BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN040N07

Length=606
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACN40426.1|  unknown                                                 322   5e-107   Picea sitchensis
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     321   1e-106   
emb|CBI29424.3|  unnamed protein product                                320   1e-106   Vitis vinifera
gb|AAN33000.1|  alpha-tubulin 4                                         320   2e-106   Gossypium hirsutum [American cotton]
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          323   4e-106   
gb|ABE66388.1|  alpha-tubulin                                           315   6e-106   Striga asiatica [witchweed]
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    323   6e-106   Brassica rapa
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    323   8e-106   
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     323   9e-106   
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     323   1e-105   
emb|CBI19330.3|  unnamed protein product                                322   1e-105   Vitis vinifera
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   321   1e-105   Citrus sinensis [apfelsine]
gb|ACU18775.1|  unknown                                                 314   1e-105   Glycine max [soybeans]
emb|CBI25125.3|  unnamed protein product                                320   1e-105   Vitis vinifera
emb|CDY25017.1|  BnaC02g39910D                                          321   2e-105   Brassica napus [oilseed rape]
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        323   2e-105   Tarenaya hassleriana [spider flower]
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        323   2e-105   Brassica rapa
emb|CBI22190.3|  unnamed protein product                                320   2e-105   Vitis vinifera
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    322   2e-105   
tpg|DAA51110.1|  TPA: alpha-tubulin                                     315   2e-105   
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             322   3e-105   Populus trichocarpa [western balsam poplar]
gb|ABK92552.1|  unknown                                                 322   3e-105   Populus trichocarpa [western balsam poplar]
emb|CDY66630.1|  BnaCnng51680D                                          322   3e-105   Brassica napus [oilseed rape]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   322   3e-105   Populus euphratica
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          322   4e-105   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                322   4e-105   Pyrus x bretschneideri [bai li]
gb|AHJ80818.1|  Tua1                                                    316   4e-105   Eragrostis tef [tef]
gb|AGG37287.1|  alpha-tubulin 5                                         322   4e-105   Salix arbutifolia
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             322   4e-105   Citrus clementina [clementine]
ref|XP_002510010.1|  tubulin alpha chain, putative                      322   4e-105   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           322   4e-105   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         322   4e-105   Pseudotsuga menziesii var. menziesii
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                322   4e-105   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                322   4e-105   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     322   4e-105   Carthamus tinctorius
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             322   4e-105   Eutrema salsugineum [saltwater cress]
ref|XP_002522104.1|  tubulin alpha chain, putative                      322   4e-105   Ricinus communis
gb|AGG37285.1|  alpha-tubulin 3                                         322   4e-105   Salix arbutifolia
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         322   4e-105   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           322   4e-105   Betula pendula [white birch]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              322   4e-105   Theobroma cacao [chocolate]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   322   5e-105   Fragaria vesca subsp. vesca
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             322   5e-105   Prunus persica
gb|EYU34086.1|  hypothetical protein MIMGU_mgv1a0196711mg               313   5e-105   Erythranthe guttata [common monkey flower]
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     321   5e-105   
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             322   5e-105   Capsella rubella
ref|XP_007042689.1|  Tubulin alpha-2 chain                              322   5e-105   Theobroma cacao [chocolate]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     322   5e-105   Eucalyptus grandis [rose gum]
ref|WP_039310890.1|  hypothetical protein                               322   5e-105   
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                322   5e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_849388.1|  tubulin alpha-6 chain                                 321   5e-105   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          322   5e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171974.1|  tubulin alpha-4 chain                                 321   5e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        321   6e-105   
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                321   6e-105   Elaeis guineensis
gb|KHG18997.1|  Tubulin alpha chain                                     321   6e-105   Gossypium arboreum [tree cotton]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    321   6e-105   Brassica rapa
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    321   7e-105   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             321   7e-105   Citrus clementina [clementine]
gb|AGG37283.1|  alpha-tubulin 1                                         321   7e-105   Salix arbutifolia
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     321   7e-105   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     321   7e-105   Pyrus x bretschneideri [bai li]
gb|ABO47736.1|  alpha-tubulin                                           321   7e-105   Gossypium hirsutum [American cotton]
gb|ABQ59634.1|  alpha-tubulin 5                                         321   7e-105   Populus tremuloides
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     321   8e-105   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                321   8e-105   Cucumis sativus [cucumbers]
dbj|BAP59012.1|  alpha tubulin                                          321   8e-105   Taxus cuspidata [ichii]
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              321   1e-104   Camelina sativa [gold-of-pleasure]
gb|KJB58757.1|  hypothetical protein B456_009G224800                    319   1e-104   Gossypium raimondii
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                321   1e-104   Populus euphratica
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          320   1e-104   
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         320   1e-104   Jatropha curcas
gb|ABO47740.1|  alpha-tubulin                                           320   1e-104   Gossypium hirsutum [American cotton]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   320   2e-104   Vitis vinifera
ref|XP_010093625.1|  Tubulin alpha chain                                320   2e-104   Morus notabilis
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                319   2e-104   Erythranthe guttata [common monkey flower]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              322   2e-104   
gb|AIX10966.1|  tubulin                                                 320   2e-104   Ornithogalum longebracteatum [sea-onion]
