BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN040P13

Length=489
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783307.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    129   5e-34   Nicotiana sylvestris
gb|AAR83854.1|  induced stolon tip protein                              125   2e-33   Capsicum annuum
ref|XP_009591907.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    127   2e-33   Nicotiana tomentosiformis
ref|XP_004229612.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    127   2e-33   
gb|ACM68451.1|  stress-associated protein 1                             124   5e-33   Solanum pennellii
ref|XP_006345468.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    124   3e-32   Solanum tuberosum [potatoes]
gb|ACR56824.1|  At3g12630-like protein                                  123   4e-32   Solanum hirtum
gb|ACR56827.1|  At3g12630-like protein                                  122   7e-32   Solanum hirtum
gb|ACR56825.1|  At3g12630-like protein                                  122   8e-32   Solanum quitoense [lulo]
ref|XP_011093526.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    121   3e-31   Sesamum indicum [beniseed]
gb|EYU31355.1|  hypothetical protein MIMGU_mgv1a014767mg                121   4e-31   Erythranthe guttata [common monkey flower]
emb|CDP07749.1|  unnamed protein product                                121   6e-31   Coffea canephora [robusta coffee]
ref|XP_011087429.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    120   8e-31   Sesamum indicum [beniseed]
ref|XP_009773992.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    120   9e-31   Nicotiana sylvestris
ref|XP_006438985.1|  hypothetical protein CICLE_v10032882mg             118   6e-30   Citrus clementina [clementine]
ref|XP_006482901.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    118   6e-30   Citrus sinensis [apfelsine]
ref|XP_009631181.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   7e-30   Nicotiana tomentosiformis
ref|XP_010106958.1|  Zinc finger A20 and AN1 domain-containing st...    117   1e-29   Morus notabilis
gb|KHN29214.1|  Zinc finger A20 and AN1 domain-containing stress-...    116   1e-29   Glycine soja [wild soybean]
ref|XP_003546877.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    117   1e-29   Glycine max [soybeans]
gb|KDP43451.1|  hypothetical protein JCGZ_16738                         117   2e-29   Jatropha curcas
ref|NP_001240258.1|  zinc finger A20 and AN1 domain-containing st...    116   3e-29   Glycine max [soybeans]
ref|XP_008461789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    116   4e-29   Cucumis melo [Oriental melon]
ref|XP_004149600.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   5e-29   Cucumis sativus [cucumbers]
ref|XP_011025412.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   6e-29   Populus euphratica
ref|XP_002314027.1|  zinc finger family protein                         115   8e-29   Populus trichocarpa [western balsam poplar]
ref|XP_004135919.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   9e-29   Cucumis sativus [cucumbers]
ref|XP_008461273.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   9e-29   Cucumis melo [Oriental melon]
ref|XP_010279007.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_003542858.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   2e-28   Glycine max [soybeans]
ref|XP_002298442.1|  zinc finger family protein                         114   2e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010067883.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    114   2e-28   Eucalyptus grandis [rose gum]
gb|EYU27075.1|  hypothetical protein MIMGU_mgv1a014771mg                114   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_011025067.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    115   3e-28   Populus euphratica
gb|AFK36400.1|  unknown                                                 113   3e-28   Medicago truncatula
ref|XP_003627722.1|  Zinc finger A20 and AN1 domain-containing st...    113   3e-28   Medicago truncatula
ref|XP_004499868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   4e-28   Cicer arietinum [garbanzo]
ref|XP_007149048.1|  hypothetical protein PHAVU_005G036400g             116   5e-28   Phaseolus vulgaris [French bean]
ref|XP_002513177.1|  zinc finger protein, putative                      112   5e-28   Ricinus communis
ref|XP_008375146.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   6e-28   Malus domestica [apple tree]
ref|XP_004510979.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   8e-28   Cicer arietinum [garbanzo]
ref|XP_008349960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   8e-28   
ref|XP_010257261.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   9e-28   Nelumbo nucifera [Indian lotus]
ref|XP_009365004.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   9e-28   
ref|XP_009365003.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   9e-28   Pyrus x bretschneideri [bai li]
ref|XP_009365002.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   9e-28   Pyrus x bretschneideri [bai li]
ref|XP_010534277.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    113   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_003633555.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    112   1e-27   Vitis vinifera
ref|XP_002882783.1|  hypothetical protein ARALYDRAFT_478622             111   1e-27   
ref|XP_006407313.1|  hypothetical protein EUTSA_v10021683mg             111   1e-27   Eutrema salsugineum [saltwater cress]
ref|NP_566429.1|  E3 ligase SAP5                                        111   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298707.1|  hypothetical protein CARUB_v10014801mg             111   2e-27   Capsella rubella
ref|XP_009354712.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   2e-27   Pyrus x bretschneideri [bai li]
gb|ACJ84133.1|  unknown                                                 111   2e-27   Medicago truncatula
ref|XP_010557789.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    111   3e-27   Tarenaya hassleriana [spider flower]
ref|XP_008231311.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   3e-27   Prunus mume [ume]
ref|XP_007218519.1|  hypothetical protein PRUPE_ppa012532mg             110   3e-27   Prunus persica
emb|CDY52666.1|  BnaC01g38560D                                          110   4e-27   Brassica napus [oilseed rape]
ref|XP_009120462.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   4e-27   Brassica rapa
gb|KFK38611.1|  hypothetical protein AALP_AA3G136800                    110   4e-27   Arabis alpina [alpine rockcress]
ref|XP_007052561.1|  Zinc finger A20 and AN1 domain-containing st...    111   5e-27   Theobroma cacao [chocolate]
ref|XP_009146604.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   5e-27   Brassica rapa
ref|XP_010547246.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   5e-27   Tarenaya hassleriana [spider flower]
ref|XP_004306522.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    110   6e-27   Fragaria vesca subsp. vesca
gb|KJB25036.1|  hypothetical protein B456_004G173900                    110   6e-27   Gossypium raimondii
gb|AIJ00004.1|  zinc finger A20 and AN1 domain-containing stress-...    110   6e-27   Gossypium hirsutum [American cotton]
ref|XP_007133828.1|  hypothetical protein PHAVU_011G212300g             109   6e-27   Phaseolus vulgaris [French bean]
ref|XP_010497315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   1e-26   Camelina sativa [gold-of-pleasure]
emb|CDY00788.1|  BnaC03g37720D                                          109   1e-26   
ref|XP_010499267.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   2e-26   Camelina sativa [gold-of-pleasure]
emb|CDY67538.1|  BnaUnng02260D                                          108   2e-26   Brassica napus [oilseed rape]
emb|CDY08419.1|  BnaA05g26550D                                          108   2e-26   Brassica napus [oilseed rape]
ref|XP_010913137.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    108   3e-26   Elaeis guineensis
emb|CDX73811.1|  BnaA03g32360D                                          108   4e-26   
ref|XP_010465038.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    109   4e-26   
gb|KJB22229.1|  hypothetical protein B456_004G036200                    108   4e-26   Gossypium raimondii
ref|XP_003540534.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   5e-26   Glycine max [soybeans]
ref|XP_009135242.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   5e-26   Brassica rapa
ref|XP_009770817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    107   7e-26   Nicotiana sylvestris
gb|ADF80942.1|  zinc finger protein                                     105   7e-25   Phyllostachys praecox [zaozhu]
ref|XP_008776561.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   7e-25   Phoenix dactylifera
ref|XP_010928494.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   7e-25   
gb|ACM68460.1|  stress-associated protein 10                            104   1e-24   Solanum pennellii
ref|XP_004252868.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   1e-24   
gb|EMT33843.1|  Zinc finger A20 and AN1 domain-containing stress-...    104   1e-24   
ref|XP_006660259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   1e-24   
ref|XP_006365818.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    104   1e-24   Solanum tuberosum [potatoes]
ref|XP_009765432.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    105   1e-24   Nicotiana sylvestris
dbj|BAJ90521.1|  predicted protein                                      103   2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002460447.1|  hypothetical protein SORBIDRAFT_02g028240          103   2e-24   Sorghum bicolor [broomcorn]
ref|XP_003599112.1|  Zinc finger A20 and AN1 domain-containing st...    103   2e-24   Medicago truncatula
ref|XP_008795709.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   2e-24   Phoenix dactylifera
emb|CBI16411.3|  unnamed protein product                                102   3e-24   Vitis vinifera
ref|XP_002285543.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   3e-24   Vitis vinifera
gb|ABS72032.1|  putative AN1-like zinc finger protein                   100   4e-24   Olea europaea
ref|XP_009618607.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    103   5e-24   Nicotiana tomentosiformis
ref|XP_011080262.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    102   5e-24   Sesamum indicum [beniseed]
gb|EYU18023.1|  hypothetical protein MIMGU_mgv1a015860mg                101   7e-24   Erythranthe guttata [common monkey flower]
ref|XP_011090386.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   9e-24   Sesamum indicum [beniseed]
gb|ACM68447.1|  stress-associated protein 10                            102   9e-24   Solanum lycopersicum
ref|XP_009589288.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   1e-23   Nicotiana tomentosiformis
ref|XP_009799138.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   1e-23   Nicotiana sylvestris
gb|EYU46288.1|  hypothetical protein MIMGU_mgv1a015852mg                101   1e-23   Erythranthe guttata [common monkey flower]
gb|EAZ45178.1|  hypothetical protein OsJ_29820                          101   1e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002445913.1|  hypothetical protein SORBIDRAFT_07g027940          102   1e-23   Sorghum bicolor [broomcorn]
ref|XP_009596933.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    100   1e-23   Nicotiana tomentosiformis
emb|CDP20562.1|  unnamed protein product                                101   1e-23   Coffea canephora [robusta coffee]
ref|NP_001063521.1|  Os09g0486500                                       101   2e-23   
ref|XP_004973853.1|  PREDICTED: zinc finger A20 and AN1 domain-co...    101   2e-23   Setaria italica
gb|EPS66139.1|  hypothetical protein M569_08638                       99.0    2e-23   Genlisea aurea
gb|ABI23728.1|  stress-tolerance zinc finger protein                    101   2e-23   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|EAZ09556.1|  hypothetical protein OsI_31833                          101   2e-23   Oryza sativa Indica Group [Indian rice]
gb|AGQ04314.1|  SAP1                                                    100   2e-23   Oryza sativa f. spontanea
ref|NP_001062181.1|  Os08g0504700                                       101   2e-23   
ref|XP_009402699.1|  PREDICTED: zinc finger AN1 domain-containing...    100   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGQ04319.1|  SAP1                                                  99.8    4e-23   Oryza meridionalis [Australian wild rice]
gb|AGQ04317.1|  SAP1                                                  99.8    4e-23   Oryza longistaminata [long-staminate rice]
gb|AGQ04315.1|  SAP1                                                  99.8    5e-23   Oryza rufipogon [common wild rice]
gb|AGQ04324.1|  SAP1                                                  99.8    5e-23   Oryza officinalis
gb|AGQ04316.1|  SAP1                                                  99.8    5e-23   Oryza glumipatula
gb|AGQ04323.1|  SAP1                                                  99.0    9e-23   Oryza punctata
ref|XP_004957171.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  99.4    1e-22   Setaria italica
ref|XP_006850149.1|  hypothetical protein AMTR_s00022p00236720        97.8    2e-22   Amborella trichopoda
ref|XP_003574738.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  98.6    2e-22   Brachypodium distachyon [annual false brome]
ref|XP_009415054.1|  PREDICTED: zinc finger AN1 domain-containing...  98.2    2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385134.1|  PREDICTED: zinc finger AN1 domain-containing...  97.1    5e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416648.1|  PREDICTED: zinc finger AN1 domain-containing...  97.1    6e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416009.1|  PREDICTED: zinc finger AN1 domain-containing...  95.9    1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001266661.1|  multiple stress-responsive zinc-finger prote...  95.5    2e-21   
ref|NP_001106266.1|  LOC100127541                                     95.5    2e-21   Zea mays [maize]
ref|XP_010928202.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  95.5    3e-21   Elaeis guineensis
ref|XP_009393780.1|  PREDICTED: zinc finger AN1 domain-containing...  94.7    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001140650.1|  uncharacterized protein LOC100272725             95.5    4e-21   Zea mays [maize]
ref|NP_001106263.1|  AN110                                            95.5    4e-21   
gb|EPS64266.1|  hypothetical protein M569_10515                       94.4    4e-21   Genlisea aurea
ref|XP_001771457.1|  predicted protein                                94.7    1e-20   
ref|XP_001770822.1|  predicted protein                                94.4    1e-20   
ref|XP_009405572.1|  PREDICTED: zinc finger AN1 domain-containing...  93.2    1e-20   
ref|XP_009416000.1|  PREDICTED: zinc finger AN1 domain-containing...  93.2    1e-20   
ref|XP_008804197.1|  PREDICTED: zinc finger AN1 domain-containing...  93.2    1e-20   
ref|XP_002160663.2|  PREDICTED: AN1-type zinc finger protein 6-like   93.6    1e-20   
ref|XP_011080265.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    2e-20   Sesamum indicum [beniseed]
ref|XP_009589284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    2e-20   Nicotiana tomentosiformis
ref|XP_009770813.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.6    2e-20   Nicotiana sylvestris
ref|XP_010925078.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  93.2    2e-20   Elaeis guineensis
ref|XP_009406414.1|  PREDICTED: zinc finger AN1 domain-containing...  93.2    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002993103.1|  hypothetical protein SELMODRAFT_187216           93.2    2e-20   
gb|EPS60935.1|  induced stolon tip protein                            92.8    2e-20   Genlisea aurea
gb|EYU18025.1|  hypothetical protein MIMGU_mgv1a014524mg              93.6    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_008791733.1|  PREDICTED: zinc finger AN1 domain-containing...  92.8    3e-20   Phoenix dactylifera
ref|XP_010912823.1|  PREDICTED: zinc finger AN1 domain-containing...  92.8    3e-20   Elaeis guineensis
ref|XP_010555326.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.8    3e-20   Tarenaya hassleriana [spider flower]
dbj|BAO74165.1|  zinc finger protein                                  92.8    3e-20   Cucurbita pepo subsp. ovifera
dbj|BAO74166.1|  zinc finger protein                                  92.8    4e-20   Cucurbita pepo subsp. pepo [field pumpkin]
gb|EYU46282.1|  hypothetical protein MIMGU_mgv1a014897mg              92.8    4e-20   Erythranthe guttata [common monkey flower]
gb|KDP35279.1|  hypothetical protein JCGZ_09438                       91.7    4e-20   Jatropha curcas
ref|XP_004229614.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    4e-20   
dbj|BAO74167.1|  zinc finger protein                                  92.4    4e-20   Cucurbita pepo subsp. pepo [field pumpkin]
gb|ACM68441.1|  stress-associated protein 4                           92.0    4e-20   Solanum lycopersicum
ref|XP_008794968.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    4e-20   Phoenix dactylifera
gb|ACM68454.1|  stress-associated protein 4                           92.0    4e-20   Solanum pennellii
ref|XP_008461274.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.4    5e-20   Cucumis melo [Oriental melon]
ref|XP_004135920.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.0    6e-20   
ref|XP_004158200.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.0    6e-20   
ref|XP_010257702.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.0    6e-20   Nelumbo nucifera [Indian lotus]
ref|XP_006345467.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  92.0    6e-20   Solanum tuberosum [potatoes]
ref|XP_008808665.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  91.7    7e-20   Phoenix dactylifera
gb|KJB51967.1|  hypothetical protein B456_008G240900                  91.7    8e-20   Gossypium raimondii
ref|XP_011078867.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  91.7    9e-20   Sesamum indicum [beniseed]
gb|ABD65463.1|  DNA binding/zinc ion binding protein                  91.7    9e-20   Gossypium hirsutum [American cotton]
ref|XP_006427949.1|  hypothetical protein CICLE_v10026622mg           91.7    1e-19   
ref|XP_004288126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  91.3    1e-19   Fragaria vesca subsp. vesca
ref|XP_003557532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  91.3    1e-19   Brachypodium distachyon [annual false brome]
gb|KDO50474.1|  hypothetical protein CISIN_1g030772mg                 91.3    1e-19   Citrus sinensis [apfelsine]
ref|XP_010645797.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.1    1e-19   Vitis vinifera
ref|XP_010261028.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.9    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010268591.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.9    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_004228358.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.9    2e-19   
ref|XP_001756532.1|  predicted protein                                90.9    2e-19   
gb|ACM68440.1|  stress-associated protein 3                           90.9    2e-19   Solanum lycopersicum
ref|NP_001275387.1|  zinc finger A20 and AN1 domain-containing st...  90.5    2e-19   Solanum tuberosum [potatoes]
ref|XP_011075194.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.5    2e-19   Sesamum indicum [beniseed]
gb|ACM68453.1|  stress-associated protein 3                           90.5    2e-19   Solanum pennellii
ref|XP_010228315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.9    3e-19   
ref|NP_001058985.1|  Os07g0168800                                     90.1    3e-19   
ref|XP_009376154.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.5    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_009609312.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  90.1    3e-19   Nicotiana tomentosiformis
gb|ABI31653.1|  zinc finger protein                                   90.1    3e-19   Camellia sinensis [black tea]
ref|XP_002279037.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.4    3e-19   Vitis vinifera
gb|ABK21003.1|  unknown                                               90.1    3e-19   Picea sitchensis
ref|XP_002975420.1|  hypothetical protein SELMODRAFT_150464           90.1    3e-19   
ref|XP_007206025.1|  hypothetical protein PRUPE_ppa012468mg           89.7    4e-19   Prunus persica
ref|XP_004951572.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.7    4e-19   Setaria italica
ref|XP_006644627.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.0    4e-19   Oryza brachyantha
ref|XP_006361216.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.7    4e-19   Solanum tuberosum [potatoes]
ref|XP_008384536.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.7    4e-19   
ref|XP_006842203.1|  hypothetical protein AMTR_s00078p00168800        89.7    4e-19   
ref|XP_010279014.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.7    5e-19   Nelumbo nucifera [Indian lotus]
gb|KHG20851.1|  Zinc finger A20 and AN1 domain-containing stress-...  90.5    6e-19   Gossypium arboreum [tree cotton]
gb|ACF80251.1|  unknown                                               89.4    6e-19   Zea mays [maize]
gb|EMT06701.1|  Zinc finger A20 and AN1 domain-containing stress-...  89.4    6e-19   
ref|XP_002285530.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.4    6e-19   Vitis vinifera
gb|AAQ84334.1|  stress-associated protein 8                           89.4    6e-19   Oryza sativa Indica Group [Indian rice]
gb|AAX14637.1|  zinc finger protein                                   89.4    7e-19   Zea mays [maize]
gb|ABK26062.1|  unknown                                               89.4    7e-19   Picea sitchensis
ref|NP_001058066.1|  Os06g0612800                                     89.4    7e-19   
ref|NP_001055132.1|  Os05g0299700                                     89.4    7e-19   
gb|AFK93416.1|  stress-response protein                               89.4    7e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006654239.1|  PREDICTED: zinc finger AN1 domain-containing...  89.4    7e-19   
ref|XP_002310618.2|  hypothetical protein POPTR_0007s06890g           89.0    7e-19   Populus trichocarpa [western balsam poplar]
gb|EMT31119.1|  Zinc finger A20 and AN1 domain-containing stress-...  89.4    7e-19   
dbj|BAJ86013.1|  predicted protein                                    89.4    7e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005708852.1|  zinc finger (AN1-like) family protein            89.7    8e-19   Galdieria sulphuraria
ref|XP_009385326.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    8e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009785364.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.0    8e-19   Nicotiana sylvestris
dbj|BAJ94586.1|  predicted protein                                    88.6    8e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG26325.1|  zinc finger A20 and AN1 domains-containing protein    89.0    9e-19   Zea mays [maize]
gb|AFW87479.1|  zinc finger protein1                                  89.4    9e-19   
ref|XP_009376157.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.0    9e-19   Pyrus x bretschneideri [bai li]
ref|NP_001130325.1|  LOC100191419                                     89.0    9e-19   Zea mays [maize]
ref|XP_010031824.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.0    9e-19   Eucalyptus grandis [rose gum]
gb|ACT53874.1|  zinc finger protein                                   89.0    9e-19   Saccharum officinarum [noble cane]
ref|XP_010531421.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_007028887.1|  Zinc finger A20 and AN1 domain-containing st...  89.0    1e-18   
ref|XP_007028890.1|  Zinc finger A20 and AN1 domain-containing st...  89.0    1e-18   
ref|XP_002283050.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  89.0    1e-18   Vitis vinifera
emb|CDS16890.1|  zinc finger A20 and AN1 domain containing protein    89.0    1e-18   Echinococcus granulosus
