbjct  901  AKDAKNSGKSVKEILEIVADALQ  923



>ref|XP_001891604.1| U5 snRNP-associated 102 kDa protein [Brugia malayi]
 emb|CDQ05273.1| Protein BM-PRP-6, isoform e [Brugia malayi]
Length=970

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD GD WA FY+FE   GS++ ++ V +KC+ AEP+HGE WQ +
Sbjct  885  KIRKAREWFQRTVKIDPDFGDAWAFFYKFELLHGSQEEQDLVKKKCLQAEPRHGELWQEV  944

Query  433  AKSVENSHKPTDEIL  389
            +K VEN  K TDEIL
Sbjct  945  SKDVENWRKRTDEIL  959



>emb|CBK23506.2| unnamed protein product [Blastocystis hominis]
Length=820

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -3

Query  610  VDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAIA  431
            V KAR W  RA+    DIGDFWAL Y FE Q G+E+ +N+V+R CV A PKHGE W +I 
Sbjct  731  VSKARVWLRRALAKNGDIGDFWALLYIFELQNGTEEQQNEVIRDCVRANPKHGEIWPSIR  790

Query  430  KSVENSHKPTDEILRQVVAALK  365
            K  EN  K   EILR V   +K
Sbjct  791  KQKENRRKEIPEILRLVADQMK  812



>ref|XP_008869866.1| hypothetical protein H310_06535 [Aphanomyces invadans]
 gb|ETW02018.1| hypothetical protein H310_06535 [Aphanomyces invadans]
Length=958

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K  KAR W  R V L PD GD WA +Y FE + G+E  R D+L +C+ AEP+HG+ W AI
Sbjct  866  KYSKARKWLERTVQLNPDFGDGWAYYYAFELKHGNELQREDILNRCIKAEPRHGDLWCAI  925

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K   N  K T E+L+ VVA+L
Sbjct  926  SKQTLNRKKKTGEVLKLVVASL  947



>ref|XP_003439073.2| PREDICTED: pre-mRNA-processing factor 6-like [Oreochromis niloticus]
Length=969

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD+GD WA FY+FE Q G+E+ + +V ++C  AEP+HGE W A 
Sbjct  884  KITKAREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAE  943

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K V N  K T EIL QV + +K
Sbjct  944  SKHVLNWQKKTGEILAQVASKIK  966



>ref|XP_007283846.1| mRNA splicing factor (prp1 zer1) [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA27105.1| mRNA splicing factor (prp1 zer1) [Colletotrichum gloeosporioides 
Nara gc5]
Length=926

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF +A+ L  D GD WA +Y+F  Q G+++ R DV+ KCV  EP+HGE WQAI
Sbjct  843  KLEKAQNWFEKALVLDSDNGDSWAWYYKFLLQHGTDEKRADVINKCVLNEPRHGEHWQAI  902

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK  +N+ K T+EIL+ V   ++K
Sbjct  903  AKHPQNARKETEEILKLVADRIEK  926



>ref|XP_001219749.1| hypothetical protein CHGG_00528 [Chaetomium globosum CBS 148.51]
 gb|EAQ92293.1| hypothetical protein CHGG_00528 [Chaetomium globosum CBS 148.51]
Length=895

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+D+A++WF RA+ L   IGD WA +Y+F  Q G+++ R D++ KCV  +P+HGE WQA+
Sbjct  813  KLDRAQNWFERALLLDRHIGDTWAWYYKFLLQHGTDEKRADLVAKCVLNDPRHGEHWQAV  872

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK  +N+ K T+E+LR V A+L
Sbjct  873  AKDPKNAGKGTEEVLRLVAASL  894



>ref|XP_004070553.1| PREDICTED: pre-mRNA-processing factor 6 [Oryzias latipes]
Length=969