gb|AAO73546.1|  alpha-tubulin                                           320   2e-104   Ceratopteris richardii
emb|CAD13176.1|  alpha-tubulin                                          320   2e-104   Nicotiana tabacum [American tobacco]
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        320   2e-104   Glycine max [soybeans]
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              320   2e-104   
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     320   2e-104   Nicotiana sylvestris
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     320   2e-104   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              320   2e-104   Nicotiana tomentosiformis
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    320   2e-104   
gb|ABO47739.1|  alpha-tubulin                                           320   2e-104   Gossypium hirsutum [American cotton]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             320   2e-104   Selaginella moellendorffii
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    320   2e-104   
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                320   2e-104   Nelumbo nucifera [Indian lotus]
gb|AAO23139.1|  alpha tubulin                                           320   2e-104   Populus tremuloides
ref|XP_001764722.1|  predicted protein                                  320   2e-104   
ref|XP_010104543.1|  Tubulin alpha chain                                320   3e-104   
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    320   3e-104   Gossypium hirsutum [American cotton]
gb|ABK92520.1|  unknown                                                 320   3e-104   Populus trichocarpa [western balsam poplar]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              320   3e-104   Populus euphratica
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     320   3e-104   Sesamum indicum [beniseed]
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        320   3e-104   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     320   3e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABO47737.1|  alpha-tubulin                                           320   3e-104   Gossypium hirsutum [American cotton]
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    320   3e-104   Arabis alpina [alpine rockcress]
gb|ABQ59633.1|  alpha-tubulin 3                                         320   3e-104   Populus tremuloides
gb|ABB02631.1|  unknown                                                 320   3e-104   Solanum tuberosum [potatoes]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    320   3e-104   Gossypium hirsutum [American cotton]
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    320   3e-104   
gb|KHG20487.1|  Tubulin alpha chain                                     320   3e-104   Gossypium arboreum [tree cotton]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     320   3e-104   Nelumbo nucifera [Indian lotus]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    320   3e-104   Gossypium raimondii
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 320   3e-104   Populus trichocarpa [western balsam poplar]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              320   3e-104   Cucumis sativus [cucumbers]
dbj|BAC24800.1|  alpha tubulin                                          320   3e-104   Physcomitrella patens
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        320   3e-104   Camelina sativa [gold-of-pleasure]
gb|AAX21196.1|  putative alpha-tubulin                                  311   3e-104   Solanum betaceum [tamarillo]
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    319   3e-104   Tarenaya hassleriana [spider flower]
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     319   3e-104   Nicotiana tomentosiformis
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                319   3e-104   Prunus dulcis [sweet almond]
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              319   3e-104   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              319   3e-104   Camelina sativa [gold-of-pleasure]
ref|NP_193232.1|  tubulin alpha-6 chain                                 319   3e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             319   3e-104   Populus trichocarpa [western balsam poplar]
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              319   3e-104   Solanum lycopersicum
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              319   3e-104   Oryza brachyantha
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   319   3e-104   Brassica rapa
gb|ADW66593.1|  alpha tubulin                                           316   4e-104   Hirschfeldia incana [buchanweed]
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                319   4e-104   Solanum tuberosum [potatoes]
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             319   4e-104   Hordeum vulgare [barley]
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             319   4e-104   Prunus persica
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   319   4e-104   Nicotiana tomentosiformis
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                319   4e-104   Phoenix dactylifera
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         319   4e-104   Jatropha curcas
ref|XP_010096739.1|  Tubulin alpha chain                                319   4e-104   
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        318   4e-104   
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    318   4e-104   
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     319   4e-104   Phoenix dactylifera
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             319   5e-104   Selaginella moellendorffii
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     319   5e-104   Vitis vinifera
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             319   5e-104   Selaginella moellendorffii
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     319   6e-104   
gb|ACN40181.1|  unknown                                                 319   6e-104   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     319   6e-104   Vitis vinifera
gb|KHN01709.1|  Tubulin alpha chain                                     319   6e-104   Glycine soja [wild soybean]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              318   7e-104   Fragaria vesca subsp. vesca
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    318   7e-104   Glycine max [soybeans]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                318   7e-104   Fragaria vesca subsp. vesca
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    318   7e-104   
emb|CAB66336.1|  alpha-tubulin                                          318   7e-104   Betula pendula [white birch]
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                318   7e-104   Daucus carota [carrots]
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                318   8e-104   Elaeis guineensis
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             318   8e-104   Prunus persica
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              318   8e-104   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   318   9e-104   Malus domestica [apple tree]
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    318   9e-104   
gb|AFV46219.1|  hypothetical protein                                    318   1e-103   Scutellaria baicalensis [Baikal skullcap]
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          318   1e-103   Malus domestica [apple tree]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                318   1e-103   Vitis vinifera
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     318   1e-103   Glycine max [soybeans]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                318   1e-103   Elaeis guineensis
