BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN040M06

Length=655
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004230770.1|  PREDICTED: U-box domain-containing protein 2...    316   3e-103   Solanum lycopersicum
ref|XP_006346399.1|  PREDICTED: U-box domain-containing protein 2...    315   1e-102   Solanum tuberosum [potatoes]
ref|XP_010107920.1|  U-box domain-containing protein 26                 313   5e-102   Morus notabilis
ref|XP_011000686.1|  PREDICTED: U-box domain-containing protein 2...    313   1e-101   Populus euphratica
gb|ABK93469.1|  unknown                                                 311   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_002313124.2|  U-box domain-containing family protein             311   2e-101   Populus trichocarpa [western balsam poplar]
gb|KDP32265.1|  hypothetical protein JCGZ_14786                         311   3e-101   Jatropha curcas
ref|XP_011005992.1|  PREDICTED: U-box domain-containing protein 2...    306   2e-99    Populus euphratica
ref|XP_010270217.1|  PREDICTED: U-box domain-containing protein 2...    306   6e-99    Nelumbo nucifera [Indian lotus]
ref|XP_002306161.2|  hypothetical protein POPTR_0004s14720g             305   1e-98    Populus trichocarpa [western balsam poplar]
emb|CDO97189.1|  unnamed protein product                                305   1e-98    Coffea canephora [robusta coffee]
ref|XP_007042451.1|  Plant U-box 26                                     303   4e-98    
ref|XP_011088242.1|  PREDICTED: U-box domain-containing protein 2...    301   2e-97    Sesamum indicum [beniseed]
ref|XP_011092561.1|  PREDICTED: U-box domain-containing protein 2...    301   2e-97    Sesamum indicum [beniseed]
gb|EPS57772.1|  hypothetical protein M569_17045                         301   2e-97    Genlisea aurea
ref|XP_009627648.1|  PREDICTED: U-box domain-containing protein 2...    301   3e-97    Nicotiana tomentosiformis
gb|KJB79347.1|  hypothetical protein B456_013G045000                    300   1e-96    Gossypium raimondii
ref|XP_002285110.1|  PREDICTED: U-box domain-containing protein 26      298   5e-96    Vitis vinifera
ref|XP_004309747.1|  PREDICTED: U-box domain-containing protein 26      296   2e-95    Fragaria vesca subsp. vesca
ref|XP_010263503.1|  PREDICTED: U-box domain-containing protein 2...    296   3e-95    Nelumbo nucifera [Indian lotus]
emb|CAN74163.1|  hypothetical protein VITISV_026443                     298   3e-95    Vitis vinifera
ref|XP_009792112.1|  PREDICTED: U-box domain-containing protein 2...    292   8e-94    Nicotiana sylvestris
ref|XP_007153588.1|  hypothetical protein PHAVU_003G048200g             291   2e-93    Phaseolus vulgaris [French bean]
ref|XP_008456137.1|  PREDICTED: U-box domain-containing protein 2...    288   7e-92    Cucumis melo [Oriental melon]
ref|XP_004140703.1|  PREDICTED: U-box domain-containing protein 2...    285   8e-91    Cucumis sativus [cucumbers]
ref|XP_006422990.1|  hypothetical protein CICLE_v10028522mg             284   2e-90    Citrus clementina [clementine]
gb|KJB32363.1|  hypothetical protein B456_005G237200                    283   3e-90    Gossypium raimondii
ref|XP_009341339.1|  PREDICTED: U-box domain-containing protein 26      282   4e-90    
ref|XP_004505237.1|  PREDICTED: U-box domain-containing protein 2...    283   5e-90    Cicer arietinum [garbanzo]
ref|XP_007199948.1|  hypothetical protein PRUPE_ppa006352mg             282   7e-90    Prunus persica
ref|XP_008236490.1|  PREDICTED: U-box domain-containing protein 2...    283   9e-90    
ref|XP_008373128.1|  PREDICTED: U-box domain-containing protein 2...    282   1e-89    
ref|XP_006487052.1|  PREDICTED: U-box domain-containing protein 2...    282   1e-89    Citrus sinensis [apfelsine]
ref|XP_003529402.1|  PREDICTED: U-box domain-containing protein 2...    281   2e-89    