emb|CDJ04631.1|  zinc finger A20 and AN1 domain containing protein    89.0    1e-18   
ref|XP_002466323.1|  hypothetical protein SORBIDRAFT_01g005640        89.0    1e-18   Sorghum bicolor [broomcorn]
ref|XP_011037831.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    1e-18   Populus euphratica
emb|CAN60517.1|  hypothetical protein VITISV_026578                   92.4    1e-18   Vitis vinifera
emb|CBI16408.3|  unnamed protein product                              87.4    1e-18   Vitis vinifera
dbj|BAO74169.1|  zinc finger protein                                  88.6    1e-18   Cucurbita pepo subsp. pepo [field pumpkin]
ref|XP_006354259.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    1e-18   Solanum tuberosum [potatoes]
ref|XP_009783306.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    1e-18   Nicotiana sylvestris
ref|XP_002297783.1|  zinc finger family protein                       88.6    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_004513638.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    1e-18   Cicer arietinum [garbanzo]
gb|KEH16279.1|  zinc finger A20 and AN1 domain stress-associated ...  88.6    1e-18   Medicago truncatula
ref|XP_006657485.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    1e-18   Oryza brachyantha
ref|XP_004513637.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    1e-18   
dbj|BAK03526.1|  predicted protein                                    88.2    1e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EUB63028.1|  Zinc finger A20 and AN1 domain-containing stress-...  89.4    1e-18   Echinococcus granulosus
ref|XP_002116218.1|  hypothetical protein TRIADDRAFT_50857            88.6    1e-18   Trichoplax adhaerens
ref|XP_011025579.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    1e-18   Populus euphratica
gb|KEH16280.1|  zinc finger A20 and AN1 domain stress-associated ...  88.6    1e-18   Medicago truncatula
ref|XP_010233975.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    2e-18   
ref|XP_008795703.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    2e-18   Phoenix dactylifera
ref|XP_006656245.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    2e-18   Oryza brachyantha
ref|XP_004250869.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.2    2e-18   
gb|ACM68452.1|  stress-associated protein 2                           88.2    2e-18   Solanum pennellii
ref|XP_004295198.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    2e-18   Fragaria vesca subsp. vesca
dbj|BAO74168.1|  zinc finger protein                                  88.2    2e-18   Cucurbita pepo subsp. ovifera
gb|AIN39820.1|  hypothetical protein                                  88.2    2e-18   Zoysia matrella [Japanese carpet grass]
ref|XP_010031823.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  88.6    2e-18   Eucalyptus grandis [rose gum]
ref|XP_004969762.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    2e-18   Setaria italica
gb|ACL01101.1|  zinc finger protein                                   87.8    2e-18   Phyllostachys edulis [kikko-chiku]
gb|KDP43452.1|  hypothetical protein JCGZ_16739                       87.8    2e-18   Jatropha curcas
ref|XP_002323304.1|  hypothetical protein POPTR_0016s05220g           87.8    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_004249448.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    2e-18   
gb|KJB20838.1|  hypothetical protein B456_003G167800                  87.8    2e-18   Gossypium raimondii
ref|XP_010928496.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    2e-18   Elaeis guineensis
emb|CBI29889.3|  unnamed protein product                              87.0    2e-18   Vitis vinifera
gb|ACM68446.1|  stress-associated protein 9                           87.4    2e-18   Solanum lycopersicum
ref|XP_010228642.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    2e-18   
gb|EMT17725.1|  Zinc finger A20 and AN1 domain-containing stress-...  87.4    2e-18   
gb|EMS48637.1|  Zinc finger A20 and AN1 domain-containing stress-...  89.4    2e-18   Triticum urartu
ref|XP_010540147.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    2e-18   Tarenaya hassleriana [spider flower]
ref|XP_009374543.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    2e-18   Pyrus x bretschneideri [bai li]
ref|NP_001135100.1|  AN1-type zinc finger protein 5                   88.6    2e-18   Salmo salar
gb|ACM68459.1|  stress-associated protein 9                           87.4    2e-18   Solanum pennellii
ref|XP_010228638.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    2e-18   
ref|NP_001105248.1|  uncharacterized protein LOC542155                89.0    2e-18   
ref|XP_011094369.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    2e-18   Sesamum indicum [beniseed]
ref|XP_007052555.1|  Zinc finger A20 and AN1 domain-containing st...  87.4    3e-18   Theobroma cacao [chocolate]
ref|XP_009419155.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    3e-18   
dbj|BAK01503.1|  predicted protein                                    87.4    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007014975.1|  Zinc finger A20 and AN1 domain-containing st...  87.8    3e-18   Theobroma cacao [chocolate]
ref|XP_010876178.1|  PREDICTED: AN1-type zinc finger protein 5-like   88.2    3e-18   Esox lucius
ref|XP_004249192.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    3e-18   
ref|XP_009391886.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    3e-18   
gb|EEE56499.1|  hypothetical protein OsJ_05747                        87.8    3e-18   
ref|XP_008384532.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    3e-18   
ref|XP_009776796.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    3e-18   
ref|XP_002304765.2|  zinc finger family protein                       87.8    3e-18   
ref|XP_004951575.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    3e-18   
emb|CBI34808.3|  unnamed protein product                              85.5    3e-18   
ref|XP_003597446.1|  Zinc finger A20 and AN1 domain-containing st...  87.0    3e-18   
gb|ABK92973.1|  unknown                                               87.4    3e-18   
ref|XP_011042076.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    3e-18   
ref|XP_009593342.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    3e-18   
ref|XP_002513466.1|  zinc finger protein, putative                    87.4    3e-18   
ref|NP_001046186.1|  Os02g0195600                                     87.4    3e-18   
ref|XP_003606772.1|  Zinc finger A20 and AN1 domain-containing st...  86.7    4e-18   
emb|CDQ80361.1|  unnamed protein product                              88.2    4e-18   
emb|CDS28068.1|  zinc finger A20 and AN1 domain containing protein    88.6    4e-18   
ref|XP_008786424.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    4e-18   
ref|XP_005841457.1|  hypothetical protein GUITHDRAFT_159135           87.4    4e-18   
ref|XP_006593451.1|  PREDICTED: uncharacterized protein LOC100802...  87.4    4e-18   
gb|ACM68455.1|  stress-associated protein 5                           87.0    4e-18   
ref|XP_009349757.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    4e-18   
ref|NP_001106259.1|  AN12                                             86.7    4e-18   
ref|NP_001044076.1|  Os01g0718000                                     86.7    4e-18   
ref|XP_009411822.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    4e-18   
ref|XP_008422823.1|  PREDICTED: AN1-type zinc finger protein 5-like   88.2    4e-18   
ref|XP_009393382.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    4e-18   
ref|XP_009391817.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.7    4e-18   
ref|XP_007014974.1|  Zinc finger A20 and AN1 domain-containing st...  87.4    4e-18   
dbj|BAD31782.1|  zinc finger protein-like                             86.7    4e-18   
emb|CBI34811.3|  unnamed protein product                              85.1    4e-18   
ref|XP_005813707.1|  PREDICTED: AN1-type zinc finger protein 5-like   87.4    4e-18   
gb|ADF80943.1|  zinc finger protein                                   86.7    5e-18   
ref|XP_003633556.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    5e-18   
ref|XP_002961236.1|  hypothetical protein SELMODRAFT_270230           87.8    5e-18   
ref|XP_010662056.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.5    5e-18   
ref|XP_008804805.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    5e-18   
gb|ACN30544.1|  unknown                                               86.7    5e-18   
emb|CDM83619.1|  unnamed protein product                              86.3    5e-18   
ref|XP_010105325.1|  Zinc finger A20 and AN1 domain-containing st...  86.7    5e-18   
ref|XP_008780854.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    5e-18   
ref|NP_001242495.1|  uncharacterized protein LOC100802969             87.0    5e-18   
ref|NP_001106260.1|  LOC100127534                                     86.7    5e-18   
ref|XP_011090378.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.7    5e-18   
gb|ACJ83925.1|  unknown                                               86.7    6e-18   
ref|XP_002603180.1|  hypothetical protein BRAFLDRAFT_226485           87.0    6e-18   
gb|EMS62344.1|  Zinc finger A20 and AN1 domain-containing stress-...  85.9    6e-18   
ref|XP_001779169.1|  predicted protein                                86.7    6e-18   
ref|XP_006850157.1|  hypothetical protein AMTR_s00022p00239310        86.7    6e-18   
gb|ABK90631.1|  zinc finger protein                                   86.3    6e-18   
gb|KJB37574.1|  hypothetical protein B456_006G211300                  86.7    6e-18   
gb|EMS61459.1|  Zinc finger AN1 domain-containing stress-associat...  86.3    7e-18   
gb|EMS47592.1|  Zinc finger A20 and AN1 domain-containing stress-...  87.8    7e-18   
ref|XP_006647019.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.8    7e-18   
ref|XP_010545575.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.7    7e-18   
gb|ACJ86086.1|  unknown                                               86.3    7e-18   
ref|XP_007575900.1|  PREDICTED: AN1-type zinc finger protein 5        87.4    7e-18   
ref|XP_004952634.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    7e-18   
ref|XP_010911243.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.3    7e-18   
emb|CBI24865.3|  unnamed protein product                              85.5    7e-18   
ref|XP_003557802.2|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    7e-18   
ref|XP_010913940.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.3    7e-18   
ref|XP_008373747.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.7    8e-18   
ref|XP_002281372.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.3    8e-18   
ref|XP_006339126.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.3    8e-18   
emb|CDP15398.1|  unnamed protein product                              86.3    8e-18   
gb|EMS48100.1|  Zinc finger A20 and AN1 domain-containing stress-...  88.2    8e-18   
ref|XP_007145644.1|  hypothetical protein PHAVU_007G256400g           86.3    8e-18   
ref|XP_009620573.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.3    9e-18   
gb|EMT33494.1|  Zinc finger A20 and AN1 domain-containing stress-...  85.5    9e-18   
gb|ABK21092.1|  unknown                                               86.3    9e-18   
ref|XP_010271706.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.3    9e-18   
ref|XP_008231312.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  86.3    9e-18   
ref|XP_007218502.1|  hypothetical protein PRUPE_ppa012373mg           86.3    9e-18   
ref|XP_010025527.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.4    1e-17   
ref|XP_009354716.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    1e-17   
gb|KFP53474.1|  AN1-type zinc finger protein 5                        85.1    1e-17   
ref|XP_006495488.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.0    1e-17   
ref|XP_009393381.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  87.0    1e-17   
ref|NP_001288688.1|  zinc finger A20 and AN1 domain-containing st...  85.9    1e-17   
ref|XP_003547098.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    1e-17   
ref|XP_009365001.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    1e-17   
ref|XP_008788284.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    1e-17   
ref|XP_007155611.1|  hypothetical protein PHAVU_003G216400g           85.5    1e-17   
ref|XP_006381027.1|  hypothetical protein POPTR_0006s05520g           85.9    1e-17   
ref|XP_009591880.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    1e-17   
ref|XP_009143596.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.5    1e-17   
ref|XP_010529513.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    1e-17   
ref|XP_010913141.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    1e-17   
ref|XP_006477315.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    1e-17   
ref|XP_005324162.1|  PREDICTED: AN1-type zinc finger protein 5-like   84.3    1e-17   
ref|XP_008364799.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    1e-17   
emb|CDP10083.1|  unnamed protein product                              86.7    1e-17   
ref|XP_005993851.1|  PREDICTED: AN1-type zinc finger protein 5-li...  86.3    1e-17   
ref|XP_004365991.2|  zinc finger protein                              85.9    1e-17   
gb|AHB08885.1|  zinc finger A20 and AN1 domain-containing stress-...  85.9    1e-17   
ref|XP_003965153.1|  PREDICTED: AN1-type zinc finger protein 5-like   86.3    1e-17   
ref|NP_001080394.1|  zinc finger, AN1-type domain 6                   86.3    2e-17   
gb|EAZ02908.1|  hypothetical protein OsI_25047                        85.5    2e-17   
ref|XP_006597247.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    2e-17   
ref|XP_008782899.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.5    2e-17   
gb|EMT32776.1|  Zinc finger A20 and AN1 domain-containing stress-...  87.8    2e-17   
ref|XP_011020305.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.5    2e-17   
gb|KFV46167.1|  AN1-type zinc finger protein 5                        83.6    2e-17   
ref|XP_006603655.1|  PREDICTED: uncharacterized protein LOC100499...  85.5    2e-17   
ref|XP_006851496.1|  hypothetical protein AMTR_s00040p00148670        85.9    2e-17   
gb|EYU31356.1|  hypothetical protein MIMGU_mgv1a014938mg              85.5    2e-17   
gb|KHN07399.1|  Zinc finger A20 and AN1 domain-containing stress-...  85.5    2e-17   
dbj|BAJ88745.1|  predicted protein                                    85.1    2e-17   
gb|KFQ91108.1|  AN1-type zinc finger protein 5                        85.1    2e-17   
ref|XP_008630811.1|  PREDICTED: AN1-type zinc finger protein 5 is...  85.1    2e-17   
ref|XP_008354997.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.5    2e-17   
ref|XP_009802017.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  84.7    2e-17   
ref|XP_005989651.1|  PREDICTED: AN1-type zinc finger protein 6 is...  85.9    2e-17   
gb|KFO85059.1|  AN1-type zinc finger protein 6                        85.1    2e-17   
ref|XP_007202662.1|  hypothetical protein PRUPE_ppa012365mg           85.5    2e-17   
ref|XP_010734145.1|  PREDICTED: AN1-type zinc finger protein 5-like   86.3    2e-17   
ref|XP_010673602.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.5    2e-17   
gb|AFK43724.1|  unknown                                               86.3    2e-17   
ref|NP_001051530.1|  Os03g0793300                                     86.3    2e-17   
emb|CAL49382.1|  zinc finger, AN1-type domain 6                       85.9    2e-17   
ref|XP_005989640.1|  PREDICTED: AN1-type zinc finger protein 6 is...  85.9    2e-17   
gb|EAY92150.1|  hypothetical protein OsI_13862                        86.3    2e-17   
ref|NP_989034.1|  zinc finger, AN1-type domain 6                      85.9    2e-17   
ref|XP_009345210.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.7    2e-17   
ref|NP_001106262.1|  AN18                                             84.7    2e-17   
gb|ABF55367.1|  zinc finger protein 216                               84.7    2e-17   
gb|EMS53549.1|  Zinc finger A20 and AN1 domain-containing stress-...  84.3    2e-17   
ref|XP_010553481.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.1    2e-17   
ref|XP_009601977.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.7    2e-17   
ref|XP_009351048.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.1    2e-17   
gb|KCW62226.1|  hypothetical protein EUGRSUZ_H04886                   87.0    2e-17   
ref|XP_009697879.1|  PREDICTED: AN1-type zinc finger protein 5        83.2    2e-17   
ref|XP_010244455.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.1    2e-17   
ref|XP_006803540.1|  PREDICTED: AN1-type zinc finger protein 5-li...  85.9    2e-17   
ref|XP_011020304.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  85.9    2e-17   
ref|XP_009411960.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.7    3e-17   
ref|XP_002876168.1|  hypothetical protein ARALYDRAFT_485652           85.1    3e-17   
ref|XP_009418201.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.7    3e-17   
ref|XP_009795588.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.7    3e-17   
ref|XP_010284815.1|  PREDICTED: AN1-type zinc finger protein 5-like   82.8    3e-17   
emb|CAG01434.1|  unnamed protein product                              89.0    3e-17   
ref|XP_010504026.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.7    3e-17   
ref|XP_009974406.1|  PREDICTED: AN1-type zinc finger protein 5        82.8    3e-17   
ref|XP_010544226.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.7    3e-17   
gb|KFP54075.1|  AN1-type zinc finger protein 5                        82.8    3e-17   
gb|EEC76316.1|  hypothetical protein OsI_13859                        85.5    3e-17   
gb|EPS60974.1|  hypothetical protein M569_13826                       84.3    3e-17   
ref|XP_010116462.1|  PREDICTED: AN1-type zinc finger protein 5        85.5    3e-17   
ref|XP_004309600.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.7    3e-17   
ref|XP_010081506.1|  PREDICTED: AN1-type zinc finger protein 5        82.8    3e-17   
ref|XP_006590265.1|  PREDICTED: uncharacterized protein LOC100500...  84.7    3e-17   
ref|NP_001236393.1|  uncharacterized protein LOC100500070             84.7    3e-17   
ref|XP_009676982.1|  PREDICTED: AN1-type zinc finger protein 5-like   84.0    3e-17   
gb|ABN08135.1|  Zinc finger, AN1-type; Zinc finger, A20-type          84.7    3e-17   
gb|ACJ85990.1|  unknown                                               84.7    4e-17   
ref|NP_001099826.1|  AN1-type zinc finger protein 5                   83.2    4e-17   
ref|XP_006487967.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    4e-17   
ref|XP_006291925.1|  hypothetical protein CARUB_v10018111mg           84.7    4e-17   
gb|KFP55383.1|  AN1-type zinc finger protein 5                        82.4    4e-17   
ref|XP_010544224.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    4e-17   
ref|XP_006440443.1|  hypothetical protein CICLE_v10022558mg           84.3    4e-17   
ref|XP_007558706.1|  PREDICTED: AN1-type zinc finger protein 5-like   85.5    4e-17   
ref|XP_001761755.1|  predicted protein                                84.3    4e-17   
ref|NP_190848.1|  zinc finger A20 and AN1 domain-containing stres...  84.3    4e-17   
gb|AAK68811.1|  zinc finger-like protein                              84.3    4e-17   
gb|ACT78956.1|  zinc finger protein                                   84.3    4e-17   
ref|XP_001637086.1|  predicted protein                                84.7    4e-17   
ref|XP_006626937.1|  PREDICTED: AN1-type zinc finger protein 5-like   85.1    4e-17   
ref|XP_008240842.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    4e-17   
ref|XP_008375158.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    4e-17   
ref|XP_010538772.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    4e-17   
ref|XP_007040022.1|  A20/AN1-like zinc finger family protein, put...  84.3    4e-17   
ref|XP_010928861.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    4e-17   
ref|XP_004955567.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    4e-17   
ref|XP_010045231.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    4e-17   
gb|KDP22067.1|  hypothetical protein JCGZ_25898                       84.3    4e-17   
ref|NP_001236983.1|  uncharacterized protein LOC100499857             84.3    4e-17   
ref|XP_009418488.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    5e-17   
dbj|BAG50058.1|  transcription factor C2H2                            84.3    5e-17   
ref|XP_005795678.1|  PREDICTED: AN1-type zinc finger protein 5-like   85.1    5e-17   
ref|XP_008462560.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    5e-17   
ref|XP_008405305.1|  PREDICTED: AN1-type zinc finger protein 5-like   85.1    5e-17   
gb|KFQ67235.1|  AN1-type zinc finger protein 5                        82.0    5e-17   
ref|XP_011472788.1|  PREDICTED: AN1-type zinc finger protein 5-li...  85.1    5e-17   
ref|XP_009462432.1|  PREDICTED: AN1-type zinc finger protein 5-like   85.1    5e-17   
emb|CDQ64148.1|  unnamed protein product                              85.1    5e-17   
ref|XP_010177250.1|  PREDICTED: AN1-type zinc finger protein 5-like   82.0    5e-17   
gb|EPS60034.1|  hypothetical protein M569_14771                       84.0    5e-17   
ref|XP_003384459.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.0    5e-17   
ref|XP_009137282.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.3    5e-17   
ref|XP_009145588.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.0    5e-17   
ref|XP_004552762.1|  PREDICTED: AN1-type zinc finger protein 5-li...  85.1    5e-17   
ref|NP_001288874.1|  zinc finger A20 and AN1 domain-containing st...  84.0    5e-17   
ref|XP_010728490.1|  PREDICTED: AN1-type zinc finger protein 5-like   84.7    5e-17   
emb|CDY25219.1|  BnaC06g04440D                                        84.0    6e-17   
ref|XP_008349975.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.0    6e-17   
ref|XP_003451345.1|  PREDICTED: AN1-type zinc finger protein 5-li...  84.7    6e-17   
ref|XP_006790380.1|  PREDICTED: AN1-type zinc finger protein 5-like   84.7    6e-17   
ref|XP_008812241.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  83.6    6e-17   
ref|XP_011050326.1|  PREDICTED: AN1-type zinc finger protein 5        84.7    6e-17   
ref|XP_006650711.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.0    6e-17   
ref|XP_008630810.1|  PREDICTED: AN1-type zinc finger protein 5 is...  84.7    6e-17   
ref|XP_005171883.1|  PREDICTED: AN1-type zinc finger protein 5 is...  84.7    6e-17   
ref|XP_008282118.1|  PREDICTED: AN1-type zinc finger protein 5-like   84.7    6e-17   
gb|KFO58247.1|  AN1-type zinc finger protein 5                        84.7    6e-17   
ref|XP_011166950.1|  PREDICTED: AN1-type zinc finger protein 5        84.3    6e-17   
ref|NP_998204.1|  AN1-type zinc finger protein 5                      84.7    6e-17   
gb|KFU83521.1|  AN1-type zinc finger protein 5                        81.6    6e-17   
ref|XP_002282913.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  83.6    6e-17   
ref|XP_005431382.1|  PREDICTED: AN1-type zinc finger protein 5-li...  84.7    6e-17   
ref|XP_004516195.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.0    6e-17   
gb|KJB12093.1|  hypothetical protein B456_002G229200                  84.0    6e-17   
ref|XP_009408498.1|  PREDICTED: zinc finger A20 and AN1 domain-co...  84.0    6e-17   
ref|XP_011251990.1|  PREDICTED: AN1-type zinc finger protein 5 is...  84.3    7e-17   
ref|NP_001237029.1|  uncharacterized protein LOC100527251             83.6    7e-17   
gb|KDP37593.1|  hypothetical protein JCGZ_07939                       84.0    7e-17   
ref|XP_009242794.1|  PREDICTED: LOW QUALITY PROTEIN: AN1-type zin...  84.7    7e-17   
ref|XP_008101498.1|  PREDICTED: AN1-type zinc finger protein 5 is...  84.7    7e-17   
dbj|BAA36294.1|  PEM-6                                                84.3    7e-17   
ref|XP_009886025.1|  PREDICTED: AN1-type zinc finger protein 5-like   84.3    7e-17   
ref|XP_011251996.1|  PREDICTED: AN1-type zinc finger protein 5 is...  84.3    7e-17   