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    318   1e-103   Glycine max [soybeans]
gb|ACU19580.1|  unknown                                                 318   1e-103   Glycine max [soybeans]
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                318   1e-103   Cicer arietinum [garbanzo]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                318   1e-103   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              318   1e-103   Medicago truncatula
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        318   2e-103   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP02221.1|  unnamed protein product                                318   2e-103   Coffea canephora [robusta coffee]
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               318   2e-103   Pisum sativum [garden pea]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             317   2e-103   Phaseolus vulgaris [French bean]
gb|AHZ58482.1|  alpha-tubulin                                           311   2e-103   Syntrichia caninervis
ref|XP_003608582.1|  Tubulin alpha-5 chain                              317   2e-103   Medicago truncatula
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          318   2e-103   
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     317   2e-103   
gb|ACH68563.1|  alpha-tubulin                                           317   3e-103   Solanum tuberosum [potatoes]
gb|AGE09583.1|  TUA1-like protein                                       316   3e-103   Eucalyptus cladocalyx
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             317   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             317   3e-103   
ref|NP_001067613.1|  Os11g0247300                                       317   3e-103   
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                317   3e-103   Phoenix dactylifera
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   317   3e-103   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          317   3e-103   Citrus sinensis [apfelsine]
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        317   3e-103   Cucumis melo [Oriental melon]
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          317   3e-103   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   317   3e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     317   3e-103   
gb|KEH43997.1|  tubulin beta-1 chain                                    317   4e-103   Medicago truncatula
dbj|BAB19779.1|  alpha tubulin                                          317   4e-103   Nicotiana tabacum [American tobacco]
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             317   4e-103   Selaginella moellendorffii
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    317   4e-103   Gossypium hirsutum [American cotton]
ref|NP_001291325.1|  tubulin alpha chain-like                           317   4e-103   Sesamum indicum [beniseed]
ref|NP_001289660.1|  tubulin alpha chain-like                           317   4e-103   Eucalyptus grandis [rose gum]
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          317   4e-103   
gb|ABP65320.1|  alpha tubulin                                           317   4e-103   Capsicum annuum
gb|KIY93466.1|  Tubulin alpha-1 chain                                   307   6e-103   Monoraphidium neglectum
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             316   6e-103   
emb|CDY29334.1|  BnaA05g16010D                                          315   6e-103   Brassica napus [oilseed rape]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             316   6e-103   Phaseolus vulgaris [French bean]
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                316   6e-103   Eucalyptus grandis [rose gum]
ref|XP_002517492.1|  tubulin alpha chain, putative                      316   6e-103   Ricinus communis
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             316   6e-103   Phaseolus vulgaris [French bean]
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    316   7e-103   Glycine max [soybeans]
dbj|BAJ06362.1|  alpha-tubulin                                          316   7e-103   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   316   7e-103   Brachypodium distachyon [annual false brome]
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              316   7e-103   Setaria italica
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             316   7e-103   Selaginella moellendorffii
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              316   7e-103   Nicotiana tomentosiformis
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             316   7e-103   Hordeum vulgare [barley]
gb|ABD92930.1|  alpha tubulin-2A                                        316   7e-103   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              316   8e-103   Nicotiana sylvestris
gb|AIX10773.1|  alpha tubulin                                           315   1e-102   Panax notoginseng [san-qi]
gb|AHJ80817.1|  Tua1                                                    315   1e-102   Eragrostis tef [tef]
gb|AHJ80815.1|  Tua1                                                    315   1e-102   Eragrostis tef [tef]
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                315   1e-102   Cucumis sativus [cucumbers]
gb|AHJ80822.1|  Tua1                                                    315   1e-102   Eragrostis tef [tef]
ref|XP_005851144.1|  alpha-tubulin                                      315   1e-102   Chlorella variabilis
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              315   1e-102   Glycine max [soybeans]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     315   1e-102   Sesamum indicum [beniseed]
ref|NP_001167663.1|  tubulin alpha-3 chain                              315   1e-102   Zea mays [maize]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    315   1e-102   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          315   1e-102   Miscanthus sinensis
emb|CAA06619.1|  alpha-tubulin 1                                        315   1e-102   Eleusine indica [crabgrass]
dbj|BAJ98211.1|  predicted protein                                      315   1e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              315   1e-102   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   315   1e-102   Zea mays [maize]
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        315   1e-102   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             315   1e-102   Prunus persica
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             315   1e-102   Phaseolus vulgaris [French bean]
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              315   1e-102   Oryza brachyantha
gb|AHJ80816.1|  Tua1                                                    315   1e-102   Eragrostis tef [tef]
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    315   2e-102   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                315   2e-102   Triticum aestivum [Canadian hard winter wheat]
gb|ABV55999.1|  alpha-tubulin 7                                         315   2e-102   Populus tremuloides
ref|XP_002508010.1|  alpha tubulin 2                                    315   2e-102   Micromonas commoda
ref|XP_005651460.1|  tubulin alpha chain                                315   2e-102   Coccomyxa subellipsoidea C-169
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    314   2e-102   Citrus sinensis [apfelsine]
gb|AGG37289.1|  alpha-tubulin 7                                         315   2e-102   Salix arbutifolia
emb|CAA62917.1|  alfa-tubulin                                           315   2e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005643073.1|  tubulin alpha chain                                315   3e-102   Coccomyxa subellipsoidea C-169