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ K+R WF R V + PD+GD WALFY+FE Q G+++ + +V ++C  AEP+HGE W A 
Sbjct  884  KITKSREWFLRTVKIEPDLGDAWALFYKFELQHGTQEQQEEVRKRCENAEPRHGELWCAE  943

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K V N  K T EIL QV + +K
Sbjct  944  SKHVLNWQKKTGEILEQVASKIK  966



>gb|EWZ90300.1| hypothetical protein FOWG_07994 [Fusarium oxysporum f. sp. lycopersici 
MN25]
Length=930

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF +A+ L  D GD WA +YRF  Q G+E+ R DV+ KCV  EP+HGE WQAI
Sbjct  847  KLEKAQNWFEKALVLDSDYGDSWAWYYRFLCQHGTEEKRADVVTKCVLNEPRHGEVWQAI  906

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK   N+ K  +EIL+ V   L++
Sbjct  907  AKKPTNARKSCEEILKLVAEELEQ  930



>ref|XP_002144562.1| mRNA splicing factor (Prp1/Zer1), putative [Talaromyces marneffei 
ATCC 18224]
 gb|EEA28047.1| mRNA splicing factor (Prp1/Zer1), putative [Talaromyces marneffei 
ATCC 18224]
 gb|KFX53464.1| Pre-mRNA-splicing factor prp1 [Talaromyces marneffei PM1]
Length=942

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +++    D GD WA +Y+F  Q G+E+ R DV+ KCV +EPKHGE WQ++
Sbjct  859  RLEKAMTWFEKSILADSDQGDSWAWYYKFLMQHGTEEKRQDVISKCVISEPKHGEIWQSV  918

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK   N HK T+EIL+ VV  L +
Sbjct  919  AKDPVNFHKSTEEILKLVVEQLPR  942



>gb|EHK39664.1| hypothetical protein TRIATDRAFT_47890 [Trichoderma atroviride 
IMI 206040]
Length=929

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA+SWF +A+ L  D GD WA +YRF  Q G+++ R D++ KCV  EP+HGE WQA+
Sbjct  846  KLEKAQSWFEKALVLDADQGDSWAWYYRFLVQHGTDEKRADMVTKCVLNEPRHGEVWQAV  905

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK  +N+ K  +EIL+ V A L++
Sbjct  906  AKDPKNAKKSVEEILKLVAAELEQ  929



>gb|EGU82876.1| hypothetical protein FOXB_06679 [Fusarium oxysporum Fo5176]
 gb|EXL85030.1| hypothetical protein FOPG_02971 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
Length=930

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF +A+ L  D GD WA +YRF  Q G+E+ R DV+ KCV  EP+HGE WQAI
Sbjct  847  KLEKAQNWFEKALVLDSDYGDSWAWYYRFLCQHGTEEKRADVVTKCVLNEPRHGEVWQAI  906

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK   N+ K  +EIL+ V   L++
Sbjct  907  AKKPTNARKSCEEILKLVAEELEQ  930



>gb|EMT63359.1| Pre-mRNA-splicing factor prp1 [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|ENH67717.1| Pre-mRNA-splicing factor prp1 [Fusarium oxysporum f. sp. cubense 
race 1]
 gb|EWY90430.1| hypothetical protein FOYG_07955 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ37036.1| hypothetical protein FOZG_10912 [Fusarium oxysporum Fo47]
 gb|EXA44609.1| hypothetical protein FOVG_05994 [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK39071.1| hypothetical protein FOMG_06521 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK90559.1| hypothetical protein FOQG_06799 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL56504.1| hypothetical protein FOCG_04096 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXM01960.1| hypothetical protein FOIG_07379 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM33053.1| hypothetical protein FOTG_03167 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=930

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF +A+ L  D GD WA +YRF  Q G+E+ R DV+ KCV  EP+HGE WQAI
Sbjct  847  KLEKAQNWFEKALVLDSDYGDSWAWYYRFLCQHGTEEKRADVVTKCVLNEPRHGEVWQAI  906