>ref|XP_009783307.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana sylvestris]
Length=180

 Score =   129 bits (324),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/59 (98%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK+AGRDAIARENP
Sbjct  112  PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENP  170



>gb|AAR83854.1| induced stolon tip protein [Capsicum annuum]
Length=88

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 71/78 (91%), Gaps = 0/78 (0%)
 Frame = +1

Query  1    VARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHD  180
            +++  K V++E+++ ++  PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHD
Sbjct  1    MSQDLKKVKQEDDQLKDSLPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHD  60

Query  181  CSYDYKAAGRDAIARENP  234
            CSYDYK AGR+AIARENP
Sbjct  61   CSYDYKTAGREAIARENP  78



>ref|XP_009591907.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Nicotiana tomentosiformis]
Length=180

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 59/59 (100%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PPAKREVNRCSGCRRKVGLTGFRCRCG+LFCGEHRYSDRHDCSYDYK+AGRDAIARENP
Sbjct  112  PPAKREVNRCSGCRRKVGLTGFRCRCGDLFCGEHRYSDRHDCSYDYKSAGRDAIARENP  170



>ref|XP_004229612.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Solanum lycopersicum]
 gb|ABD57310.1| stress-associated protein 1 [Solanum lycopersicum]
Length=188

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  120  PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP  178



>gb|ACM68451.1| stress-associated protein 1 [Solanum pennellii]
Length=87

 Score =   124 bits (310),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/59 (97%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  19   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP  77



>ref|XP_006345468.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum tuberosum]
Length=187

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDC+YDYK AGR+AIARENP
Sbjct  119  PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCNYDYKTAGREAIARENP  177



>gb|ACR56824.1| At3g12630-like protein, partial [Solanum hirtum]
Length=147

 Score =   123 bits (308),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDC+YDYK AGR+AIARENP
Sbjct  85   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCNYDYKTAGREAIARENP  143



>gb|ACR56827.1| At3g12630-like protein, partial [Solanum hirtum]
Length=151

 Score =   122 bits (307),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDC YDYK AGR+AIARENP
Sbjct  89   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCXYDYKTAGREAIARENP  147



>gb|ACR56825.1| At3g12630-like protein, partial [Solanum quitoense]
 gb|ACR56826.1| At3g12630-like protein, partial [Solanum quitoense]
Length=150

 Score =   122 bits (306),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/59 (95%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PPAKREV+RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  88   PPAKREVSRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP  146



>ref|XP_011093526.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Sesamum indicum]
Length=177

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +PP KREVNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYK AGR+AIARENP
Sbjct  108  APPVKREVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTAGREAIARENP  167



>gb|EYU31355.1| hypothetical protein MIMGU_mgv1a014767mg [Erythranthe guttata]
Length=179

 Score =   121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 58/60 (97%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +PPAKREVNRC+GCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYK AGR+AIARENP
Sbjct  110  APPAKREVNRCTGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTAGREAIARENP  169



>emb|CDP07749.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            KREVNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  124  KREVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP  179



>ref|XP_011087429.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=170

 Score =   120 bits (301),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +PP KR+VNRCSGCRRKVGLTGFRCRCGELFC +HRYSDRHDCSYDYKAAGR AIARENP
Sbjct  101  APPVKRQVNRCSGCRRKVGLTGFRCRCGELFCADHRYSDRHDCSYDYKAAGRQAIARENP  160



>ref|XP_009773992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=158

 Score =   120 bits (300),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDY+ AGR+AIAR+NP
Sbjct  91   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYRTAGREAIARQNP  148



>ref|XP_006438985.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
 gb|ESR52225.1| hypothetical protein CICLE_v10032882mg [Citrus clementina]
Length=179

 Score =   118 bits (296),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            KR VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK+AGRDAIARENP
Sbjct  114  KRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENP  169



>ref|XP_006482901.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Citrus sinensis]
 gb|KDO36542.1| hypothetical protein CISIN_1g030404mg [Citrus sinensis]
Length=178

 Score =   118 bits (296),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            KR VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK+AGRDAIARENP
Sbjct  113  KRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENP  168



>ref|XP_009631181.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=156

 Score =   117 bits (294),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PAK EVNRCSGCRRK+GLTGFRCRCGELFCGEHRYSDRHDCSYDY+ AGR+AIAR+NP
Sbjct  89   PAKSEVNRCSGCRRKLGLTGFRCRCGELFCGEHRYSDRHDCSYDYRTAGREAIARQNP  146



>ref|XP_010106958.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
 gb|EXC12840.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Morus notabilis]
Length=172

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  16   KTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDY  195
            KT  +    EE+ + PAKR VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDY
Sbjct  90   KTTADSARSEEDEAVPAKRVVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDY  149

Query  196  KAAGRDAIARENP  234
            K+ GR+AIARENP
Sbjct  150  KSVGREAIARENP  162



>gb|KHN29214.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5 [Glycine soja]
Length=136

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AKR VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  70   AKRVVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP  126



>ref|XP_003546877.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Glycine max]
Length=161

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AKR VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  95   AKRVVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP  151



>gb|KDP43451.1| hypothetical protein JCGZ_16738 [Jatropha curcas]
Length=185

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            A+REVNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AI RENP
Sbjct  119  ARREVNRCSGCRRKVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKAAGREAITRENP  175



>ref|NP_001240258.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
5-like [Glycine max]
 gb|ADK25058.1| AN1-like transcription factor [Glycine max]
Length=164

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AKR VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  98   AKRVVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP  154



>ref|XP_008461789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis melo]
Length=169

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AKR+VNRCSGCR++VGLTGFRCRCGELFC EHRYSDRHDCS+DYKAAGRDAIARENP
Sbjct  103  AKRQVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGRDAIARENP  159



>ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 ref|XP_004173024.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN58601.1| hypothetical protein Csa_3G697940 [Cucumis sativus]
Length=169

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AKR+VNRCSGCR++VGLTGFRCRCGELFC EHRYSDRHDCS+DYKAAGRDAIARENP
Sbjct  103  AKRQVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGRDAIARENP  159



>ref|XP_011025412.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
 ref|XP_011007335.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=179

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/60 (88%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S  AK+EVNRCSGCRR+VGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  110  SHVAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTAGREAIARENP  169



>ref|XP_002314027.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE87982.1| zinc finger family protein [Populus trichocarpa]
Length=179

 Score =   115 bits (288),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK+EVNRCSGCRR+VGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  113  AKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTAGREAIARENP  169



>ref|XP_004135919.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 ref|XP_004158204.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cucumis sativus]
 gb|KGN45146.1| hypothetical protein Csa_7G428830 [Cucumis sativus]
Length=159

 Score =   115 bits (287),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AKREVNRCSGCR++VGLTGFRCRCG+LFC EHRYSDRHDCS+DYKAAGR+AIARENP
Sbjct  93   AKREVNRCSGCRKRVGLTGFRCRCGDLFCAEHRYSDRHDCSFDYKAAGREAIARENP  149



>ref|XP_008461273.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Cucumis melo]
Length=159

 Score =   115 bits (287),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AKREVNRCSGCR++VGLTGFRCRCG+LFC EHRYSDRHDCS+DYKAAGR+AIARENP
Sbjct  93   AKREVNRCSGCRKRVGLTGFRCRCGDLFCAEHRYSDRHDCSFDYKAAGREAIARENP  149