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     314   3e-102   Populus euphratica
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             314   3e-102   Selaginella moellendorffii
gb|KHN42598.1|  Tubulin alpha-2 chain                                   314   3e-102   Glycine soja [wild soybean]
gb|ABG78593.1|  alpha-tubulin                                           314   4e-102   Oryza sativa Japonica Group [Japonica rice]
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             314   4e-102   Anemia phyllitidis
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  314   4e-102   Brassica napus [oilseed rape]
gb|ABO47742.1|  alpha-tubulin                                           314   5e-102   Gossypium hirsutum [American cotton]
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed              313   5e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              314   5e-102   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              314   6e-102   Selaginella moellendorffii
ref|NP_001051132.1|  Os03g0726100                                       313   6e-102   
gb|ACY05960.1|  alpha-tubulin                                           311   6e-102   Haematococcus lacustris
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             313   6e-102   Selaginella moellendorffii
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                313   7e-102   Nelumbo nucifera [Indian lotus]
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              313   8e-102   Oryza brachyantha
ref|XP_001777081.1|  predicted protein                                  313   8e-102   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             313   8e-102   Citrus clementina [clementine]
ref|XP_001782790.1|  predicted protein                                  313   9e-102   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   313   1e-101   Nelumbo nucifera [Indian lotus]
gb|AIA82437.1|  alpha-tubulin-like protein 06                           310   1e-101   Stentor coeruleus
gb|AAB84298.1|  tubulin                                                 313   1e-101   Oryza sativa Indica Group [Indian rice]
gb|AIA82433.1|  alpha-tubulin-like protein 01                           313   1e-101   Stentor coeruleus
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                313   1e-101   Nicotiana tomentosiformis
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                313   1e-101   Tetrahymena pyriformis
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                313   1e-101   Solanum lycopersicum
ref|XP_001022424.1|  Tubulin/FtsZ family, GTPase domain containin...    312   2e-101   Tetrahymena thermophila SB210
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             312   2e-101   Selaginella moellendorffii
emb|CDO97305.1|  unnamed protein product                                312   2e-101   Coffea canephora [robusta coffee]
ref|XP_003058621.1|  alpha tubulin                                      312   2e-101   Micromonas pusilla CCMP1545
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             312   2e-101   Selaginella moellendorffii
ref|XP_004034900.1|  hypothetical protein IMG5_110300                   312   3e-101   Ichthyophthirius multifiliis
gb|AAX63396.1|  alpha-tubulin                                           311   3e-101   Haematococcus lacustris
ref|XP_004231960.1|  PREDICTED: tubulin alpha-3 chain-like              311   4e-101   Solanum lycopersicum
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   311   6e-101   Monoraphidium neglectum
gb|AAB86649.1|  alpha-tubulin                                           311   6e-101   Chloromonas sp. ANT1
ref|XP_006357741.1|  PREDICTED: tubulin alpha-3 chain-like              311   7e-101   Solanum tuberosum [potatoes]
gb|KIZ03400.1|  Tubulin alpha chain                                     311   7e-101   Monoraphidium neglectum
gb|AHJ80823.1|  Tua1                                                    311   8e-101   Eragrostis tef [tef]
gb|AAB08791.1|  alpha tubulin                                           311   9e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGV54441.1|  tubulin alpha-2 chain-like protein                      310   1e-100   Phaseolus vulgaris [French bean]
emb|CAA62916.1|  alpha-tubulin                                          310   1e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001770881.1|  predicted protein                                  310   1e-100   
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                310   1e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010099392.1|  Tubulin alpha chain                                310   1e-100   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           310   2e-100   
gb|AEW46684.1|  beta-tubulin                                            310   2e-100   
ref|XP_002951007.1|  alpha tubulin                                      310   2e-100   
sp|P09205.1|TBA2_CHLRE  RecName: Full=Tubulin alpha-2 chain             310   2e-100   
gb|ACK76232.1|  alpha-tubulin                                           310   2e-100   
ref|XP_001691876.1|  alpha tubulin 1                                    310   2e-100   
ref|XP_001454509.1|  hypothetical protein                               309   2e-100   
emb|CAA67848.1|  alpha-tubulin                                          309   3e-100   
emb|CAI38956.1|  alpha_tubulin,putative                                 309   3e-100   
ref|XP_001460309.1|  hypothetical protein                               308   3e-100   
emb|CDW82295.1|  alpha tubulin                                          309   3e-100   
gb|ACH70610.1|  alpha tubulin                                           309   3e-100   
dbj|BAJ97454.1|  predicted protein                                      306   4e-100   
ref|XP_002766433.1|  tubulin alpha chain, putative                      299   4e-100   
ref|XP_002781275.1|  Tubulin alpha chain, putative                      301   4e-100   
gb|EJY81124.1|  Alpha tubulin,putative                                  308   5e-100   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   308   6e-100   
emb|CDP00974.1|  unnamed protein product                                308   7e-100   
ref|XP_002785264.1|  Tubulin alpha chain, putative                      300   7e-100   
ref|XP_002767974.1|  Tubulin alpha chain, putative                      302   7e-100   
emb|CBI16534.3|  unnamed protein product                                306   1e-99    
ref|XP_001455356.1|  hypothetical protein                               308   1e-99    
ref|XP_002779347.1|  Tubulin alpha chain, putative                      304   1e-99    
gb|ETL46656.1|  tubulin alpha chain                                     299   1e-99    
gb|ETL46639.1|  tubulin alpha chain                                     299   1e-99    
dbj|BAJ06364.1|  alpha-tubulin                                          307   2e-99    
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              307   2e-99    
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     307   2e-99    
gb|ETK93224.1|  tubulin alpha-2 chain                                   298   2e-99    
gb|ETK93242.1|  tubulin alpha chain                                     298   2e-99    
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        306   2e-99    
gb|AEF79970.1|  alpha-tubulin protein                                   307   2e-99    
gb|AAW30623.1|  unknown                                                 298   2e-99    
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                307   2e-99    
gb|ABC59068.2|  alpha tubulin 1                                         307   2e-99    
ref|XP_008294350.1|  PREDICTED: tubulin alpha chain                     298   2e-99    
ref|XP_008606530.1|  tubulin alpha                                      302   3e-99    