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK   N+ K  +EIL+ V   L++
Sbjct  907  AKKPTNARKSCEEILKLVAEELEQ  930



>gb|EWG40666.1| hypothetical protein FVEG_02975 [Fusarium verticillioides 7600]
Length=930

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF +A+ L  D GD WA +YRF  Q G+E+ R DV+ KCV  EP+HGE WQAI
Sbjct  847  KLEKAQNWFEKALVLDSDYGDSWAWYYRFLCQHGTEEKRADVVTKCVLNEPRHGEVWQAI  906

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK   N+ K  +EIL+ V   L++
Sbjct  907  AKKPTNARKSCEEILKLVAEELEQ  930



>ref|XP_007912541.1| putative pre-mrna-splicing factor prp1 protein [Togninia minima 
UCRPA7]
 gb|EOO02676.1| putative pre-mrna-splicing factor prp1 protein [Togninia minima 
UCRPA7]
Length=966

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+++A++WF +A+ L  D+GD WA +Y+F  Q G+++ R DV+ KC++ +P+HGE WQ I
Sbjct  883  KLERAQNWFEKALILDGDMGDTWAWYYKFLLQHGTDEKREDVISKCISNDPRHGEYWQPI  942

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK  +NS K  +EIL+ V A+L
Sbjct  943  AKDPKNSKKSVEEILKLVTASL  964



>gb|KIZ07717.1| putative Pre-mRNA-processing factor 6 [Monoraphidium neglectum]
Length=244

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KVDKARSWF+RAV LAP++GD+W  +Y+FE Q G+ +   DV R+     P++GE+W  +
Sbjct  157  KVDKARSWFNRAVLLAPEVGDYWGHYYKFELQHGTPESAADVARRAADKGPRYGERWTRV  216

Query  433  AKSVENSHKPTDEILRQVV  377
            AK V N+H P + +LR+VV
Sbjct  217  AKDVRNAHLPVEALLRKVV  235



>dbj|GAM82021.1| hypothetical protein ANO11243_000008 [fungal sp. No.11243]
Length=937

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA SWF +A  L PD GD WA +Y+F  Q G+++ + +V+ KCV  EPKHGE WQAI
Sbjct  855  KLDKAASWFQKAAVLDPDDGDTWAWWYKFLLQHGTDEKQAEVVSKCVMNEPKHGETWQAI  914

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK+ EN+    +E+L+ V A L+
Sbjct  915  AKAPENARLGIEEVLKLVAAKLQ  937



>ref|XP_008316164.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6 
[Cynoglossus semilaevis]
Length=952

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD+GD WA+FY+FE Q G+E+ + +VL++C  AEP+HGE W A 
Sbjct  867  KITKAREWFLRTVKIDPDLGDSWAMFYKFELQHGTEEQQAEVLKRCDNAEPRHGELWCAE  926

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K + N  K T EIL  V + +K
Sbjct  927  SKHILNWQKKTGEILELVASKIK  949



>gb|KEQ83272.1| hypothetical protein M438DRAFT_356644 [Aureobasidium pullulans 
EXF-150]
Length=929

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA +WF +A+   PD+GD WA + +F  Q G+E+ + + + KCV +EPKHGE WQ+I
Sbjct  847  KLDKAVTWFEKAIVADPDVGDSWAYYLKFLRQHGTEEKQEETINKCVLSEPKHGEVWQSI  906

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK+ ENS    +EIL+ V + L
Sbjct  907  AKAPENSKLGVEEILKLVASKL  928



>gb|KIX03920.1| hypothetical protein Z518_07473 [Rhinocladiella mackenziei CBS 
650.93]
Length=947

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA SWF +A+ L  D+GD WA + +F  Q G+++ R DV+ KCVA+EPKHGE WQ +
Sbjct  859  RLDKAMSWFEKAIVLDSDLGDTWAWYLKFLTQHGTDEKREDVIAKCVASEPKHGEVWQRV  918