>ref|XP_010279007.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=164

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             KREVNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH+CS+DYKAAGR+AIARENP
Sbjct  98   VKREVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHECSFDYKAAGREAIARENP  154



>ref|XP_003542858.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=137

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            KR VNRCSGCRR+VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  72   KRAVNRCSGCRRRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENP  127



>ref|XP_002298442.1| zinc finger family protein [Populus trichocarpa]
 gb|ABK94884.1| unknown [Populus trichocarpa]
 gb|EEE83247.1| zinc finger family protein [Populus trichocarpa]
Length=181

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S  AK+EVNRCSGCRR+VGLTGFRCRCGELFC EHRYSDRHDCSYDYK  GR+AIARENP
Sbjct  112  SSVAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTVGREAIARENP  171



>ref|XP_010067883.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Eucalyptus grandis]
 gb|KCW66121.1| hypothetical protein EUGRSUZ_G03392 [Eucalyptus grandis]
Length=190

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 59/67 (88%), Gaps = 7/67 (10%)
 Frame = +1

Query  55   SPP-------AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRD  213
            SPP       A+REVNRCSGCR++VGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+
Sbjct  114  SPPSSTESNSARREVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGRE  173

Query  214  AIARENP  234
            AIARENP
Sbjct  174  AIARENP  180



>gb|EYU27075.1| hypothetical protein MIMGU_mgv1a014771mg [Erythranthe guttata]
Length=178

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P KREVNRCSGCRRKVGLTGFRCRCG+LFC +HRYSDRHDCSYDYK+AGR+AI RENP
Sbjct  111  PLKREVNRCSGCRRKVGLTGFRCRCGDLFCADHRYSDRHDCSYDYKSAGREAIERENP  168



>ref|XP_011025067.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Populus euphratica]
Length=249

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/60 (87%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S  AK+EVNRCSGCRR+VGLTGFRCRCGELFC EHRYSDRHDCSYDYK  GR+AIARENP
Sbjct  180  SSVAKKEVNRCSGCRRRVGLTGFRCRCGELFCWEHRYSDRHDCSYDYKTVGREAIARENP  239



>gb|AFK36400.1| unknown [Medicago truncatula]
Length=151

 Score =   113 bits (282),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S  AKR VNRCSGCR++VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGR++IARENP
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  141



>ref|XP_003627722.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AET02198.1| AN1-like zinc finger protein [Medicago truncatula]
 gb|AFK41885.1| unknown [Medicago truncatula]
Length=151

 Score =   113 bits (282),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 56/60 (93%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S  AKR VNRCSGCR++VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGR++IARENP
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  141



>ref|XP_004499868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=165

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AKR V+RCSGCRRKVGLTGFRCRCG+LFC EHRYSDRHDCS+DYKAAGR+AIARENP
Sbjct  99   AKRVVSRCSGCRRKVGLTGFRCRCGDLFCSEHRYSDRHDCSFDYKAAGREAIARENP  155



>ref|XP_007149048.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
 gb|ESW21042.1| hypothetical protein PHAVU_005G036400g [Phaseolus vulgaris]
Length=301

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AKR VNRCSGCRRKVGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  235  AKRVVNRCSGCRRKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENP  291



>ref|XP_002513177.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF49168.1| zinc finger protein, putative [Ricinus communis]
Length=140

 Score =   112 bits (280),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AKR+VNRCSGCRRKVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK  GR+AIARENP
Sbjct  74   AKRDVNRCSGCRRKVGLTGFRCRCGDLFCWEHRYSDRHDCSYDYKTVGREAIARENP  130



>ref|XP_008375146.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=165

 Score =   112 bits (281),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P +R VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  98   PNRRVVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  155



>ref|XP_004510979.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Cicer arietinum]
Length=160

 Score =   112 bits (280),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S  AKR VNRCSGCRR+VGLTGFRCRCG+LFC EHRYSDRHDCSYDYK  GR+AIARENP
Sbjct  91   SSEAKRAVNRCSGCRRRVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTVGREAIARENP  150



>ref|XP_008349960.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
 ref|XP_008349986.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Malus domestica]
Length=169

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P +R VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  102  PNRRVVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  159



>ref|XP_010257261.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nelumbo nucifera]
Length=163

 Score =   112 bits (280),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             +REVNRCSGCRRKVGLTGFRCRCG+LFC EHRYSDRH+CSYDYKAAGR+AI+RENP
Sbjct  97   VRREVNRCSGCRRKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKAAGREAISRENP  153



>ref|XP_009365004.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X3 [Pyrus x bretschneideri]
Length=167

 Score =   112 bits (280),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P +R VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  100  PNRRVVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  157



>ref|XP_009365003.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X2 [Pyrus x bretschneideri]
Length=168

 Score =   112 bits (280),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P +R VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  101  PNRRVVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  158



>ref|XP_009365002.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 isoform X1 [Pyrus x bretschneideri]
Length=168

 Score =   112 bits (280),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P +R VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  101  PNRRVVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  158



>ref|XP_010534277.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=189

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            K+ VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  124  KKIVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAAGREAIARENP  179



>ref|XP_003633555.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Vitis vinifera]
Length=172

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             KREVNRCSGCRRKVGLTGFRCRCG+LFC EHRY+DRH+CSYDYK AGR+AIARENP
Sbjct  106  VKREVNRCSGCRRKVGLTGFRCRCGDLFCAEHRYTDRHECSYDYKTAGREAIARENP  162



>ref|XP_002882783.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59042.1| hypothetical protein ARALYDRAFT_478622 [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score =   111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCSGCR+KVGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  98   VNRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENP  150



>ref|XP_006407313.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
 gb|ESQ48766.1| hypothetical protein EUTSA_v10021683mg [Eutrema salsugineum]
Length=158

 Score =   111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 3/61 (5%)
 Frame = +1

Query  61   PAKRE---VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN  231
            P KR+   VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIAREN
Sbjct  88   PVKRDQQTVNRCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIAREN  147

Query  232  P  234
            P
Sbjct  148  P  148



>ref|NP_566429.1| E3 ligase SAP5 [Arabidopsis thaliana]
 sp|Q9LHJ8.1|SAP5_ARATH RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 5; Short=AtSAP5 [Arabidopsis thaliana]
 gb|AAG51008.1|AC069474_7 unknown protein; 15087-14605 [Arabidopsis thaliana]
 dbj|BAB02254.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM61324.1| unknown [Arabidopsis thaliana]
 gb|AAP88348.1| At3g12630 [Arabidopsis thaliana]
 dbj|BAF00270.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75226.1| E3 ligase SAP5 [Arabidopsis thaliana]
Length=160

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCSGCR+KVGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  98   VNRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENP  150



>ref|XP_006298707.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
 gb|EOA31605.1| hypothetical protein CARUB_v10014801mg [Capsella rubella]
Length=163

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            ++ VNRCSGCR+KVGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  98   QQVVNRCSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENP  153



>ref|XP_009354712.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Pyrus x bretschneideri]
Length=165

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P +R VNRCSGCRRKVGLTGFRCRCG+LFC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  98   PNRRVVNRCSGCRRKVGLTGFRCRCGDLFCSEHRYSDRHVCSYDYKAAGREAIARENP  155



>gb|ACJ84133.1| unknown [Medicago truncatula]
Length=151

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S  AKR VNRCSGCR++VGLTGF CRCG+LFC EHRYSDRHDCSYDYKAAGR++IARENP
Sbjct  82   SSEAKRAVNRCSGCRKRVGLTGFHCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  141



>ref|XP_010557789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=175

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            K+ VNRCSGCRRKVGLTGFRCRCGELFC EHRYS RHDCSYDYKAAGR+AIARENP
Sbjct  110  KKIVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSARHDCSYDYKAAGREAIARENP  165



>ref|XP_008231311.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Prunus mume]
Length=165

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +R VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  100  RRVVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  155



>ref|XP_007218519.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
 gb|EMJ19718.1| hypothetical protein PRUPE_ppa012532mg [Prunus persica]
Length=165

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +R VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  100  RRVVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  155



>emb|CDY52666.1| BnaC01g38560D [Brassica napus]
Length=155

 Score =   110 bits (275),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 3/61 (5%)
 Frame = +1

Query  61   PAKRE---VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN  231
            P KR+   +NRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIAREN
Sbjct  85   PVKRDQQTINRCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIAREN  144

Query  232  P  234
            P
Sbjct  145  P  145



>ref|XP_009120462.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Brassica rapa]
 emb|CDY50536.1| BnaA01g30440D [Brassica napus]
Length=156

 Score =   110 bits (275),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 3/61 (5%)
 Frame = +1

Query  61   PAKRE---VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN  231
            P KR+   +NRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIAREN
Sbjct  86   PVKRDQQTINRCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIAREN  145

Query  232  P  234
            P
Sbjct  146  P  146



>gb|KFK38611.1| hypothetical protein AALP_AA3G136800 [Arabis alpina]
Length=160

 Score =   110 bits (275),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  98   VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENP  150



>ref|XP_007052561.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
 gb|EOX96718.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
5, putative [Theobroma cacao]
Length=192

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            K+ VNRCSGCR++VGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  127  KKVVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKTAGREAIARENP  182



>ref|XP_009146604.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 3/61 (5%)
 Frame = +1

Query  61   PAKRE---VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN  231
            P KR+   VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIAREN
Sbjct  89   PVKRDQQTVNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIAREN  148

Query  232  P  234
            P
Sbjct  149  P  149



>ref|XP_010547246.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Tarenaya hassleriana]
Length=179

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             ++ VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRHDCSYDYKA GR+ IARENP
Sbjct  113  VEKIVNRCSGCRRKVGLTGFRCRCGELFCAEHRYSDRHDCSYDYKAVGRETIARENP  169



>ref|XP_004306522.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Fragaria vesca subsp. vesca]
Length=170

 Score =   110 bits (275),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +R VNRCSGCRRKVGLTGFRCRCGELFC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  105  RRVVNRCSGCRRKVGLTGFRCRCGELFCSEHRYSDRHVCSYDYKAAGREAIARENP  160



>gb|KJB25036.1| hypothetical protein B456_004G173900 [Gossypium raimondii]
Length=180

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            K+ VNRCSGCR++VGLTGFRCRCGELFC +HRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  115  KKSVNRCSGCRKRVGLTGFRCRCGELFCSDHRYSDRHDCSYDYKAAGREAIARENP  170



>gb|AIJ00004.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Gossypium hirsutum]
Length=180

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            K+ VNRCSGCR++VGLTGFRCRCGELFC +HRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  115  KKSVNRCSGCRKRVGLTGFRCRCGELFCSDHRYSDRHDCSYDYKAAGREAIARENP  170



>ref|XP_007133828.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
 gb|AAA33773.1| PVPR3 [Phaseolus vulgaris]
 gb|ESW05822.1| hypothetical protein PHAVU_011G212300g [Phaseolus vulgaris]
Length=137

 Score =   109 bits (272),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            KR VNRCSGCRR+VGLTGFRCRCG+LFC EHRY+DRHDCSYDYK  GR+AIARENP
Sbjct  72   KRAVNRCSGCRRRVGLTGFRCRCGDLFCAEHRYTDRHDCSYDYKTVGREAIARENP  127



>ref|XP_010497315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=170

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  108  VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENP  160



>emb|CDY00788.1| BnaC03g37720D [Brassica napus]
Length=155

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            ++ VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  89   QQTVNRCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKTAGREAIARENP  144



>ref|XP_010499267.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Camelina sativa]
Length=166

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/53 (91%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  104  VNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHDCSYDYKTAGREAIARENP  156



>emb|CDY67538.1| BnaUnng02260D [Brassica napus]
Length=159

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 3/61 (5%)
 Frame = +1

Query  61   PAKRE---VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN  231
            P KR+   VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRH+CSYDYK AGR+AIAREN
Sbjct  89   PVKRDQQTVNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKTAGREAIAREN  148

Query  232  P  234
            P
Sbjct  149  P  149



>emb|CDY08419.1| BnaA05g26550D [Brassica napus]
Length=159

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 3/61 (5%)
 Frame = +1

Query  61   PAKRE---VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN  231
            P KR+   VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRH+CSYDYK AGR+AIAREN
Sbjct  89   PVKRDQQTVNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKTAGREAIAREN  148

Query  232  P  234
            P
Sbjct  149  P  149



>ref|XP_010913137.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Elaeis guineensis]
Length=158

 Score =   108 bits (270),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 1/62 (2%)
 Frame = +1

Query  49   NRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARE  228
             R  PA R+VNRC+GCR++VGLTGFRCRCGELFC EHRYSDRHDCS+DYKAAGR+AIARE
Sbjct  88   TRLAPA-RQVNRCAGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGREAIARE  146

Query  229  NP  234
            NP
Sbjct  147  NP  148



>emb|CDX73811.1| BnaA03g32360D [Brassica napus]
Length=159

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 5/63 (8%)
 Frame = +1

Query  61   PAKRE-----VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAR  225
            P KR+     VNRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRH+CSYDYK AGR+AIAR
Sbjct  86   PVKRDHHQQTVNRCSGCRKKVGLTGFRCRCGDLFCSEHRYSDRHECSYDYKTAGREAIAR  145

Query  226  ENP  234
            ENP
Sbjct  146  ENP  148



>ref|XP_010465038.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Camelina sativa]
Length=213

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 54/61 (89%), Gaps = 3/61 (5%)
 Frame = +1

Query  61   PAKRE---VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN  231
            P KR+   VNRCSGCR+KVGLTGFRCRCGELFC EHRYS RHDCSYDYK AGR+AIAREN
Sbjct  143  PVKRDQQIVNRCSGCRKKVGLTGFRCRCGELFCSEHRYSGRHDCSYDYKTAGREAIAREN  202

Query  232  P  234
            P
Sbjct  203  P  203



>gb|KJB22229.1| hypothetical protein B456_004G036200 [Gossypium raimondii]
Length=173

 Score =   108 bits (269),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            K+ VNRCSGCR++VGLTGFRCRCGELFC +HRYSDRHDCSYDYK  GR+AIARENP
Sbjct  108  KKVVNRCSGCRKRVGLTGFRCRCGELFCADHRYSDRHDCSYDYKTVGREAIARENP  163



>ref|XP_003540534.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Glycine max]
Length=135

 Score =   107 bits (266),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            KR V+RCS CRR+VGLTGFRCRCG+LFC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  70   KRVVSRCSCCRRRVGLTGFRCRCGDLFCAEHRYSDRHDCSYDYKAAGREAIARENP  125



>ref|XP_009135242.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Brassica rapa]
Length=159

 Score =   107 bits (268),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 5/63 (8%)
 Frame = +1

Query  61   PAKRE-----VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAR  225
            P KR+     +NRCSGCR+KVGLTGFRCRCG+LFC EHRYSDRH+CSYDYK AGR+AIAR
Sbjct  86   PVKRDHHQQTINRCSGCRKKVGLTGFRCRCGDLFCAEHRYSDRHECSYDYKTAGREAIAR  145

Query  226  ENP  234
            ENP
Sbjct  146  ENP  148



>ref|XP_009770817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=151

 Score =   107 bits (266),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 2/57 (4%)
 Frame = +1

Query  70   REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            RE NRCSG  CRRKVGL GFRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  85   REANRCSGIGCRRKVGLIGFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIARENP  141



>gb|ADF80942.1| zinc finger protein [Phyllostachys praecox]
Length=165

 Score =   105 bits (261),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            K  VNRCS CR++VGLTGFRCRCGELFCGEHRYSDRH CSYDYKAA RDAIAR+NP
Sbjct  100  KTSVNRCSSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAATRDAIARDNP  155



>ref|XP_008776561.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Phoenix dactylifera]
Length=160

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  70   REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            + VNRC+GCR++VGLTGFRCRCGELFC EHRYSDRHDCS+DYKAAGR+AI RENP
Sbjct  96   KRVNRCAGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGREAITRENP  150



>ref|XP_010928494.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Elaeis guineensis]
Length=161

 Score =   104 bits (260),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +1

Query  70   REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            R VNRC+GCR++VGLTGFRCRCG LFC EHRYSDRHDCS+DYKAAGR+AIARENP
Sbjct  97   RRVNRCAGCRKRVGLTGFRCRCGNLFCVEHRYSDRHDCSFDYKAAGREAIARENP  151



>gb|ACM68460.1| stress-associated protein 10 [Solanum pennellii]
Length=160

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 2/58 (3%)
 Frame = +1

Query  67   KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +RE NRCSG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIA+ENP
Sbjct  93   QREANRCSGIGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENP  150



>ref|XP_004252868.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum lycopersicum]
Length=160

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 2/58 (3%)
 Frame = +1

Query  67   KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +RE NRCSG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIA+ENP
Sbjct  93   QREANRCSGMGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENP  150