emb|CDP12358.1|  unnamed protein product                                307   3e-99    
gb|KJB83376.1|  hypothetical protein B456_013G244600                    300   3e-99    
gb|ABD92937.1|  alpha tubulin-4A                                        306   4e-99    
gb|ABD92936.1|  alpha tubulin-4D                                        306   4e-99    
ref|XP_004599399.1|  PREDICTED: tubulin alpha-1B chain                  299   4e-99    
gb|AAB86648.1|  alpha-tubulin                                           306   4e-99    
ref|XP_005932717.1|  PREDICTED: tubulin alpha-1B chain-like             299   4e-99    
dbj|BAE01779.1|  unnamed protein product                                299   5e-99    
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   306   5e-99    
ref|XP_004778983.1|  PREDICTED: tubulin alpha-1C chain                  299   5e-99    
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              306   6e-99    
gb|AAW30622.1|  unknown                                                 297   6e-99    
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like             299   7e-99    
sp|P07304.2|TBA1_STYLE  RecName: Full=Tubulin alpha-1 chain             306   7e-99    
ref|XP_007426287.1|  PREDICTED: tubulin alpha-1C chain                  299   7e-99    
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like             301   7e-99    
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   306   7e-99    
gb|AIA82436.1|  alpha-tubulin-like protein 04                           306   7e-99    
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                306   8e-99    
gb|KJB83377.1|  hypothetical protein B456_013G244600                    302   8e-99    
ref|XP_006895063.1|  PREDICTED: tubulin alpha-1B chain-like             298   8e-99    
gb|AFC88824.1|  putative tubulin alpha-3 chain                          305   8e-99    
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   305   9e-99    
ref|XP_002466376.1|  hypothetical protein SORBIDRAFT_01g006650          305   9e-99    
gb|EDL87015.1|  rCG50513, isoform CRA_a                                 301   1e-98    
gb|AAG49533.3|  alpha tubulin                                           299   1e-98    
ref|XP_673091.1|  hypothetical protein                                  298   1e-98    
ref|XP_008172101.1|  PREDICTED: tubulin alpha-1B chain                  299   1e-98    
ref|NP_001105440.1|  tubulin alpha-3 chain                              305   1e-98    
ref|XP_002904194.1|  alpha-tubulin                                      305   1e-98    
ref|XP_008317242.1|  PREDICTED: tubulin alpha-1C chain-like             300   1e-98    
ref|XP_005801995.1|  PREDICTED: tubulin alpha-1A chain-like             298   1e-98    
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             305   2e-98    
ref|XP_006264719.1|  PREDICTED: tubulin alpha-1A chain                  301   2e-98    
gb|AIJ27191.1|  alpha-tubulin 1a                                        298   2e-98    
gb|KGL81705.1|  Tubulin alpha-1C chain                                  297   2e-98    
emb|CAJ26346.1|  alpha-tubulin                                          295   2e-98    
gb|ETL99793.1|  tubulin alpha chain                                     301   2e-98    
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              305   2e-98    
ref|XP_674476.1|  hypothetical protein                                  296   2e-98    
ref|XP_010995722.1|  PREDICTED: tubulin alpha-1B chain                  301   2e-98    
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              305   2e-98    
ref|NP_197478.1|  tubulin alpha-3                                       305   2e-98    
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        304   2e-98    
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   304   2e-98    
ref|XP_002777471.1|  Tubulin alpha chain, putative                      303   3e-98    
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             304   3e-98    
ref|XP_006109205.1|  PREDICTED: tubulin alpha-1D chain-like             296   3e-98    
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              304   3e-98    
ref|XP_006056311.1|  PREDICTED: tubulin alpha-1B chain-like             296   3e-98    
gb|AIK29207.1|  putative alpha-tubulin                                  298   3e-98    
emb|CDY44941.1|  BnaA02g04460D                                          304   3e-98    
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              304   3e-98    
emb|CDY42294.1|  BnaC02g09000D                                          304   3e-98    
gb|AII97815.1|  BLTX443                                                 298   3e-98    
gb|AAT09064.1|  alpha tubulin 2                                         304   3e-98    
ref|XP_739480.1|  hypothetical protein                                  294   3e-98    
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             304   4e-98    
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              304   4e-98    
emb|CDX88875.1|  BnaA03g07740D                                          304   4e-98    
ref|XP_005406777.1|  PREDICTED: tubulin alpha-1A chain-like             298   4e-98    
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              304   4e-98    
ref|XP_002786953.1|  Tubulin alpha chain, putative                      304   4e-98    
ref|XP_006433709.1|  hypothetical protein CICLE_v100015521mg            293   4e-98    
ref|XP_002783368.1|  alpha tubulin, putative                            293   5e-98    
gb|AEF59080.1|  alpha tubulin-like protein                              298   5e-98    
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   303   5e-98    
gb|ACN40824.1|  unknown                                                 303   5e-98    
ref|XP_008575749.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    298   5e-98    
gb|AAT09063.1|  alpha tubulin 1                                         303   6e-98    
ref|XP_003979092.1|  PREDICTED: tubulin alpha-1B chain-like             296   6e-98    
gb|EDL87016.1|  rCG50513, isoform CRA_b                                 299   7e-98    
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  303   8e-98    
ref|XP_008240534.1|  PREDICTED: tubulin alpha-3 chain isoform X2        302   8e-98    
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   303   1e-97    
ref|XP_001419217.1|  predicted protein                                  303   1e-97    
ref|XP_005139691.1|  PREDICTED: tubulin alpha-1B chain-like             301   1e-97    
gb|AFX62864.1|  alpha tubulin 84B                                       301   1e-97    
emb|CCC46467.1|  putative alpha tubulin, fragment                       296   1e-97    
ref|XP_004874971.1|  PREDICTED: tubulin alpha-3 chain-like              297   1e-97    
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                302   1e-97    
emb|CAB77671.1|  alpha-tubulin                                          302   1e-97    
gb|EKF30131.1|  epsilon tubulin, putative                               294   2e-97    
gb|AEG74028.1|  alpha-tubulin                                           302   2e-97    
ref|XP_010535935.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    302   2e-97    
ref|XP_007248487.1|  PREDICTED: tubulin alpha-1B chain-like             300   2e-97    
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              302   2e-97    
ref|XP_008412910.1|  PREDICTED: tubulin alpha-1B chain-like             300   2e-97    
gb|EKF98903.1|  epsilon tubulin, putative                               295   2e-97    
ref|XP_008475351.1|  PREDICTED: tubulin alpha-1 chain-like              297   2e-97    
ref|XP_002675196.1|  alpha-tubulin                                      302   2e-97    
gb|EHB00536.1|  Tubulin alpha-1C chain                                  301   2e-97    
ref|XP_010751704.1|  PREDICTED: tubulin alpha chain                     298   2e-97    