Query  433  AKSVENSHKPTDEILRQVVAALKKEE  356
             K   N++  T E+L+ V++ L+ +E
Sbjct  919  RKDPRNAYLSTREVLKVVMSQLQSKE  944



>ref|XP_006462485.1| hypothetical protein AGABI2DRAFT_193619 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV45665.1| hypothetical protein AGABI2DRAFT_193619 [Agaricus bisporus var. 
bisporus H97]
Length=922

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KAR WFSRAV  APD+GD W  + +FE   G E+ R +V +KC+AAEP H   WQ++
Sbjct  840  KIEKARHWFSRAVATAPDLGDTWGWWLKFERMHGVEEQREEVRKKCIAAEPHHSPVWQSV  899

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK   N  K   EIL  V AAL+
Sbjct  900  AKDDANRGKSVGEILEMVAAALQ  922



>gb|EQB58193.1| PRP1 splicing factor [Colletotrichum gloeosporioides Cg-14]
Length=926

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KA++WF +A+ L  D GD WA +Y+F  Q G+++ R DV+ KCV  EP+HGE WQAI
Sbjct  843  KLEKAQNWFEKALVLDSDNGDSWAWYYKFLLQHGTDEKRADVINKCVLNEPRHGEYWQAI  902

Query  433  AKSVENSHKPTDEILRQVVAALKK  362
            AK  +N+ K T+EIL+ V   ++K
Sbjct  903  AKHPQNARKGTEEILKLVADRIEK  926



>gb|EKV04839.1| MRNA splicing factor (Prp1/Zer1), putative [Penicillium digitatum 
PHI26]
 gb|EKV17226.1| MRNA splicing factor (Prp1/Zer1), putative [Penicillium digitatum 
Pd1]
Length=937

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+ L  D GD WA +Y+F  Q G+E+ R+DV+ KC++ EPKHGE WQ+I
Sbjct  855  RLEKAMTWFEKAIVLDSDYGDGWAWYYKFLLQHGTEEKRSDVVSKCISMEPKHGEIWQSI  914

Query  433  AKSVENSHKPTDEILRQV  380
             K   N++K T+EIL+ V
Sbjct  915  VKDPANAYKTTEEILKLV  932



>ref|XP_002117163.1| hypothetical protein TRIADDRAFT_51004 [Trichoplax adhaerens]
 gb|EDV20469.1| hypothetical protein TRIADDRAFT_51004 [Trichoplax adhaerens]
Length=929

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV KAR WF RAV + PD GD WA  Y+ E Q+G+E  +  V +KCV AEP HGE W  I
Sbjct  844  KVTKAREWFHRAVKIDPDNGDAWAYLYKLELQYGTEALQQSVSKKCVTAEPHHGEYWCKI  903

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K  EN  K TDE+L  V A L
Sbjct  904  SKRKENWRKKTDELLPLVAATL  925



>ref|XP_007783240.1| hypothetical protein W97_07420 [Coniosporium apollinis CBS 100218]
 gb|EON67923.1| hypothetical protein W97_07420 [Coniosporium apollinis CBS 100218]
Length=933

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA SWF +A+ L  D+GD WA +Y+F  Q G+++ R +V+ KCV AEP+HGE WQA+
Sbjct  851  RLEKAMSWFEKAILLDADLGDTWAWYYKFLLQHGTDEKREEVVAKCVLAEPRHGEVWQAV  910

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ K  +EIL+ VV  L+
Sbjct  911  AKDPKNAGKGREEILKMVVQRLE  933



>ref|XP_001593581.1| hypothetical protein SS1G_05008 [Sclerotinia sclerotiorum 1980]
 gb|EDO02532.1| hypothetical protein SS1G_05008 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=926

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA++WF +A+ L  D+GD WA +Y+F  Q G+E+ R DV+ KC+ +EP+HGE WQA+
Sbjct  844  RLEKAQNWFEKAILLDSDLGDTWAWYYKFLLQHGTEEKRADVVSKCILSEPRHGEFWQAV  903