>gb|EMT33843.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
11 [Aegilops tauschii]
Length=172

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +K  VNRC  CR++VGLTGFRCRCGE+FCG HRYSDRHDCSYDYK+A RDAIARENP
Sbjct  106  SKSSVNRCHNCRKRVGLTGFRCRCGEMFCGAHRYSDRHDCSYDYKSAARDAIARENP  162



>ref|XP_006660259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Oryza brachyantha]
Length=118

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S  ++  VNRC  CR++VGLTGFRCRCGELFCG HRYSDRHDCS+DYK+A RDAIARENP
Sbjct  49   SKASRSSVNRCHSCRKRVGLTGFRCRCGELFCGAHRYSDRHDCSFDYKSAARDAIARENP  108



>ref|XP_006365818.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Solanum tuberosum]
Length=159

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 2/58 (3%)
 Frame = +1

Query  67   KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +RE NRCSG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIA+ENP
Sbjct  92   QREANRCSGIGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENP  149



>ref|XP_009765432.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nicotiana sylvestris]
Length=226

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 50/57 (88%), Gaps = 2/57 (4%)
 Frame = +1

Query  70   REVNRC--SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            RE NRC   GCRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGRDAIARENP
Sbjct  160  REANRCCGIGCRRKVGLLPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGRDAIARENP  216



>dbj|BAJ90521.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=161

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +K  VNRC  CR++VGLTGFRCRCGE+FCG HRYSDRHDCSYDYK+A RDAIARENP
Sbjct  95   SKSSVNRCHNCRKRVGLTGFRCRCGEMFCGAHRYSDRHDCSYDYKSAARDAIARENP  151



>ref|XP_002460447.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
 gb|EER96968.1| hypothetical protein SORBIDRAFT_02g028240 [Sorghum bicolor]
Length=172

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCGELFCG HRYSDRH CSYDYK AGRDAIARENP
Sbjct  110  VNRCSSCRKRVGLTGFRCRCGELFCGAHRYSDRHGCSYDYKGAGRDAIARENP  162



>ref|XP_003599112.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Medicago truncatula]
 gb|AES69363.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
 gb|AFK37674.1| unknown [Medicago truncatula]
Length=163

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             KR V+RCSGCRRKVGL GFRCRCGELFC +HRYSDRHDC YDYK  GR+ IARENP
Sbjct  97   VKRVVSRCSGCRRKVGLAGFRCRCGELFCADHRYSDRHDCGYDYKKVGREEIARENP  153



>ref|XP_008795709.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
 ref|XP_008778992.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Phoenix dactylifera]
Length=157

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = +1

Query  70   REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            R V+RC+GCR++VGLTGFRCRCG+LFC +HRYSDRHDCS+DYKAAGR+AIARENP
Sbjct  93   RRVSRCAGCRKRVGLTGFRCRCGKLFCAQHRYSDRHDCSFDYKAAGREAIARENP  147



>emb|CBI16411.3| unnamed protein product [Vitis vinifera]
Length=142

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +REVNRCSGC+RK+GL GFRCRCGE+FC +HRYSDRH+C +DYKAAGR+ IA+ENP
Sbjct  77   RREVNRCSGCKRKLGLIGFRCRCGEMFCSKHRYSDRHECRFDYKAAGREMIAKENP  132



>ref|XP_002285543.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5 [Vitis vinifera]
Length=126

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +REVNRCSGC+RK+GL GFRCRCGE+FC +HRYSDRH+C +DYKAAGR+ IA+ENP
Sbjct  61   RREVNRCSGCKRKLGLIGFRCRCGEMFCSKHRYSDRHECRFDYKAAGREMIAKENP  116



>gb|ABS72032.1| putative AN1-like zinc finger protein, partial [Olea europaea]
Length=76

 Score =   100 bits (249),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 2/57 (4%)
 Frame = +1

Query  70   REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            REV RCSG  CR+K+GL GFRCRCGE+FC EHRYSDRHDC+YDYKAAGR+AIARENP
Sbjct  10   REVTRCSGSGCRKKIGLIGFRCRCGEMFCSEHRYSDRHDCNYDYKAAGREAIARENP  66



>ref|XP_009618607.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=205

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 2/57 (4%)
 Frame = +1

Query  70   REVNRC--SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            RE NRC   GCRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  139  REANRCCGIGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIARENP  195



>ref|XP_011080262.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=147

 Score =   102 bits (253),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 2/57 (4%)
 Frame = +1

Query  70   REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            REV RCSG  CR+++GL GFRCRCG++FC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  81   REVTRCSGSGCRKRIGLMGFRCRCGDVFCSEHRYSDRHDCSYDYKAAGREAIARENP  137



>gb|EYU18023.1| hypothetical protein MIMGU_mgv1a015860mg [Erythranthe guttata]
Length=143

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 2/57 (4%)
 Frame = +1

Query  70   REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            REV RCSG  CR+++GLTGF+CRCG+ FC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  77   REVTRCSGSGCRKRIGLTGFQCRCGDTFCSEHRYSDRHDCSYDYKAAGREAIARENP  133



>ref|XP_011090386.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Sesamum indicum]
Length=143

 Score =   101 bits (252),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 52/57 (91%), Gaps = 2/57 (4%)
 Frame = +1

Query  70   REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            REV RCSG  CR+++GL GFRCRCG++FC EHRYSDRHDCSYDYKAAGR+AIARENP
Sbjct  77   REVTRCSGSGCRKRIGLMGFRCRCGDVFCSEHRYSDRHDCSYDYKAAGREAIARENP  133



>gb|ACM68447.1| stress-associated protein 10 [Solanum lycopersicum]
Length=160

 Score =   102 bits (253),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 2/58 (3%)
 Frame = +1

Query  67   KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +RE NR SG  CRRKVGL  FRCRCGE+FC EHRYSDRHDCSYDYKAAGR+AIA+ENP
Sbjct  93   QREANRSSGMGCRRKVGLMPFRCRCGEVFCSEHRYSDRHDCSYDYKAAGREAIAKENP  150



>ref|XP_009589288.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=151

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (88%), Gaps = 2/57 (4%)
 Frame = +1

Query  70   REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            RE NRCSG  CRRKVGL GFRCRCG++FC EHRYSDRH CSYDYKA GR+AIARENP
Sbjct  85   REANRCSGIGCRRKVGLIGFRCRCGDVFCSEHRYSDRHGCSYDYKAVGREAIARENP  141



>ref|XP_009799138.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana sylvestris]
Length=142

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 2/58 (3%)
 Frame = +1

Query  67   KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            + E NRCSG  CRRKVGL GFRCRCGE+FC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  75   REEANRCSGIGCRRKVGLIGFRCRCGEVFCYEHRYSDRHSCSYDYKAAGREAIARENP  132



>gb|EYU46288.1| hypothetical protein MIMGU_mgv1a015852mg [Erythranthe guttata]
Length=143

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 51/57 (89%), Gaps = 2/57 (4%)
 Frame = +1

Query  70   REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            RE  RCSG  CR+++GL GFRCRCG++FC EHRYSDRHDCSYDYKAAGRDAIA+ENP
Sbjct  77   REATRCSGSGCRKRIGLVGFRCRCGDVFCSEHRYSDRHDCSYDYKAAGRDAIAKENP  133



>gb|EAZ45178.1| hypothetical protein OsJ_29820 [Oryza sativa Japonica Group]
Length=164

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct  102  VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  154



>ref|XP_002445913.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
 gb|EES15408.1| hypothetical protein SORBIDRAFT_07g027940 [Sorghum bicolor]
Length=176

 Score =   102 bits (253),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRC  CR++VGLTGFRCRCGELFCG HRYSDRHDC +DYKA GRDAIARENP
Sbjct  114  VNRCQSCRKRVGLTGFRCRCGELFCGAHRYSDRHDCCFDYKAVGRDAIARENP  166



>ref|XP_009596933.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Nicotiana tomentosiformis]
Length=142

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 51/58 (88%), Gaps = 2/58 (3%)
 Frame = +1

Query  67   KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            + E NRCSG  CRRKVGL GFRCRCGE+FC EHRYSDRH CSYDYKAAGR+AIARENP
Sbjct  75   REEANRCSGIGCRRKVGLIGFRCRCGEVFCYEHRYSDRHSCSYDYKAAGREAIARENP  132



>emb|CDP20562.1| unnamed protein product [Coffea canephora]
Length=159

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 50/55 (91%), Gaps = 2/55 (4%)
 Frame = +1

Query  76   VNRCS--GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS  GCRRK+GL GFRCRCG++FC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct  95   VNRCSCTGCRRKLGLMGFRCRCGDMFCSEHRYSDRHDCSYDYKTAGREAIARENP  149



>ref|NP_001063521.1| Os09g0486500 [Oryza sativa Japonica Group]
 sp|A2Z2J6.1|SAP1_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Indica Group]
 sp|A3C039.2|SAP1_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 1; Short=OsSAP1; AltName: Full=Multiple 
stress-responsive zinc finger protein ISAP1; Short=OsiSAP1 
[Oryza sativa Japonica Group]
 gb|AAF74344.1|AF140722_1 multiple stress-responsive zinc-finger protein [Oryza sativa 
Indica Group]
 gb|AAN15744.1| multiple stress-associated zinc-finger protein [Oryza sativa 
Indica Group]
 dbj|BAF25435.1| Os09g0486500 [Oryza sativa Japonica Group]
 gb|EAZ09557.1| hypothetical protein OsI_31835 [Oryza sativa Indica Group]
 gb|ABQ12733.1| Zn-finger protein [Oryza sativa Indica Group]
 gb|ABR26098.1| multiple stress-responsive zinc-finger protein isap1 [Oryza sativa 
Indica Group]
 dbj|BAG87708.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91792.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97589.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99795.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct  102  VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  154



>ref|XP_004973853.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11-like [Setaria italica]
Length=178

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P    VNRC  CR++VGLTGFRCRCGELFCG HRYSDRHDC++DYK  GRDAIARENP
Sbjct  111  PRTSSVNRCHNCRKRVGLTGFRCRCGELFCGAHRYSDRHDCNFDYKGVGRDAIARENP  168



>gb|EPS66139.1| hypothetical protein M569_08638, partial [Genlisea aurea]
Length=76

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 52/57 (91%), Gaps = 2/57 (4%)
 Frame = +1

Query  70   REVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            REV RCSG  CR++VGL GFRCRCG+LFC EHRYSDRHDCSYDYKAAGR++IARENP
Sbjct  10   REVARCSGSGCRKRVGLVGFRCRCGDLFCSEHRYSDRHDCSYDYKAAGRESIARENP  66



>gb|ABI23728.1| stress-tolerance zinc finger protein [Chrysanthemum x morifolium]
Length=170

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct  108  VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  160



>gb|EAZ09556.1| hypothetical protein OsI_31833 [Oryza sativa Indica Group]
Length=164

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct  102  VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  154



>gb|AGQ04314.1| SAP1, partial [Oryza nivara]
 gb|AGQ04318.1| SAP1, partial [Oryza barthii]
 gb|AGQ04320.1| SAP1, partial [Oryza glaberrima]
 gb|AGQ04321.1| SAP1, partial [Oryza sativa Indica Group]
 gb|AGQ04322.1| SAP1, partial [Oryza sativa Japonica Group]
Length=147

 Score =   100 bits (250),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct  85   VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  137



>ref|NP_001062181.1| Os08g0504700 [Oryza sativa Japonica Group]
 sp|Q84PD8.1|SAP11_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 11; Short=OsSAP11 [Oryza sativa Japonica 
Group]
 gb|AAO72541.1| pathogenesis-related protein-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD08826.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAD10163.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 gb|AAT11791.1| putative zinc finger transcription factor [Oryza sativa Japonica 
Group]
 dbj|BAF24095.1| Os08g0504700 [Oryza sativa Japonica Group]
 gb|EAZ07540.1| hypothetical protein OsI_29795 [Oryza sativa Indica Group]
 gb|EAZ43265.1| hypothetical protein OsJ_27862 [Oryza sativa Japonica Group]
Length=170

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRC  CRR+VGLTGFRCRCGEL+CG HRYSDRHDCS+DYK+A RDAIARENP
Sbjct  108  VNRCHSCRRRVGLTGFRCRCGELYCGAHRYSDRHDCSFDYKSAARDAIARENP  160



>ref|XP_009402699.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
 ref|XP_009402700.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=145

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  49   NRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARE  228
            ++  P  R +NRCS CR+KVGLTGFRCRCG+LFC  HRYSD HDCS+DYKAAGR+ IA+ 
Sbjct  74   SKQAPPLRYINRCSTCRKKVGLTGFRCRCGDLFCASHRYSDTHDCSFDYKAAGREQIAKA  133

Query  229  NP  234
            NP
Sbjct  134  NP  135



>gb|AGQ04319.1| SAP1, partial [Oryza meridionalis]
Length=146

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct  84   VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  136



>gb|AGQ04317.1| SAP1, partial [Oryza longistaminata]
Length=147

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct  85   VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  137



>gb|AGQ04315.1| SAP1, partial [Oryza rufipogon]
Length=149

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct  87   VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  139



>gb|AGQ04324.1| SAP1, partial [Oryza officinalis]
Length=145

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct  83   VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  135



>gb|AGQ04316.1| SAP1, partial [Oryza glumipatula]
Length=147

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGFRCRCG LFCGEHRYSDRH CSYDY++A RDAIAR+NP
Sbjct  85   VNRCSRCRKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYQSAARDAIARDNP  137



>gb|AGQ04323.1| SAP1, partial [Oryza punctata]
Length=146

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++V LTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct  84   VNRCSRCRKRVSLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP  136



>ref|XP_004957171.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 1-like [Setaria italica]
Length=169

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRCS CR++VGLTGF CRCGELFCG HRYSDRH CSYDYK A RDAIARENP
Sbjct  107  VNRCSSCRKRVGLTGFWCRCGELFCGAHRYSDRHGCSYDYKGAARDAIARENP  159



>ref|XP_006850149.1| hypothetical protein AMTR_s00022p00236720 [Amborella trichopoda]
 gb|ERN11730.1| hypothetical protein AMTR_s00022p00236720 [Amborella trichopoda]
Length=145

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRC  CR++VGLTGFRCRCG+LFCGEHRYSDRH CS+DYKA G++AIARENP
Sbjct  84   NRCQSCRKRVGLTGFRCRCGDLFCGEHRYSDRHVCSFDYKAVGKEAIARENP  135



>ref|XP_003574738.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 11 [Brachypodium distachyon]
Length=171

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            ++  VNRC  CR++VGLTGFRCRCGE+FC  HRYSDRHDCSYDYK+A RDAIARENP
Sbjct  105  SRSSVNRCRSCRKRVGLTGFRCRCGEMFCCAHRYSDRHDCSYDYKSAARDAIARENP  161



>ref|XP_009415054.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
 gb|AAR96005.1| hypothetical protein [Musa acuminata]
Length=157

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            SP   R  NRCS CR+KVGLTGFRCRCG+LFCG HRYSD H+CS+DYKAAGR+ IA+ NP
Sbjct  88   SPAPVRFSNRCSACRKKVGLTGFRCRCGDLFCGRHRYSDAHECSFDYKAAGREEIAKANP  147



>ref|XP_009385134.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=156

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P  R V+RCS CR++VGLTGFRCRCG+LFC  HRYSD HDCS+DYKAAGR+ IA+ NP
Sbjct  89   PPVRLVSRCSSCRKRVGLTGFRCRCGDLFCASHRYSDTHDCSFDYKAAGREQIAKANP  146



>ref|XP_009416648.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
 ref|XP_009416649.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=153

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            SP   R  NRCS CR+KVGLTGFRCRCG+LFCG HRYSD H+CS+DYKA GR+ IAR NP
Sbjct  84   SPTPVRFSNRCSTCRKKVGLTGFRCRCGDLFCGRHRYSDAHECSFDYKALGREEIARANP  143



>ref|XP_009416009.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=147

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S P  R  NRCS C RKVGLTGFRCRCG+LFCG HRYSD HDCS+DYKA GR+ IA+ NP
Sbjct  78   SKPQVRFSNRCSTCGRKVGLTGFRCRCGDLFCGRHRYSDVHDCSFDYKALGREEIAKANP  137



>ref|NP_001266661.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
 gb|ACG38807.1| multiple stress-responsive zinc-finger protein ISAP1 [Zea mays]
Length=167

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            V RC  CR++VGLTGFRCRCG+LFCG HRYSDRHDC +DY+AAGRDAIAR+NP
Sbjct  105  VRRCQTCRKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNP  157



>ref|NP_001106266.1| LOC100127541 [Zea mays]
 gb|ABS83246.1| AN15 [Zea mays]
 tpg|DAA62024.1| TPA: AN15 [Zea mays]
Length=163