ref|XP_006916969.1|  PREDICTED: tubulin alpha-1B chain                  301   2e-97    
ref|NP_001060075.1|  Os07g0574800                                       302   2e-97    
gb|ABO33166.1|  alpha tubulin a2                                        295   2e-97    
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   301   2e-97    
gb|KJB80786.1|  hypothetical protein B456_013G115100                    301   2e-97    
ref|XP_005452428.1|  PREDICTED: tubulin alpha-1A chain-like             296   2e-97    
ref|XP_002532068.1|  tubulin alpha chain, putative                      301   3e-97    
ref|XP_004817225.1|  PREDICTED: tubulin alpha-3 chain-like              299   3e-97    
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             301   3e-97    
ref|XP_007179355.1|  PREDICTED: tubulin alpha-1B chain                  301   3e-97    
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   301   3e-97    
gb|ETM30643.1|  tubulin alpha chain                                     301   3e-97    
gb|ETO82054.1|  tubulin alpha chain                                     301   3e-97    
ref|XP_007634877.1|  PREDICTED: tubulin alpha-1A chain isoform X3       296   3e-97    
gb|AAW57312.1|  alpha-tubulin                                           297   3e-97    
emb|CCI41153.1|  unnamed protein product                                301   4e-97    
ref|XP_008900864.1|  tubulin alpha chain                                301   4e-97    
emb|CBH08957.1|  alpha tubulin, (fragment)                              291   4e-97    
emb|CAL80740.1|  alpha-tubulin                                          301   4e-97    
ref|XP_002904195.1|  alpha-tubulin, putative                            301   4e-97    
ref|XP_007198449.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    301   4e-97    
gb|ETM52951.1|  tubulin alpha chain                                     301   4e-97    
ref|XP_008872990.1|  tubulin alpha chain                                301   4e-97    
ref|XP_003770912.1|  PREDICTED: tubulin alpha-1C chain                  297   4e-97    
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   301   4e-97    
ref|XP_008702766.1|  PREDICTED: tubulin alpha-1B chain-like             300   5e-97    
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              301   5e-97    
ref|XP_002599490.1|  hypothetical protein BRAFLDRAFT_81006              297   5e-97    
gb|ABS57456.1|  alpha-tubulin                                           293   5e-97    
ref|XP_009842456.1|  tubulin alpha chain                                301   5e-97    
gb|KJB83375.1|  hypothetical protein B456_013G244600                    301   5e-97    
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    301   5e-97    
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             301   5e-97    
ref|XP_010852034.1|  PREDICTED: tubulin alpha-1C chain                  301   5e-97    
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              301   5e-97    
ref|XP_003629736.1|  Alpha-tubulin                                      301   5e-97    
gb|ACU24494.1|  unknown                                                 291   6e-97    
gb|ESL08706.1|  alpha tubulin                                           296   6e-97    
pdb|3DU7|A  Chain A, Tubulin-Colchicine-Phomopsin A: Stathmin-Lik...    301   6e-97    
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              301   6e-97    
dbj|BAM28754.1|  tubulin                                                298   6e-97    
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              301   6e-97    
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          301   7e-97    
emb|CAE52514.1|  alpha tubulin                                          301   7e-97    
ref|XP_006752422.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    300   7e-97    
ref|XP_005680058.1|  PREDICTED: tubulin alpha-1C chain                  300   7e-97    
ref|XP_006675832.1|  tubulin, alpha, ubiquitous                         300   8e-97    
ref|XP_007936041.1|  PREDICTED: tubulin alpha-1A chain isoform X2       301   8e-97    
ref|XP_006779408.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    297   8e-97    
ref|XP_010803242.1|  PREDICTED: tubulin alpha-1C chain isoform X1       300   8e-97    
ref|NP_001029376.1|  tubulin alpha-1C chain                             300   8e-97    
ref|XP_001790595.1|  PREDICTED: tubulin alpha-1C chain-like isofo...    300   8e-97    
emb|CDQ72000.1|  unnamed protein product                                300   8e-97    
emb|CCC46464.1|  putative alpha tubulin                                 296   8e-97    
pdb|4DRX|A  Chain A, Gtp-Tubulin In Complex With A Darpin               300   8e-97    
ref|XP_002714140.1|  PREDICTED: tubulin alpha-1B chain-like             300   8e-97    
tpg|DAA32343.1|  TPA: tubulin alpha-1C chain-like                       300   9e-97    
ref|XP_004863093.1|  PREDICTED: tubulin alpha-1B chain-like             300   9e-97    
ref|XP_005986293.1|  PREDICTED: tubulin alpha-1A chain-like isofo...    301   9e-97    
emb|CBN77373.1|  alpha tubulin                                          300   9e-97    
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   300   9e-97    
ref|XP_007107561.1|  PREDICTED: tubulin alpha-1C chain isoform X1       300   9e-97    
sp|Q40832.1|TBA2_PELFA  RecName: Full=Tubulin alpha-2 chain             300   9e-97    
gb|EKG00415.1|  epsilon tubulin, putative                               298   9e-97    
ref|XP_006054596.1|  PREDICTED: tubulin alpha-1B chain                  300   1e-96    
gb|AFX62862.1|  alpha tubulin 84B                                       299   1e-96    
ref|XP_005532035.1|  PREDICTED: tubulin alpha-1C chain isoform X2       300   1e-96    
gb|ABU93324.1|  tubulin alpha subunit                                   300   1e-96    
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             300   1e-96    
emb|CAD26886.1|  alpha-tubulin                                          300   1e-96    
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        300   1e-96    
ref|NP_001029267.1|  tubulin alpha-1B chain                             300   1e-96    
ref|XP_004400918.1|  PREDICTED: tubulin alpha-1B chain-like             300   1e-96    
gb|AFX62804.1|  alpha tubulin 84B                                       299   1e-96    
gb|AFX62797.1|  alpha tubulin 84B                                       299   1e-96    
ref|XP_006035257.1|  PREDICTED: tubulin alpha-1B chain                  300   1e-96    
gb|AFX62784.1|  alpha tubulin 84B                                       299   1e-96    
ref|NP_001275086.1|  uncharacterized LOC102577521                       300   1e-96    
gb|ELR55924.1|  hypothetical protein M91_03110                          298   1e-96    
gb|AFX62786.1|  alpha tubulin 84B                                       299   1e-96    
ref|XP_008069065.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    300   1e-96    
dbj|BAF82043.1|  unnamed protein product                                300   1e-96    
ref|XP_004400917.1|  PREDICTED: tubulin alpha-1B chain-like             300   1e-96    
ref|XP_004429038.1|  PREDICTED: tubulin alpha-1B chain                  300   1e-96    
gb|ETN59126.1|  tubulin alpha chain                                     297   1e-96    
ref|XP_004447014.1|  PREDICTED: tubulin alpha-1C chain                  300   1e-96    
ref|XP_003355423.1|  PREDICTED: tubulin alpha-1C chain isoformX1        300   1e-96    
ref|XP_001504231.1|  PREDICTED: tubulin alpha-1C chain isoform 1        300   1e-96    
ref|XP_004880762.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    300   1e-96    
ref|XP_006131233.1|  PREDICTED: tubulin alpha-1C chain                  300   1e-96    
gb|AFX62861.1|  alpha tubulin 84B                                       299   1e-96    