Query  433  AKSVENSHKPTDEILRQVV  377
            AK  +N+ K  +EIL+ VV
Sbjct  904  AKDPKNAGKSIEEILKLVV  922



>gb|KEQ67970.1| hypothetical protein M437DRAFT_35817 [Aureobasidium melanogenum 
CBS 110374]
Length=929

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA +WF +A+ L PDIGD WA + +F  Q G+E+ + + + KCV +EPKHGE WQ+I
Sbjct  847  RLDKAVTWFEKAIVLDPDIGDSWAWYLKFLRQHGTEEKQEETINKCVLSEPKHGEVWQSI  906

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK+ EN+    +EIL+ V   L+
Sbjct  907  AKAPENAKLGIEEILKLVATKLE  929



>gb|KIW41698.1| hypothetical protein, variant [Exophiala oligosperma]
Length=746

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA SWF +A+ L  D+GD WA + +F  Q G+E+ R DV+ KC+A EPKHGE WQ +
Sbjct  659  RLDKAMSWFEKAIVLDSDLGDTWAWYLKFLMQHGTEEKREDVINKCIATEPKHGEVWQRV  718

Query  433  AKSVENSHKPTDEILRQVVAALKKEENA  350
             K  +N++  T E+L +V   L+ ++ A
Sbjct  719  RKDPKNAYLSTKEVLMEVTKKLEAKDIA  746



>ref|XP_011402481.1| PREDICTED: pre-mRNA-processing factor 6-like [Amphimedon queenslandica]
Length=939

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ K R WF RA+ + PD GD WA +Y+FE   G+++ +++VL++CV AEP+HGE W ++
Sbjct  854  KISKCREWFIRAIKIDPDQGDTWAHYYKFELAHGTQEQQDEVLKRCVQAEPRHGETWCSV  913

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K ++N  K T++IL  V AA+
Sbjct  914  SKDIKNWQKHTNDILPLVTAAI  935



>ref|XP_006639651.1| PREDICTED: pre-mRNA-processing factor 6-like [Lepisosteus oculatus]
Length=980

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD+GD WALFY+FE Q G+E+ + +V R+C  AEP+HGE W A 
Sbjct  895  KITKAREWFLRTVKIEPDLGDAWALFYKFEIQHGTEEQQEEVKRRCENAEPRHGELWCAE  954

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K + N  K   EIL  V A +K
Sbjct  955  SKHIHNWQKKIGEILVLVAAKIK  977



>emb|CDH55389.1| pre-mrna-processing factor 6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=910

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKAR+WF +AV + PD GD +A +Y+FE Q G+E+ +  V+++CVA+EP+HGE+W A+
Sbjct  825  KIDKARNWFQKAVQIDPDQGDSFAWWYKFELQHGTEEQQEAVVKRCVASEPRHGERWTAV  884

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK + N  K T +IL+   A L+
Sbjct  885  AKDMANIGKRTADILKLCAAQLE  907



>ref|XP_005740593.1| PREDICTED: pre-mRNA-processing factor 6-like [Pundamilia nyererei]
Length=892

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ K+R WF R V + PD+GD WA FY+FE Q G+E+ + +V ++C  AEP+HGE W A 
Sbjct  807  KITKSREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAE  866

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K V N  K T EIL QV + +K
Sbjct  867  SKHVLNWQKKTGEILAQVASKIK  889



>gb|EPE04968.1| pre-mrna-splicing factor prp1 [Ophiostoma piceae UAMH 11346]
Length=951

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+++A++WF +A+ L  D+GD WA +Y+F +Q G+ + R DV+ KCV  +P+HGE WQAI
Sbjct  869  KLERAQNWFEKALVLDADMGDSWAWYYKFLQQHGTAEKRADVVSKCVMNDPRHGEHWQAI  928