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            A+   NRCS CR++VGLTGFRCRCG+LFCG HRYSDRH C YDY+ A RDAIARENP
Sbjct  97   ARTSANRCSSCRKRVGLTGFRCRCGDLFCGAHRYSDRHGCRYDYRGAARDAIARENP  153



>ref|XP_010928202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PAK+  NRCS C +KVGL GF+CRCGE+FC  HRYSD+H+C++DYK AG+DAIA+ NP
Sbjct  97   PAKKPTNRCSFCNKKVGLMGFKCRCGEVFCSLHRYSDKHNCAFDYKGAGQDAIAKANP  154



>ref|XP_009393780.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=146

 Score = 94.7 bits (234),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S P  R   RCS CR+KVGLTGFRCRCG+LFCG HRYSD HDCS+DYKA GR+ IA+ NP
Sbjct  77   SKPPVRYSKRCSTCRKKVGLTGFRCRCGDLFCGRHRYSDSHDCSFDYKAFGREQIAKANP  136



>ref|NP_001140650.1| uncharacterized protein LOC100272725 [Zea mays]
 gb|ACF84270.1| unknown [Zea mays]
 tpg|DAA47934.1| TPA: multiple stress-responsive zinc-finger protein ISAP1 [Zea 
mays]
Length=176

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            V RC  CR++VGLTGFRCRCG+LFCG HRYSDRHDC +DY+AAGRDAIAR+NP
Sbjct  114  VRRCQTCRKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNP  166



>ref|NP_001106263.1| AN110 [Zea mays]
 gb|ABS83249.1| AN110 [Zea mays]
Length=174

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            V RC  CR++VGLTGFRCRCG+LFCG HRYSDRHDC +DY+AAGRDAIAR+NP
Sbjct  112  VRRCQTCRKRVGLTGFRCRCGDLFCGAHRYSDRHDCCFDYRAAGRDAIARDNP  164



>gb|EPS64266.1| hypothetical protein M569_10515, partial [Genlisea aurea]
Length=141

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 2/58 (3%)
 Frame = +1

Query  67   KREVNRCSG--CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            + E  RCSG  CR++VGL GFRCRCG+LFC EHRYSDRHDC+YDYK AGR+AI++ENP
Sbjct  74   REEATRCSGSGCRKRVGLIGFRCRCGDLFCSEHRYSDRHDCNYDYKKAGREAISKENP  131



>ref|XP_001771457.1| predicted protein [Physcomitrella patens]
 gb|EDQ63657.1| predicted protein [Physcomitrella patens]
Length=188

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P++   NRC  CR++VGLTGF+CRCG LFC  HRYSD+H C+YDYKAAG++AIA+ NP
Sbjct  121  PSRPAPNRCGSCRKRVGLTGFQCRCGHLFCALHRYSDKHSCTYDYKAAGQEAIAKANP  178



>ref|XP_001770822.1| predicted protein [Physcomitrella patens]
 gb|EDQ64346.1| predicted protein [Physcomitrella patens]
Length=188

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P++ E NRC  CR++VGLTGF+CRCG L+C  HRYSD+H C+YDYKAAG++AIA+ NP
Sbjct  121  PSRPEPNRCGSCRKRVGLTGFKCRCGNLYCALHRYSDKHTCTYDYKAAGQEAIAKANP  178



>ref|XP_009405572.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=143

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P  R  NRCS CR+KVGLTGFRC+CG+LFCG H+Y+D HDCS+DYKA GR+ IA+ NP
Sbjct  76   PPVRFSNRCSTCRKKVGLTGFRCQCGDLFCGRHQYTDTHDCSFDYKAFGREEIAKANP  133



>ref|XP_009416000.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=147

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            S P  + +N CS C RKVGLTGFRCRCG+LFCG HRYSD HDCS+DYKA GR+ IA+ NP
Sbjct  78   SKPQVKFINGCSTCGRKVGLTGFRCRCGDLFCGRHRYSDTHDCSFDYKALGREEIAKANP  137



>ref|XP_008804197.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Phoenix dactylifera]
 ref|XP_008804198.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Phoenix dactylifera]
Length=151

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGFRCRCG+LFCG HRYSD HDCS+DYK AGR+ IA+ NP
Sbjct  90   NRCSTCRKRVGLTGFRCRCGDLFCGRHRYSDTHDCSFDYKTAGREEIAKANP  141



>ref|XP_002160663.2| PREDICTED: AN1-type zinc finger protein 6-like [Hydra vulgaris]
Length=161

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +1

Query  49   NRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARE  228
            N   P K + NRC  CR+KVGLTGF CRCG LFCG HRYSD+H+CSYDYKA GR+ IA+ 
Sbjct  90   NSECPGKIKKNRCCSCRKKVGLTGFECRCGGLFCGIHRYSDKHNCSYDYKADGREQIAKA  149

Query  229  NP  234
            NP
Sbjct  150  NP  151



>ref|XP_011080265.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011080266.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P  K   NRCS C+++VGLTGF+CRCG LFCG HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  104  PKTKEGPNRCSTCKKRVGLTGFKCRCGYLFCGSHRYSDKHDCPFDYRTAARDAIAKANP  162



>ref|XP_009589284.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
 ref|XP_009589285.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
Length=172

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   +RCS C++KVGLTGF+CRCG L+CG HRYSD+HDC +DY++AGRDAIA+ NP
Sbjct  106  AKVGPSRCSSCKKKVGLTGFKCRCGNLYCGSHRYSDKHDCQFDYRSAGRDAIAKANP  162



>ref|XP_009770813.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana sylvestris]
Length=172

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +RCS C++KVGLTGF+CRCG L+CG HRYSD+HDC +DY++AGRDAIA+ NP
Sbjct  111  SRCSSCKKKVGLTGFKCRCGNLYCGSHRYSDKHDCQFDYRSAGRDAIAKANP  162



>ref|XP_010925078.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Elaeis guineensis]
Length=164

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K+  NRCS C +KVGL GF+CRCGE+FC  HRYSD+HDC++DY+ AG+DAIA+ NP
Sbjct  97   PVKKPPNRCSFCNKKVGLMGFKCRCGEVFCSVHRYSDKHDCAFDYRGAGQDAIAKANP  154



>ref|XP_009406414.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Musa acuminata subsp. malaccensis]
Length=161

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             RCS CR+KVGLTGFRCRCG+LFCG HRYSD H+CS+DYKAAGR+ IA+ NP
Sbjct  100  KRCSTCRKKVGLTGFRCRCGDLFCGRHRYSDAHECSFDYKAAGREEIAKANP  151



>ref|XP_002993103.1| hypothetical protein SELMODRAFT_187216 [Selaginella moellendorffii]
 gb|EFJ05851.1| hypothetical protein SELMODRAFT_187216 [Selaginella moellendorffii]
Length=176

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = +1

Query  1    VARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHD  180
            +A G  T+  E++   ++  P  R  NRC  CR+++GLTGF+CRCG++FC  HRYSD+H+
Sbjct  91   IATGATTLVTEDDSSASQEKP--RLPNRCLACRKRLGLTGFKCRCGDVFCSMHRYSDKHN  148

Query  181  CSYDYKAAGRDAIARENP  234
            CS+DYKAAGR+AIA+ NP
Sbjct  149  CSFDYKAAGREAIAKANP  166



>gb|EPS60935.1| induced stolon tip protein [Genlisea aurea]
Length=156

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P +R VNRCSGCR+KVGLTGFRCRCGELFC EHRYSDRHDC YDY+AA R AIARENP
Sbjct  89   PLERSVNRCSGCRKKVGLTGFRCRCGELFCAEHRYSDRHDCRYDYRAAARAAIARENP  146



>gb|EYU18025.1| hypothetical protein MIMGU_mgv1a014524mg [Erythranthe guttata]
 gb|EYU18026.1| hypothetical protein MIMGU_mgv1a014524mg [Erythranthe guttata]
Length=186

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P AK    RCS C+++VGLTGF+CRCG ++CG HRYSD+HDC +DY+ AGRDAIA+ NP
Sbjct  118  PKAKEGPARCSSCKKRVGLTGFKCRCGNMYCGSHRYSDKHDCPFDYRTAGRDAIAKANP  176



>ref|XP_008791733.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Phoenix dactylifera]
Length=159

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGFRCRCG+LFCG HRYSD H+CS+DYKAAGR+ IA+ NP
Sbjct  98   NRCSTCRKRVGLTGFRCRCGDLFCGRHRYSDTHNCSFDYKAAGREEIAKANP  149



>ref|XP_010912823.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Elaeis guineensis]
 ref|XP_010912824.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Elaeis guineensis]
 ref|XP_010912825.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Elaeis guineensis]
Length=157

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGFRCRCG+LFCG HRYSD H+CS+DYKAAGR+ IA+ NP
Sbjct  96   NRCSTCRKRVGLTGFRCRCGDLFCGRHRYSDTHNCSFDYKAAGREEIAKANP  147



>ref|XP_010555326.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
 ref|XP_010555327.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
Length=162

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PP   + NRCS CR++VGLTGF+CRCG  FC +HRYSD+H+C +DYK  G+DAIA+ NP
Sbjct  94   PPPPLKSNRCSSCRKRVGLTGFKCRCGHTFCSQHRYSDKHNCVFDYKTVGQDAIAKANP  152



>dbj|BAO74165.1| zinc finger protein [Cucurbita pepo subsp. ovifera]
Length=176

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             K   NRCS CR++VGLTGF CRCG LFC  HRYSD+HDC++DY+A GR+AIA+ NP
Sbjct  110  VKASPNRCSSCRKRVGLTGFNCRCGSLFCAVHRYSDKHDCTFDYQAVGREAIAKANP  166



>dbj|BAO74166.1| zinc finger protein [Cucurbita pepo subsp. pepo]
Length=176

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             K   NRCS CR+++GLTGF CRCG LFC  HRYSD+HDC++DY+A GR+AIA+ NP
Sbjct  110  VKASPNRCSSCRKRIGLTGFNCRCGSLFCAVHRYSDKHDCTFDYQAVGREAIAKANP  166



>gb|EYU46282.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata]
 gb|EYU46283.1| hypothetical protein MIMGU_mgv1a014897mg [Erythranthe guttata]
Length=174

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +1

Query  49   NRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARE  228
            +  P AK   ++CS C+++VGLTGF+CRCG  FCG HRYSD+HDC +DY+ AGRDAIA+ 
Sbjct  103  DEPPRAKEGPSKCSSCKKRVGLTGFKCRCGSTFCGSHRYSDKHDCPFDYRTAGRDAIAKA  162

Query  229  NP  234
            NP
Sbjct  163  NP  164



>gb|KDP35279.1| hypothetical protein JCGZ_09438 [Jatropha curcas]
Length=133

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 6/78 (8%)
 Frame = +1

Query  1    VARGEKTVeeeeeeeeNRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHD  180
            VA GE+T        ENR P A    NRCS CR++VGLTGF CRCG+ FC  HRYSD+H+
Sbjct  52   VAGGEQT---GANSSENRPPAA---ANRCSFCRKRVGLTGFNCRCGQTFCSLHRYSDKHN  105

Query  181  CSYDYKAAGRDAIARENP  234
            C +DYK+AG+DAIA+ NP
Sbjct  106  CVFDYKSAGQDAIAKANP  123



>ref|XP_004229614.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Solanum lycopersicum]
Length=167

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRCS CRR+VGLTGF CRCG LFC  HRYSD+H+C YDY+ AG+DAIA+ NP
Sbjct  101  AKEGPNRCSTCRRRVGLTGFNCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANP  157



>dbj|BAO74167.1| zinc finger protein [Cucurbita pepo subsp. pepo]
Length=176

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             K   NRCS CR+++GLTGF CRCG LFC  HRYSD+HDC++DY+A GR+AIA+ NP
Sbjct  110  VKASPNRCSSCRKRIGLTGFNCRCGSLFCAVHRYSDKHDCTFDYQAVGREAIAKANP  166



>gb|ACM68441.1| stress-associated protein 4 [Solanum lycopersicum]
Length=161

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRCS CRR+VGLTGF CRCG LFC  HRYSD+H+C YDY+ AG+DAIA+ NP
Sbjct  95   AKEGPNRCSTCRRRVGLTGFNCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANP  151



>ref|XP_008794968.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PAK   NRCS C ++VGL GF+CRCGELFC  HRYSD+H+C++DY+ AG+DAIA+ NP
Sbjct  97   PAKETPNRCSFCNKRVGLMGFKCRCGELFCSLHRYSDKHNCAFDYRGAGQDAIAKANP  154



>gb|ACM68454.1| stress-associated protein 4 [Solanum pennellii]
Length=161

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRCS CRR+VGLTGF CRCG LFC  HRYSD+H+C YDY+ AG+DAIA+ NP
Sbjct  95   AKEGPNRCSTCRRRVGLTGFNCRCGNLFCSAHRYSDKHECPYDYRKAGQDAIAKANP  151



>ref|XP_008461274.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Cucumis melo]
Length=172

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             K   NRCS CR++VGLTGF CRCG LFC  HRYSD+H+CS+DY+A GR+AIA+ NP
Sbjct  106  VKESPNRCSSCRKRVGLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANP  162



>ref|XP_004135920.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform 1 [Cucumis sativus]
 ref|XP_004135921.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform 2 [Cucumis sativus]
 gb|KGN45145.1| hypothetical protein Csa_7G428820 [Cucumis sativus]
Length=172

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             K   NRCS CR++VGLTGF CRCG LFC  HRYSD+H+CS+DY+A GR+AIA+ NP
Sbjct  106  VKESPNRCSSCRKRVGLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANP  162



>ref|XP_004158200.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 1 [Cucumis sativus]
 ref|XP_004158201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 2 [Cucumis sativus]
 ref|XP_004158202.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 3 [Cucumis sativus]
 ref|XP_004158203.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like isoform 4 [Cucumis sativus]
Length=172

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             K   NRCS CR++VGLTGF CRCG LFC  HRYSD+H+CS+DY+A GR+AIA+ NP
Sbjct  106  VKESPNRCSSCRKRVGLTGFNCRCGSLFCAVHRYSDKHNCSFDYQAVGREAIAKANP  162



>ref|XP_010257702.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=170

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 5/62 (8%)
 Frame = +1

Query  49   NRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARE  228
            N+ PP     NRC  C+++VGLTGF+CRCG +FCG HRYS++H CSYDY++AGRDAIA+ 
Sbjct  104  NKQPP-----NRCLACQKRVGLTGFKCRCGGIFCGVHRYSEKHGCSYDYRSAGRDAIAKA  158

Query  229  NP  234
            NP
Sbjct  159  NP  160



>ref|XP_006345467.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum tuberosum]
Length=167

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRCS CRR+VGLTGF CRCG LFC  HRYSD+H+C YDY  AG+DAIA+ NP
Sbjct  101  AKEGPNRCSTCRRRVGLTGFNCRCGNLFCSAHRYSDKHECPYDYHKAGQDAIAKANP  157



>ref|XP_008808665.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808673.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
 ref|XP_008808683.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Phoenix dactylifera]
Length=164

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K+  NRCS C ++VGL GF+CRCGE+FC  HRYSD+HDC++DY+ AG+DAIA+ NP
Sbjct  97   PVKKPPNRCSFCNKRVGLMGFKCRCGEVFCSLHRYSDKHDCAFDYRGAGQDAIAKANP  154



>gb|KJB51967.1| hypothetical protein B456_008G240900 [Gossypium raimondii]
Length=171

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P   +  NRC  CR+KVGLTGF+C+CG  FCGEHRY+++HDCS+D+K  GRDAIA+ NP
Sbjct  103  PAEPKAANRCFICRKKVGLTGFKCKCGSTFCGEHRYAEKHDCSFDFKGTGRDAIAKANP  161



>ref|XP_011078867.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 1/61 (2%)
 Frame = +1

Query  55   SPPAKREV-NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN  231
            S P  +EV NRC+ CR++VGLTGF C+CG LFC  HRYSD+H+C +DY+ AGRDAIA+ N
Sbjct  102  SEPKPKEVPNRCTTCRKRVGLTGFNCKCGNLFCSVHRYSDKHECPFDYRTAGRDAIAKAN  161

Query  232  P  234
            P
Sbjct  162  P  162



>gb|ABD65463.1| DNA binding/zinc ion binding protein [Gossypium hirsutum]
Length=171

 Score = 91.7 bits (226),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P   +  NRC  CR+KVGLTGF+C+CG  FCGEHRY+++HDCS+D+K  GRDAIA+ NP
Sbjct  103  PAEPKAANRCFICRKKVGLTGFKCKCGSTFCGEHRYAEKHDCSFDFKGTGRDAIAKANP  161