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   322 bits (825),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   321 bits (823),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   320 bits (820),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   323 bits (829),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABE66388.1| alpha-tubulin [Striga asiatica]
Length=206

 Score =   315 bits (807),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   323 bits (828),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   323 bits (827),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   323 bits (828),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ACU18775.1| unknown [Glycine max]
Length=202

 Score =   314 bits (805),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSV YGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVGYGKKSKLGFTV  171



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>tpg|DAA51110.1| TPA: alpha-tubulin, partial [Zea mays]
 tpg|DAA51116.1| TPA: alpha-tubulin, partial [Zea mays]
Length=240

 Score =   315 bits (806),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   322 bits (824),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   316 bits (810),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   322 bits (824),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   322 bits (824),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|EYU34086.1| hypothetical protein MIMGU_mgv1a0196711mg, partial [Erythranthe 
guttata]
Length=199

 Score =   313 bits (801),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   321 bits (822),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   322 bits (824),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   322 bits (824),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   322 bits (824),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   322 bits (824),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/173 (98%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = +3

Query  87   AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  266
            +KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA
Sbjct  3    SKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  62

Query  267  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  446
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC
Sbjct  63   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  122

Query  447  LDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            LDRIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  123  LDRIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  175



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   322 bits (824),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   321 bits (822),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   322 bits (824),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   321 bits (823),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   321 bits (822),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   321 bits (823),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   321 bits (823),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   321 bits (823),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFADLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   321 bits (822),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDICLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008372962.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=438

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGL SLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLASLLLERLSVDYGKKSKLGFTV  171



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +3

Query  75   NSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFS  254
             S+  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFS
Sbjct  45   QSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFS  104

Query  255  ETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEI  434
            ETG+GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEI
Sbjct  105  ETGSGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEI  164

Query  435  VDLCLDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            VDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  165  VDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  221



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPADKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRPGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGSGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010500556.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
Length=462

 Score =   320 bits (820),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            +VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   YVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   320 bits (820),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AAX21196.1| putative alpha-tubulin [Solanum betaceum]
Length=204

 Score =   311 bits (796),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006601463.1| PREDICTED: tubulin alpha-3 chain-like [Glycine max]
Length=432

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010461854.1| PREDICTED: tubulin alpha-6 chain-like [Camelina sativa]
Length=450

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ADW66593.1| alpha tubulin [Hirschfeldia incana]
Length=355

 Score =   316 bits (810),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/169 (99%), Positives = 169/169 (100%), Gaps = 0/169 (0%)
 Frame = +3

Query  99   ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  278
            ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV
Sbjct  1    ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  60

Query  279  PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI  458
            PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI
Sbjct  61   PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI  120

Query  459  RKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  169



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 170/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   319 bits (817),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   318 bits (814),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006606007.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=437

 Score =   318 bits (816),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   319 bits (818),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   319 bits (817),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   319 bits (817),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score =   319 bits (817),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006589612.1| PREDICTED: tubulin alpha chain-like isoform X2 [Glycine max]
Length=449

 Score =   319 bits (817),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   319 bits (817),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   319 bits (817),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   319 bits (817),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_003524707.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Glycine max]
 gb|KHN47565.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006573681.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Glycine max]
Length=424

 Score =   318 bits (814),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>sp|Q9FT36.1|TBA_DAUCA RecName: Full=Tubulin alpha chain [Daucus carota]
 gb|AAG02564.1| alpha-tubulin [Daucus carota]
Length=451

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQ+GNACWELYCLEHGIQP+GQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQIGNACWELYCLEHGIQPNGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   318 bits (816),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGT+RQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTFRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   318 bits (816),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   318 bits (816),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   318 bits (815),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006579968.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Glycine max]
Length=462

 Score =   318 bits (816),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AFV46219.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=440

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/173 (98%), Positives = 171/173 (99%), Gaps = 0/173 (0%)
 Frame = +3

Query  87   AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  266
            AKMRECISIHIG+AGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGA
Sbjct  36   AKMRECISIHIGRAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGA  95

Query  267  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  446
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC
Sbjct  96   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  155

Query  447  LDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            LDRIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  156  LDRIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  208



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFL FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLGFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDHTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AHZ58482.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=261

 Score =   311 bits (796),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDG+MPSD + GGGDDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDASTGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDVCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006472373.1| PREDICTED: tubulin alpha chain isoform X2 [Citrus sinensis]
Length=460

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008219157.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=442

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = +3

Query  96   RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  275
            RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKH
Sbjct  1    RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKH  60