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK  +N+ K  +E+L+ V A L
Sbjct  929  AKDPKNASKSVEELLKMVAADL  950



>ref|XP_004546042.1| PREDICTED: pre-mRNA-processing factor 6-like [Maylandia zebra]
 ref|XP_005931895.1| PREDICTED: pre-mRNA-processing factor 6-like [Haplochromis burtoni]
Length=969

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ K+R WF R V + PD+GD WA FY+FE Q G+E+ + +V ++C  AEP+HGE W A 
Sbjct  884  KITKSREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAE  943

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K V N  K T EIL QV + +K
Sbjct  944  SKHVLNWQKKTGEILAQVASKIK  966



>gb|ERS99164.1| hypothetical protein HMPREF1624_04360 [Sporothrix schenckii ATCC 
58251]
Length=927

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+++A++WF +A+ L  DIGD WA +Y+F  Q G+ + R DV+ KCV  +P+HGE WQAI
Sbjct  845  KLERAQNWFEKALVLDADIGDSWAWYYKFLLQHGTAEKRADVISKCVTNDPRHGEHWQAI  904

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK  +N+ K  +EIL+ V A L
Sbjct  905  AKDPKNASKGVEEILKLVAAEL  926



>ref|XP_006796391.1| PREDICTED: pre-mRNA-processing factor 6-like [Neolamprologus 
brichardi]
Length=969

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ K+R WF R V + PD+GD WA FY+FE Q G+E+ + +V ++C  AEP+HGE W A 
Sbjct  884  KITKSREWFLRTVKIEPDLGDAWAFFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAE  943

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K V N  K T EIL QV + +K
Sbjct  944  SKHVLNWQKKTGEILAQVASKIK  966



>emb|CDM36399.1| Pre-mRNA-splicing factor prp1 [Penicillium roqueforti FM164]
Length=973

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA +WF +A+ L  D GD WA +Y+F  Q G+E+ R DV+ KC++ EPKHGE WQ+I
Sbjct  891  RLEKAMTWFEKAIVLDSDYGDGWAWYYKFLMQHGTEEKRADVVSKCMSMEPKHGEIWQSI  950

Query  433  AKSVENSHKPTDEILRQV  380
            AK   N++K T+E+L+ V
Sbjct  951  AKDPANAYKTTEELLKLV  968



>ref|XP_007801510.1| hypothetical protein EPUS_04223 [Endocarpon pusillum Z07020]
 gb|ERF72788.1| hypothetical protein EPUS_04223 [Endocarpon pusillum Z07020]
Length=972

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+DKA SWF +A+ L   +GD W  +Y+F  Q G+E+ R DV+ KCV + P+HGE WQ++
Sbjct  890  KLDKAMSWFEKAIVLDSALGDTWGWYYKFLLQHGTEEKREDVIAKCVVSAPRHGEVWQSV  949

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+   T+E+L+ VVA L+
Sbjct  950  AKDPQNADLGTEEVLKLVVAKLE  972



>gb|EKC35667.1| Pre-mRNA-processing factor 6 [Crassostrea gigas]
Length=411

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV KAR WF+R V + PD+GD WA FY+FE+  G ED + D+ ++C+ A+PKHGE W  +
Sbjct  326  KVAKAREWFNRTVKIEPDLGDAWAYFYKFEQAHGDEDSQADIKKRCINADPKHGEFWCQV  385

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K ++N    T++IL  V   L
Sbjct  386  SKDIKNWRLRTEQILPLVADCL  407



>ref|XP_003374769.1| Pre-mRNA-processing factor 6 [Trichinella spiralis]
 gb|EFV55688.1| Pre-mRNA-processing factor 6 [Trichinella spiralis]
Length=953

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            KV+KAR WF+R V + PD+GD WA +Y+FE+  G+E+ +NDV  +CV AEP+HGE W + 
Sbjct  868  KVNKAREWFNRTVKVEPDLGDSWAYYYKFEQVHGTEEQQNDVRSRCVQAEPRHGELWCSY  927