>ref|XP_006427949.1| hypothetical protein CICLE_v10026622mg [Citrus clementina]
 ref|XP_006464510.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Citrus sinensis]
 gb|ESR41189.1| hypothetical protein CICLE_v10026622mg [Citrus clementina]
Length=171

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P KR  NRCS CR+++GLTGF+CRC + FC  HRYSD+H+C +DYK+AG+DAIA+ NP
Sbjct  104  PEKRPANRCSFCRKRIGLTGFKCRCEQTFCSLHRYSDKHNCVFDYKSAGQDAIAKANP  161



>ref|XP_004288126.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
 ref|XP_004288127.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Fragaria vesca subsp. vesca]
Length=167

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P KR  NRCS CR++VGLTGF+CRCG+ FC  HRYS+ H+C +DYK+AG+DAIA+ NP
Sbjct  100  PEKRPANRCSFCRKRVGLTGFKCRCGDTFCSLHRYSNSHNCMFDYKSAGQDAIAKANP  157



>ref|XP_003557532.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_003557533.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
 ref|XP_010228317.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X2 [Brachypodium distachyon]
Length=160

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K   NRC  CR+KVGLTGF+CRCG  FC  HRY+D H+CS+DYKAAGR+ IA++NP
Sbjct  93   PPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSMHRYADSHECSFDYKAAGREQIAKQNP  150



>gb|KDO50474.1| hypothetical protein CISIN_1g030772mg [Citrus sinensis]
Length=171

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P KR  NRCS CR+++GLTGF+CRC + FC  HRYSD+H+C +DYK+AG+DAIA+ NP
Sbjct  104  PEKRPANRCSFCRKRIGLTGFKCRCEQTFCSLHRYSDKHNCVFDYKSAGQDAIAKANP  161



>ref|XP_010645797.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 5-like [Vitis vinifera]
Length=126

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  52   RSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN  231
            R+   +REVN CS C+RK+GL GFR RCG +FC  HRYSDRH+C +DYKAAGR  IA+EN
Sbjct  56   RNKDMRREVNWCSKCKRKLGLIGFRYRCGNMFCSNHRYSDRHECRFDYKAAGRAMIAKEN  115

Query  232  P  234
            P
Sbjct  116  P  116



>ref|XP_010261028.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Nelumbo nucifera]
Length=164

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K   NRCS C+++VGLTGF+CRCG+ FC  HRYSD+H+C +DYK AG+DAIA+ NP
Sbjct  97   PGKLPANRCSFCKKRVGLTGFKCRCGQTFCSLHRYSDKHNCLFDYKTAGQDAIAKANP  154



>ref|XP_010268591.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nelumbo nucifera]
Length=163

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K   NRCS CR++VGLTGF+CRCG+ FC  HRY+D+H+C +DYK AG+DAIA+ NP
Sbjct  96   PGKLPANRCSFCRKRVGLTGFKCRCGQTFCSLHRYTDKHNCLFDYKTAGQDAIAKANP  153



>ref|XP_004228358.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
 ref|XP_004228359.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
Length=171

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRC  C++KVG+TGF+CRCG L+CG HRYSD+HDC +DY++AG+DAIA+ NP
Sbjct  105  AKVGPNRCGTCKKKVGITGFKCRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANP  161



>ref|XP_001756532.1| predicted protein [Physcomitrella patens]
 gb|EDQ78486.1| predicted protein [Physcomitrella patens]
Length=172

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P++ + NRC  C+++VGLTGF CRCG LFC  HRYSD+H C++DYK AGRDAI++ NP
Sbjct  105  PSRPKANRCFSCKKRVGLTGFECRCGNLFCSAHRYSDKHSCTFDYKTAGRDAISKANP  162



>gb|ACM68440.1| stress-associated protein 3 [Solanum lycopersicum]
Length=171

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRC  C++KVG+TGF+CRCG L+CG HRYSD+HDC +DY++AG+DAIA+ NP
Sbjct  105  AKVGPNRCGTCKKKVGITGFKCRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANP  161



>ref|NP_001275387.1| zinc finger A20 and AN1 domain-containing stress-associated protein 
8-like [Solanum tuberosum]
 gb|AFW90615.1| stress-associated protein 3 [Solanum tuberosum]
 gb|AFX66985.1| stress-associated protein 3 [Solanum tuberosum]
Length=171

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRC  C++KVG+TGF+CRCG L+CG HRYSD+HDC +DY++AG+DAIA+ NP
Sbjct  105  AKVGPNRCGTCKKKVGITGFKCRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANP  161



>ref|XP_011075194.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011075195.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
 ref|XP_011075196.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Sesamum indicum]
Length=172

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRC+ C ++VGLTGF CRCG LFC  HRYSD+HDC +DY+AAGRDAI++ NP
Sbjct  111  NRCTTCHKRVGLTGFSCRCGNLFCSTHRYSDKHDCPFDYQAAGRDAISKANP  162



>gb|ACM68453.1| stress-associated protein 3 [Solanum pennellii]
Length=171

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRC  C++KVG+TGF+CRCG L+CG HRYSD+HDC +DY++AG+DAIA+ NP
Sbjct  105  AKVGPNRCGTCKKKVGITGFKCRCGNLYCGAHRYSDKHDCLFDYRSAGQDAIAKANP  161



>ref|XP_010228315.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
 ref|XP_010228316.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 isoform X1 [Brachypodium distachyon]
Length=205

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K   NRC  CR+KVGLTGF+CRCG  FC  HRY+D H+CS+DYKAAGR+ IA++NP
Sbjct  138  PPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSMHRYADSHECSFDYKAAGREQIAKQNP  195



>ref|NP_001058985.1| Os07g0168800 [Oryza sativa Japonica Group]
 sp|Q7Y1W9.1|SAP9_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 9; Short=OsSAP9 [Oryza sativa Japonica 
Group]
 gb|AAP37480.1| putative A20/AN1-type zinc finger protein ZFP177 [Oryza sativa 
Japonica Group]
 dbj|BAD31780.1| putative zinc finger protein 216 [Oryza sativa Japonica Group]
 dbj|BAF20899.1| Os07g0168800 [Oryza sativa Japonica Group]
 gb|EAZ02907.1| hypothetical protein OsI_25046 [Oryza sativa Indica Group]
 gb|EAZ38825.1| hypothetical protein OsJ_23237 [Oryza sativa Japonica Group]
 dbj|BAH00672.1| unnamed protein product [Oryza sativa Japonica Group]
Length=161

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K   NRC  CR+KVGLTGF+CRCG  FC  HRY++ HDC++DYK AGRD IA++NP
Sbjct  94   PPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSTHRYTEAHDCTFDYKKAGRDQIAKQNP  151



>ref|XP_009376154.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376155.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379441.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379442.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=172

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  82   RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            RCS C ++VGLTGF CRCG LFC  HRYSD+HDC+YDY+ AGRDAIA+ NP
Sbjct  112  RCSSCNKRVGLTGFNCRCGHLFCAVHRYSDKHDCAYDYRTAGRDAIAKANP  162



>ref|XP_009609312.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
 ref|XP_009609313.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana tomentosiformis]
Length=170

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  67   KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            K  ++RC+ CR++VGLTGF C+CG LFC  HRYSD+HDC +DYK AGRDAIA+ NP
Sbjct  105  KEGLSRCNTCRKRVGLTGFNCKCGNLFCAVHRYSDKHDCPFDYKNAGRDAIAKANP  160



>gb|ABI31653.1| zinc finger protein [Camellia sinensis]
Length=173

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGF CRCG LFC  HRYSD+HDC +DY++A +DAIA+ NP
Sbjct  112  NRCSACRKRVGLTGFNCRCGNLFCAVHRYSDKHDCPFDYRSAAQDAIAKANP  163



>ref|XP_002279037.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9 [Vitis vinifera]
 emb|CAN73104.1| hypothetical protein VITISV_042893 [Vitis vinifera]
Length=141

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K   NRCS CR++VGLTGF+CRCG+ FC  HRYSD+H+C +DYK+A +DAIA+ NP
Sbjct  74   PEKCPANRCSFCRKRVGLTGFKCRCGQTFCSMHRYSDKHNCVFDYKSAAQDAIAKANP  131



>gb|ABK21003.1| unknown [Picea sitchensis]
 gb|ACN40831.1| unknown [Picea sitchensis]
Length=180

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             NRC  CR++VGLTGFRCRCG++FC  HRYSD+H+C+YDYK AGR+AIA+ NP
Sbjct  118  TNRCFSCRKRVGLTGFRCRCGDMFCALHRYSDKHNCTYDYKTAGREAIAKANP  170



>ref|XP_002975420.1| hypothetical protein SELMODRAFT_150464 [Selaginella moellendorffii]
 gb|EFJ23621.1| hypothetical protein SELMODRAFT_150464 [Selaginella moellendorffii]
Length=175

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  70   REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            R  NRC  CR+++GLTGF+CRCG++FC  HRYSD+H+CS+DYKAAGR+AIA+ NP
Sbjct  111  RLSNRCLACRKRLGLTGFKCRCGDVFCSMHRYSDKHNCSFDYKAAGREAIAKANP  165



>ref|XP_007206025.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
 gb|EMJ07224.1| hypothetical protein PRUPE_ppa012468mg [Prunus persica]
Length=168

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P KR  NRC+ CR++VGLTGF+CRCG+ FC  HRYS++H+C +DYK+AG++AIA+ NP
Sbjct  100  PEKRPANRCNFCRKRVGLTGFKCRCGQTFCSLHRYSNKHNCVFDYKSAGQEAIAKANP  157



>ref|XP_004951572.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Setaria italica]
 ref|XP_004951573.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Setaria italica]
Length=171

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P AK   NRC+ CR++VGLTGF CRCG ++C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  103  PKAKEGPNRCATCRKRVGLTGFNCRCGNMYCAVHRYSDKHDCHFDYRTAARDAIAKANP  161



>ref|XP_006644627.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 2-like [Oryza brachyantha]
Length=144

 Score = 89.0 bits (219),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P AK + +RC+ C R VGL GF CRCG +FCG HRYSDRHDC YDY+ AGRDAIAR NP
Sbjct  76   PRAKAKKSRCAACGRSVGLMGFECRCGGVFCGAHRYSDRHDCGYDYRGAGRDAIARANP  134



>ref|XP_006361216.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Solanum tuberosum]
Length=171

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRC  C++KVG+TGF+CRCG ++CG HRYSD+HDC +DY++AG+DAIA+ NP
Sbjct  105  AKVGPNRCGTCKKKVGITGFKCRCGNIYCGAHRYSDKHDCLFDYRSAGQDAIAKANP  161



>ref|XP_008384536.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
 ref|XP_008349466.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Malus domestica]
Length=172

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  82   RCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            RCS C ++VGLTGF CRCG LFC  HRYSD+HDC YDY+ AGRDAIA+ NP
Sbjct  112  RCSSCNKRVGLTGFNCRCGHLFCAVHRYSDKHDCPYDYRTAGRDAIAKANP  162



>ref|XP_006842203.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
 gb|ERN03878.1| hypothetical protein AMTR_s00078p00168800 [Amborella trichopoda]
Length=168

 Score = 89.7 bits (221),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K+  NRC  CR++VGL GFRCRCG LFC  HRYSD+H+CS+DY+A+G+DAIA+ NP
Sbjct  101  PQKQAPNRCRLCRKRVGLAGFRCRCGGLFCSTHRYSDKHNCSFDYRASGQDAIAKANP  158



>ref|XP_010279014.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nelumbo nucifera]
Length=172

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGF CRCG +FC  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  111  NRCSSCRKRVGLTGFNCRCGNIFCAVHRYSDKHDCPFDYRTAARDAIAKANP  162



>gb|KHG20851.1| Zinc finger A20 and AN1 domain-containing stress-associated 7 
-like protein [Gossypium arboreum]
Length=218

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P   +  NRC  CR+KVGLTGF+C+CG  FCGEHRY ++H+CS+D+K  GRDAIA+ NP
Sbjct  150  PAESKAANRCFICRKKVGLTGFKCKCGSTFCGEHRYPEKHECSFDFKGTGRDAIAKANP  208



>gb|ACF80251.1| unknown [Zea mays]
Length=174

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  113  NRCSACRKRVGLTGFNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANP  164



>gb|EMT06701.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
1 [Aegilops tauschii]
Length=165

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PA+  VNRCS CR++VGLTGFRCRCG++FCGEHRYSDRH CSYDYKAA RDAIAR+NP
Sbjct  98   PARTSVNRCSSCRKRVGLTGFRCRCGDMFCGEHRYSDRHGCSYDYKAAARDAIARDNP  155



>ref|XP_002285530.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
 ref|XP_002285528.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
Length=172

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS C+++VGLTGF CRCG LFC  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  111  NRCSTCKKRVGLTGFNCRCGHLFCATHRYSDKHDCPFDYRTAARDAIAKANP  162



>gb|AAQ84334.1| stress-associated protein 8 [Oryza sativa Indica Group]
Length=171

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +P  +   NRCS CR++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  102  NPKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANP  161



>gb|AAX14637.1| zinc finger protein [Zea mays]
 gb|ABS83244.1| AN13 [Zea mays]
 gb|ACG36018.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|ACG48526.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|AFW87476.1| zinc finger protein1 isoform 1 [Zea mays]
 gb|AFW87477.1| zinc finger protein1 isoform 2 [Zea mays]
 gb|AFW87478.1| zinc finger protein1 isoform 3 [Zea mays]
Length=174

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  113  NRCSACRKRVGLTGFNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANP  164



>gb|ABK26062.1| unknown [Picea sitchensis]
Length=180

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             NRC  CR++VGLTGFRCRCG++FC  HRYSD+H C+YDYK AGR+AIA+ NP
Sbjct  118  TNRCFSCRKRVGLTGFRCRCGDMFCALHRYSDKHKCTYDYKTAGREAIAKANP  170



>ref|NP_001058066.1| Os06g0612800 [Oryza sativa Japonica Group]
 sp|A2YEZ6.2|SAP8_ORYSI RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Indica Group]
 sp|A3BDI8.1|SAP8_ORYSJ RecName: Full=Zinc finger A20 and AN1 domain-containing stress-associated 
protein 8; Short=OsSAP8; AltName: Full=Stress-associated 
protein 3 [Oryza sativa Japonica Group]
 dbj|BAD35521.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAD35553.1| putative multiple stress-responsive zinc-finger protein [Oryza 
sativa Japonica Group]
 dbj|BAF19980.1| Os06g0612800 [Oryza sativa Japonica Group]
 gb|EAZ37627.1| hypothetical protein OsJ_21962 [Oryza sativa Japonica Group]
 dbj|BAG96476.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91568.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96788.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87267.1| unnamed protein product [Oryza sativa Japonica Group]
Length=171

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +P  +   NRCS CR++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  102  NPKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANP  161



>ref|NP_001055132.1| Os05g0299700 [Oryza sativa Japonica Group]
 sp|Q0DJC7.1|SAP15_ORYSJ RecName: Full=Zinc finger AN1 domain-containing stress-associated 
protein 15; Short=OsSAP15 [Oryza sativa Japonica Group]
 dbj|BAF17046.1| Os05g0299700 [Oryza sativa Japonica Group]
 gb|EAY97427.1| hypothetical protein OsI_19358 [Oryza sativa Indica Group]
 dbj|BAG92958.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63145.1| hypothetical protein OsJ_17953 [Oryza sativa Japonica Group]
 gb|AEP20536.1| zinc finger AN1 domain-containing protein [Oryza sativa Japonica 
Group]
Length=174

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRC+ CR++VGLTGFRCRCGELFC  HR+S+ H+CS+DYK AGR+ IAR NP
Sbjct  112  VNRCNVCRKRVGLTGFRCRCGELFCPRHRHSETHECSFDYKTAGREEIARANP  164



>gb|AFK93416.1| stress-response protein [Triticum aestivum]
Length=175

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            SP  K   NRCS CR++VGLTGF CRCG ++C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  106  SPKRKEGPNRCSTCRKRVGLTGFNCRCGNMYCSLHRYSDKHDCQFDYRTAARDAIAKANP  165



>ref|XP_006654239.1| PREDICTED: zinc finger AN1 domain-containing stress-associated 
protein 15-like [Oryza brachyantha]
Length=178

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  76   VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            VNRC+ CR++VGLTGFRCRCGELFC  HR+S+ H+CS+DYK AGR+ IAR NP
Sbjct  116  VNRCNVCRKRVGLTGFRCRCGELFCPRHRHSETHECSFDYKTAGREEIARANP  168



>ref|XP_002310618.2| hypothetical protein POPTR_0007s06890g [Populus trichocarpa]
 gb|EEE91068.2| hypothetical protein POPTR_0007s06890g [Populus trichocarpa]
Length=156