Query  276  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  455
            VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR
Sbjct  61   VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  120

Query  456  IRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            IRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  IRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  170



>gb|AGE09583.1| TUA1-like protein [Eucalyptus cladocalyx]
 gb|KCW68570.1| hypothetical protein EUGRSUZ_F02183 [Eucalyptus grandis]
Length=420

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTV  171



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DK VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKIVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002989721.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
 ref|XP_002993678.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ05267.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ09198.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
Length=451

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTV  171



>ref|NP_001067613.1| Os11g0247300 [Oryza sativa Japonica Group]
 sp|Q53M52.1|TBA2_ORYSJ RecName: Full=Tubulin alpha-2 chain [Oryza sativa Japonica Group]
 gb|AAX96762.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|AAX96764.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92352.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA92353.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27976.1| Os11g0247300 [Oryza sativa Japonica Group]
 gb|EAY80511.1| hypothetical protein OsI_35689 [Oryza sativa Indica Group]
 gb|EAZ17981.1| hypothetical protein OsJ_33527 [Oryza sativa Japonica Group]
 dbj|BAG95614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH85357.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|ADM86870.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|AFI71279.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008352751.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=449

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_009357231.1| PREDICTED: tubulin alpha chain-like isoform X2 [Pyrus x bretschneideri]
Length=446

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLF PEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFRPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_002976230.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
 ref|XP_002987138.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ11714.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ22490.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
Length=451

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 171/171 (100%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAG+QVGNACWELYCLEHGIQPDGQMP+DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGVQVGNACWELYCLEHGIQPDGQMPTDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFL+FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAF TFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFYTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDQTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTV  171



>ref|XP_009388503.1| PREDICTED: tubulin alpha chain isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=465

 Score =   317 bits (812),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 169/171 (99%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFL FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLDFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>gb|KIY93466.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=193

 Score =   307 bits (786),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR +F+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDL LD
Sbjct  61   HVPRCIFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLALD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDG MPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   315 bits (808),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLG  596
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLG
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLG  168



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGN+CWELYC+EHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCVEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTV  171



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007155784.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
 gb|ESW27778.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
Length=450

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002972670.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
 ref|XP_002988134.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ10926.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ25891.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
Length=450

 Score =   316 bits (809),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTI  171



>ref|XP_009618479.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana tomentosiformis]
Length=451

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_009779180.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana sylvestris]
Length=451

 Score =   316 bits (809),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLAD+CTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADSCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D T+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTLGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AHJ80822.1| Tua1 [Eragrostis tef]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR VFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>dbj|BAJ98211.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRE ISIH+GQAGIQ+GNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQAGIQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_008347837.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Malus domestica]
Length=459

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AHJ80816.1| Tua1 [Eragrostis tef]
Length=451

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006338461.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Solanum tuberosum]
Length=434

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFT+
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTV  171



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKE+AANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKENAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002508010.1| alpha tubulin 2 [Micromonas sp. RCC299]
 ref|XP_002506067.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO67325.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO69268.1| alpha tubulin 2 [Micromonas sp. RCC299]
Length=449

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRE ISIHIGQAGIQ GNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQTGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_005651460.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE26916.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006482577.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Citrus sinensis]
Length=425

 Score =   314 bits (804),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQM SDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMLSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>emb|CAA62917.1| alfa-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPT+IDEVRTG YRQLFHPEQ+ISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTMIDEVRTGDYRQLFHPEQVISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_005643073.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 sp|Q9ZRJ4.1|TBA_CHLVU RecName: Full=Tubulin alpha chain [Chlorella vulgaris]
 dbj|BAA03955.1| alpha-tubulin [Chlorella vulgaris]
 gb|EIE18529.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002962209.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
 ref|XP_002965123.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ33961.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ37469.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
Length=451

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTV  171



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   314 bits (805),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVNLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABG78593.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   314 bits (805),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQP+GQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPEGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHY+IGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYSIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNA WELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNARWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGG TGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGXTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|AAQ81585.1| putative tubulin alpha-2/alpha-4 chain [Brassica napus]
Length=450

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            M ECISIH+GQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MGECISIHMGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   314 bits (804),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ABF98643.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=433

 Score =   313 bits (802),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   314 bits (804),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGG DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGADAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPE LISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEHLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_002963092.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
 ref|XP_002980241.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ18501.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ36555.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
Length=451

 Score =   314 bits (804),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTV  171



>ref|NP_001051132.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|AAG16905.1|AF182523_1 alpha-tubulin [Oryza sativa]
 gb|AAS07163.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|AAT77077.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|ABF98642.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG78592.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF13046.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|EAY91719.1| hypothetical protein OsI_13361 [Oryza sativa Indica Group]
 gb|EAZ28437.1| hypothetical protein OsJ_12419 [Oryza sativa Japonica Group]
 gb|AFI71265.1| alpha tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   313 bits (803),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 166/171 (97%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>gb|ACY05960.1| alpha-tubulin, partial [Haematococcus pluvialis]
Length=386

 Score =   311 bits (798),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 163/171 (95%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRE ISIH+GQAG+QVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREAISIHLGQAGVQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRA+F+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDL LD
Sbjct  61   HVPRAIFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLALD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_002973792.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
 ref|XP_002983604.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ15505.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ24747.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
Length=451

 Score =   313 bits (803),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 164/171 (96%), Positives = 170/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI
Sbjct  121  RVRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTI  171



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 165/171 (96%), Positives = 169/171 (99%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGNYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   313 bits (803),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 167/171 (98%), Positives = 168/171 (98%), Gaps = 0/171 (0%)
 Frame = +3

Query  93   MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  272
            MRECISIHIGQ GIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQPGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  273  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  452
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  453  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTI  605
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTV  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800