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            +K++ N      EIL ++V  L
Sbjct  928  SKNIANWRCSVGEILDKLVQNL  949



>gb|KIH94211.1| pre-mRNA-processing factor 6 [Sporothrix brasiliensis 5110]
Length=927

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+++A++WF +A+ L  DIGD WA +Y+F  Q G+ + R DV+ KCV  +P+HGE WQAI
Sbjct  845  KLERAQNWFEKALVLDADIGDSWAWYYKFLLQHGTAEKRADVISKCVMNDPRHGEHWQAI  904

Query  433  AKSVENSHKPTDEILRQVVAAL  368
            AK  +N+ K  +EIL+ V A L
Sbjct  905  AKDPKNASKGVEEILKLVAAEL  926



>gb|KHN88451.1| Pre-mRNA-processing factor 6 [Toxocara canis]
Length=970

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD GD WA FY+FE   G+++ +  V +KC+ AEP+HGE+WQ +
Sbjct  885  KMKKAREWFQRTVKIDPDFGDAWAYFYKFELLHGTQEEQEHVKKKCMQAEPRHGERWQEV  944

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K V N  K T+EIL ++ + L+
Sbjct  945  SKDVTNWRKRTEEILVELASQLE  967



>gb|KIN06332.1| hypothetical protein OIDMADRAFT_112324 [Oidiodendron maius Zn]
Length=928

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 60/83 (72%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            +++KA++WF +A+ L  D+GD WA +Y+F  Q G+E+ R DV+ KC+ +EP+HGE WQ +
Sbjct  846  RLEKAQNWFEKAILLDSDLGDTWAWYYKFLLQHGTEEKRADVIAKCILSEPRHGEVWQTV  905

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK  +N+ +  +EIL+ VV  L+
Sbjct  906  AKDPKNATRGIEEILKIVVGKLE  928



>gb|KIW22129.1| hypothetical protein PV07_12450 [Cladophialophora immunda]
Length=725

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            ++DKA +WF +A+ + PD+GD WA + +F  Q GSE+ R DV+ KCVA EPKHGE WQ +
Sbjct  637  RLDKAMNWFEKALVVDPDLGDSWAWYLKFLMQHGSEEKREDVVAKCVANEPKHGEVWQRV  696

Query  433  AKSVENSHKPTDEILRQVVAALKKEE  356
             K  +N+   T E+L +V+  L+ +E
Sbjct  697  RKDPKNASLSTKEVLMKVMKQLEAKE  722



>ref|XP_007329932.1| hypothetical protein AGABI1DRAFT_113788 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM79190.1| hypothetical protein AGABI1DRAFT_113788 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=922

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K++KAR WFSRAV  APD+GD W  + +FE   G E+ R +V +KC+AAEP H   WQ++
Sbjct  840  KIEKARHWFSRAVATAPDLGDTWGWWLKFERMHGVEEQREEVRKKCIAAEPHHSPVWQSV  899

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            AK   N  +   EIL  V AAL+
Sbjct  900  AKDDANRGRSVGEILEMVAAALQ  922



>ref|XP_010777270.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6 
[Notothenia coriiceps]
Length=976

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = -3

Query  613  KVDKARSWFSRAVTLAPDIGDFWALFYRFEEQFGSEDGRNDVLRKCVAAEPKHGEKWQAI  434
            K+ KAR WF R V + PD+GD WALFY+FE Q G+E+ + +V ++C  AEP+HGE W A 
Sbjct  891  KITKAREWFLRTVKIEPDLGDAWALFYKFELQHGTEEQQEEVRKRCENAEPRHGELWCAE  950

Query  433  AKSVENSHKPTDEILRQVVAALK  365
            +K V N  K T EIL  V   +K
Sbjct  951  SKHVLNWQKKTGEILAGVAGKIK  973



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090