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRC+ CR+KVGLTGF+CRCG  FC +HRYSD+H+C +DYK+AG+DAIA+ NP
Sbjct  95   NRCNFCRKKVGLTGFKCRCGYTFCSQHRYSDKHNCVFDYKSAGQDAIAKANP  146



>gb|EMT31119.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
4 [Aegilops tauschii]
Length=175

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            SP  K   NRCS CR++VGLTGF CRCG ++C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  106  SPKRKEGPNRCSTCRKRVGLTGFNCRCGNMYCSLHRYSDKHDCQFDYRTAARDAIAKANP  165



>dbj|BAJ86013.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=176

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            SP  K   NRCS CR++VGLTGF CRCG ++C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  107  SPKRKEGPNRCSTCRKRVGLTGFNCRCGNMYCSLHRYSDKHDCQFDYRTAARDAIAKANP  166



>ref|XP_005708852.1| zinc finger (AN1-like) family protein [Galdieria sulphuraria]
 gb|EME32332.1| zinc finger (AN1-like) family protein [Galdieria sulphuraria]
Length=194

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             +++ NRC  C++KVGLTGF CRCG+LFCG+HRYSD+HDCS+DYKA  ++ ++R NP
Sbjct  128  TEKKSNRCQYCQKKVGLTGFTCRCGKLFCGDHRYSDKHDCSFDYKAENKEMLSRANP  184



>ref|XP_009385326.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like, partial [Musa acuminata subsp. malaccensis]
Length=129

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRCS C+++VGLTGF CRCG LFC  HRYSD+HDCS+DY++A ++AIA+ NP
Sbjct  63   AKEGPNRCSTCKKRVGLTGFTCRCGNLFCSVHRYSDKHDCSFDYRSAAQNAIAKANP  119



>ref|XP_009785364.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana sylvestris]
 ref|XP_009785366.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Nicotiana sylvestris]
Length=172

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +RC+ CR++VGLTGF C+CG LFC  HRYSD+HDC +DYK AGRDAIA+ NP
Sbjct  111  SRCNTCRKRVGLTGFNCKCGNLFCAVHRYSDKHDCPFDYKNAGRDAIAKANP  162



>dbj|BAJ94586.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99722.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=160

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K   NRC  CR+KVGLTGF+CRCG  FC  HRY+D H+CS+DYK AGR+ IA++NP
Sbjct  93   PPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSMHRYADSHECSFDYKKAGREQIAKQNP  150



>gb|ACG26325.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
 gb|ACG28071.1| zinc finger A20 and AN1 domains-containing protein [Zea mays]
Length=171

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P AK   +RC+ CR++VGLTGF CRCG ++C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  103  PKAKEGPDRCAACRKRVGLTGFSCRCGNMYCSVHRYSDKHDCQFDYRTAARDAIAKANP  161



>gb|AFW87479.1| zinc finger protein1 [Zea mays]
Length=193

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  132  NRCSACRKRVGLTGFNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANP  183



>ref|XP_009376157.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376158.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376159.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009376160.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379443.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379444.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379445.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
 ref|XP_009379446.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Pyrus x bretschneideri]
Length=169

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P   +  RC+ C ++VGLTGF CRCG LFC  HRYSD+HDCSYDY  AG+DAIA+ NP
Sbjct  102  PKPEDPKRCNTCNKRVGLTGFNCRCGHLFCAVHRYSDKHDCSYDYLTAGQDAIAKANP  159



>ref|NP_001130325.1| LOC100191419 [Zea mays]
 ref|XP_008680964.1| PREDICTED: LOC100191419 isoform X1 [Zea mays]
 ref|XP_008680965.1| PREDICTED: LOC100191419 isoform X1 [Zea mays]
 gb|ACF78509.1| unknown [Zea mays]
 gb|ACF81174.1| unknown [Zea mays]
 gb|ACN33638.1| unknown [Zea mays]
 gb|AFW70762.1| zinc finger A20 and AN1 domain-containing protein isoform 1 [Zea 
mays]
 gb|AFW70763.1| zinc finger A20 and AN1 domain-containing protein isoform 2 [Zea 
mays]
 gb|AFW70764.1| zinc finger A20 and AN1 domain-containing protein isoform 3 [Zea 
mays]
 gb|AFW70765.1| zinc finger A20 and AN1 domain-containing protein isoform 4 [Zea 
mays]
Length=171

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P AK   +RC+ CR++VGLTGF CRCG ++C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  103  PKAKEGPDRCAACRKRVGLTGFSCRCGNMYCSVHRYSDKHDCQFDYRTAARDAIAKANP  161



>ref|XP_010031824.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X2 [Eucalyptus grandis]
 ref|XP_010031825.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 isoform X2 [Eucalyptus grandis]
 gb|KCW51205.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51206.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51207.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51208.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
 gb|KCW51209.1| hypothetical protein EUGRSUZ_J00790 [Eucalyptus grandis]
Length=171

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             RCS C ++VGLTGF CRCG +FCG HRYSD+HDC +DY++AGR+AIA+ NP
Sbjct  110  TRCSSCNKRVGLTGFSCRCGNIFCGTHRYSDKHDCPFDYRSAGRNAIAKANP  161



>gb|ACT53874.1| zinc finger protein [Saccharum officinarum]
 gb|ADM33793.1| SAP1 [Saccharum officinarum]
Length=171

 Score = 89.0 bits (219),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  110  NRCSTCRKRVGLTGFNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANP  161



>ref|XP_010531421.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 6-like [Tarenaya hassleriana]
Length=161

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGF+CRCG  FC +HRYSD+H+C +DYK+AG+DAIA+ NP
Sbjct  100  NRCSLCRKRVGLTGFKCRCGHTFCSQHRYSDKHNCVFDYKSAGQDAIAKANP  151



>ref|XP_007028887.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
 ref|XP_007028888.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
 ref|XP_007028889.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
 gb|EOY09389.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
 gb|EOY09390.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
 gb|EOY09391.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 1 [Theobroma cacao]
Length=172

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRC+ CR++VGLTGF CRCG LFC  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  111  NRCTTCRKRVGLTGFNCRCGNLFCAAHRYSDKHDCPFDYRTAARDAIAKANP  162



>ref|XP_007028890.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 4 [Theobroma cacao]
 gb|EOY09392.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
8 isoform 4 [Theobroma cacao]
Length=182

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRC+ CR++VGLTGF CRCG LFC  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  121  NRCTTCRKRVGLTGFNCRCGNLFCAAHRYSDKHDCPFDYRTAARDAIAKANP  172



>ref|XP_002283050.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
 ref|XP_010653814.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
 ref|XP_010653815.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Vitis vinifera]
 emb|CAN65596.1| hypothetical protein VITISV_027161 [Vitis vinifera]
Length=172

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRC+ CR++VGLTGF C+CG LFC  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  111  NRCTACRKRVGLTGFNCKCGNLFCAVHRYSDKHDCPFDYRTAARDAIAKANP  162



>emb|CDS16890.1| zinc finger A20 and AN1 domain containing protein [Echinococcus 
granulosus]
Length=191

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            A+R VNRC  C+++VGLTGF+CRC  LFC  HRYSD+HDC++DY+  G+D IAR+NP
Sbjct  125  AQRTVNRCQKCKKRVGLTGFQCRCEGLFCALHRYSDQHDCTFDYRKQGQDQIARDNP  181



>emb|CDJ04631.1| zinc finger A20 and AN1 domain containing protein [Echinococcus 
multilocularis]
 emb|CDS41913.1| zinc finger A20 and AN1 domain containing protein [Echinococcus 
multilocularis]
Length=191

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            A+R VNRC  C+++VGLTGF+CRC  LFC  HRYSD+HDC++DY+  G+D IAR+NP
Sbjct  125  AQRTVNRCQKCKKRVGLTGFQCRCEGLFCALHRYSDQHDCTFDYRKQGQDQIARDNP  181



>ref|XP_002466323.1| hypothetical protein SORBIDRAFT_01g005640 [Sorghum bicolor]
 gb|EER93321.1| hypothetical protein SORBIDRAFT_01g005640 [Sorghum bicolor]
Length=180

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K+  NRCS CR+KVGL GFRC CGE FCG HRY+++H C YDYK+AGR+ IA+ NP
Sbjct  113  PVKQTANRCSACRKKVGLLGFRCCCGETFCGAHRYAEKHACGYDYKSAGRERIAKNNP  170



>ref|XP_011037831.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
 ref|XP_011037832.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Populus euphratica]
Length=172

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRC+ C+++VGLTGF+CRCG LFC  HRYSD+HDC +DY++A R+AIA+ NP
Sbjct  111  NRCTSCKKRVGLTGFKCRCGSLFCASHRYSDKHDCPFDYRSAAREAIAKANP  162



>emb|CAN60517.1| hypothetical protein VITISV_026578 [Vitis vinifera]
Length=560

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +1

Query  52   RSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN  231
            R+   +REVN CS C+RK+GL GFR RCG +FC  HRYSDRH+C +DYKAAGR  IA+EN
Sbjct  56   RNKDMRREVNWCSKCKRKLGLIGFRYRCGXMFCSNHRYSDRHECRFDYKAAGRAMIAKEN  115

Query  232  P  234
            P
Sbjct  116  P  116



>emb|CBI16408.3| unnamed protein product [Vitis vinifera]
Length=132

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS C+++VGLTGF CRCG LFC  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  71   NRCSTCKKRVGLTGFNCRCGHLFCATHRYSDKHDCPFDYRTAARDAIAKANP  122



>dbj|BAO74169.1| zinc finger protein [Cucurbita pepo subsp. pepo]
Length=173

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
             K   NRC+ CR++VGLTGF CRCG LFC  HRYSD+HDC +DY+A GR+AI++ NP
Sbjct  107  VKESPNRCNSCRKRVGLTGFNCRCGSLFCAVHRYSDKHDCPFDYQAIGREAISKANP  163



>ref|XP_006354259.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum tuberosum]
Length=170

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   +RCS C++KVGLTGF+CRCG  +CG HRYSD+HDC +DY++A R+AIA+ NP
Sbjct  104  AKEGPSRCSTCKKKVGLTGFKCRCGNFYCGSHRYSDKHDCQFDYRSAARNAIAKANP  160



>ref|XP_009783306.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 4-like [Nicotiana sylvestris]
Length=168

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   NRC+ CR++VGLTGF CRCG LFC  HRYSD+HDC YDY  A +DAIA+ NP
Sbjct  102  AKVGPNRCNTCRKRVGLTGFNCRCGHLFCSAHRYSDKHDCPYDYHKAAQDAIAKANP  158



>ref|XP_002297783.1| zinc finger family protein [Populus trichocarpa]
 gb|ABK92782.1| unknown [Populus trichocarpa]
 gb|EEE82588.1| zinc finger family protein [Populus trichocarpa]
Length=172

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRC+ C+++VGLTGF+CRCG LFC  HRYSD+HDC +DY++A R+AIA+ NP
Sbjct  111  NRCTSCKKRVGLTGFKCRCGSLFCASHRYSDKHDCPFDYRSAAREAIAKANP  162



>ref|XP_004513638.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X2 [Cicer arietinum]
Length=160

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  49   NRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARE  228
            N     K   +RC+ CR++VGLTGF C+CG LFC  HRYSD+HDC +DY++ GRDAIA+ 
Sbjct  89   NLETKVKTGPSRCAACRKRVGLTGFTCKCGNLFCAMHRYSDKHDCPFDYQSVGRDAIAKS  148

Query  229  NP  234
            NP
Sbjct  149  NP  150



>gb|KEH16279.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=169

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  49   NRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARE  228
            N     K   +RC+ CR++VGLTGF C+CG LFC  HRYSD+HDC +DY++ GRDAIA+ 
Sbjct  98   NLETKVKTGPSRCATCRKRVGLTGFTCKCGNLFCAMHRYSDKHDCPFDYQSVGRDAIAKS  157

Query  229  NP  234
            NP
Sbjct  158  NP  159



>ref|XP_006657485.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X1 [Oryza brachyantha]
 ref|XP_006657486.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like isoform X2 [Oryza brachyantha]
Length=160

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P K   NRC  CR+KVGLTGF+CRCG  FC  HRY++ H+C++DYK AGRD IA++NP
Sbjct  93   PPKPPSNRCLSCRKKVGLTGFQCRCGGTFCSTHRYTEAHNCTFDYKKAGRDQIAKQNP  150



>ref|XP_004513637.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like isoform X1 [Cicer arietinum]
Length=166

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  49   NRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARE  228
            N     K   +RC+ CR++VGLTGF C+CG LFC  HRYSD+HDC +DY++ GRDAIA+ 
Sbjct  95   NLETKVKTGPSRCAACRKRVGLTGFTCKCGNLFCAMHRYSDKHDCPFDYQSVGRDAIAKS  154

Query  229  NP  234
            NP
Sbjct  155  NP  156



>dbj|BAK03526.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  61   PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            PA+  VNRCS CR++VGLTGFRCRCG++FCGEHRYSDRH CSYDYKAA RDAIAR+NP
Sbjct  96   PARTSVNRCSSCRKRVGLTGFRCRCGDVFCGEHRYSDRHGCSYDYKAAARDAIARDNP  153



>gb|EUB63028.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 
[Echinococcus granulosus]
Length=218

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            A+R VNRC  C+++VGLTGF+CRC  LFC  HRYSD+HDC++DY+  G+D IAR+NP
Sbjct  152  AQRTVNRCQKCKKRVGLTGFQCRCEGLFCALHRYSDQHDCTFDYRKQGQDQIARDNP  208



>ref|XP_002116218.1| hypothetical protein TRIADDRAFT_50857 [Trichoplax adhaerens]
 gb|EDV21251.1| hypothetical protein TRIADDRAFT_50857 [Trichoplax adhaerens]
Length=183

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +P    + NRC  CR+KVGLTGF C CG +FC  HRYSD+HDC++DYKAAGR AI++ NP
Sbjct  114  TPTKSIKRNRCFTCRKKVGLTGFVCHCGNVFCSTHRYSDKHDCTFDYKAAGRAAISKNNP  173



>ref|XP_011025579.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 9-like [Populus euphratica]
Length=156

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRC+ CR+KVGLTGF+CRCG  FC +HRYSD+H+C +DY++AG+DAIA+ NP
Sbjct  95   NRCNFCRKKVGLTGFKCRCGHTFCSQHRYSDKHNCVFDYRSAGQDAIAKANP  146



>gb|KEH16280.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago 
truncatula]
Length=177

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +1

Query  49   NRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARE  228
            N     K   +RC+ CR++VGLTGF C+CG LFC  HRYSD+HDC +DY++ GRDAIA+ 
Sbjct  106  NLETKVKTGPSRCATCRKRVGLTGFTCKCGNLFCAMHRYSDKHDCPFDYQSVGRDAIAKS  165

Query  229  NP  234
            NP
Sbjct  166  NP  167



>ref|XP_010233975.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Brachypodium distachyon]
 ref|XP_003571070.2| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8 [Brachypodium distachyon]
Length=171

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +1

Query  58   PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            P  K   NRCS CR++VGLTGF CRCG ++C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  103  PKRKEGPNRCSTCRKRVGLTGFNCRCGNMYCSMHRYSDKHDCQFDYRTAARDAIAKANP  161



>ref|XP_008795703.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795704.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795705.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
 ref|XP_008795706.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Phoenix dactylifera]
Length=171

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +1

Query  79   NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            NRCS CR++VGLTGF CRCG LFC  HRYS+ H+C +DY+ AGRDAIA+ NP
Sbjct  110  NRCSTCRKRVGLTGFNCRCGNLFCATHRYSEEHNCPFDYRTAGRDAIAKANP  161



>ref|XP_006656245.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Oryza brachyantha]
Length=171

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +1

Query  55   SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            +P  K   +RCS CR++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct  102  NPKGKEGPSRCSTCRKRVGLTGFNCRCGNLYCALHRYSDKHDCQFDYRTAARDAIAKANP  161



>ref|XP_004250869.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated 
protein 8-like [Solanum lycopersicum]
 gb|ACM68439.1| stress-associated protein 2 [Solanum lycopersicum]
Length=170

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   +RCS C++KVGLTGF+CRCG  +CG HRYSD+HDC +DY++A R+AIA+ NP
Sbjct  104  AKEGPSRCSTCKKKVGLTGFKCRCGNFYCGSHRYSDKHDCQFDYRSAARNAIAKANP  160



>gb|ACM68452.1| stress-associated protein 2 [Solanum pennellii]
Length=170

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP  234
            AK   +RCS C++KVGLTGF+CRCG  +CG HRYSD+HDC +DY++A R+AIA+ NP
Sbjct  104  AKEGPSRCSTCKKKVGLTGFKCRCGNFYCGSHRYSDKHDCQFDYRSAARNAIAKANP  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370