gb|AES90137.2|  plant U-box protein                                     280   3e-89    Medicago truncatula
ref|XP_006583889.1|  PREDICTED: U-box domain-containing protein 2...    280   1e-88    
gb|EPS67592.1|  hypothetical protein M569_07183                         279   2e-88    Genlisea aurea
ref|XP_003518699.1|  PREDICTED: U-box domain-containing protein 2...    276   1e-87    Glycine max [soybeans]
ref|XP_003607940.1|  U-box domain-containing protein                    277   2e-87    
ref|XP_010690605.1|  PREDICTED: U-box domain-containing protein 26      266   2e-83    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010538612.1|  PREDICTED: U-box domain-containing protein 2...    263   2e-82    Tarenaya hassleriana [spider flower]
ref|XP_002894216.1|  U-box domain-containing protein                    256   8e-80    Arabidopsis lyrata subsp. lyrata
ref|NP_175400.1|  U-box domain-containing protein 26                    256   1e-79    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42960.1|  unknown protein                                        254   7e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500528.1|  PREDICTED: U-box domain-containing protein 2...    252   5e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010461826.1|  PREDICTED: U-box domain-containing protein 26      250   2e-77    Camelina sativa [gold-of-pleasure]
ref|XP_006306175.1|  hypothetical protein CARUB_v10011740mg             250   2e-77    Capsella rubella
ref|XP_009145797.1|  PREDICTED: U-box domain-containing protein 25      249   5e-77    Brassica rapa
ref|XP_006393215.1|  hypothetical protein EUTSA_v10011515mg             249   8e-77    Eutrema salsugineum [saltwater cress]
emb|CDX99233.1|  BnaC05g33480D                                          245   3e-75    
ref|XP_006847114.1|  hypothetical protein AMTR_s00017p00223570          244   3e-75    Amborella trichopoda
emb|CDY16513.1|  BnaA08g02540D                                          244   6e-75    Brassica napus [oilseed rape]
ref|XP_002518745.1|  Spotted leaf protein, putative                     244   8e-75    
emb|CDY59286.1|  BnaCnng34640D                                          243   1e-74    Brassica napus [oilseed rape]
ref|XP_009107285.1|  PREDICTED: U-box domain-containing protein 26      244   1e-74    Brassica rapa
ref|XP_009111906.1|  PREDICTED: U-box domain-containing protein 2...    243   2e-74    Brassica rapa
gb|ABV89622.1|  U-box domain-containing protein                         243   2e-74    Brassica rapa
ref|XP_006299353.1|  hypothetical protein CARUB_v10015518mg             242   3e-74    Capsella rubella
emb|CDY50158.1|  BnaA01g26180D                                          241   4e-74    Brassica napus [oilseed rape]
emb|CDX92328.1|  BnaA05g20790D                                          241   8e-74    
gb|KFK35978.1|  hypothetical protein AALP_AA4G062500                    241   1e-73    Arabis alpina [alpine rockcress]
ref|XP_006406505.1|  hypothetical protein EUTSA_v10022190mg             240   2e-73    Eutrema salsugineum [saltwater cress]
emb|CDX95458.1|  BnaC01g33500D                                          240   2e-73    
ref|XP_010468287.1|  PREDICTED: U-box domain-containing protein 2...    239   5e-73    
dbj|BAF01749.1|  hypothetical protein                                   239   7e-73    Arabidopsis thaliana [mouse-ear cress]
ref|NP_566632.1|  U-box domain-containing protein 25                    238   8e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466083.1|  PREDICTED: U-box domain-containing protein 25      238   1e-72    
ref|XP_002885309.1|  hypothetical protein ARALYDRAFT_479456             237   2e-72    
ref|XP_010507691.1|  PREDICTED: U-box domain-containing protein 2...    236   6e-72    Camelina sativa [gold-of-pleasure]
gb|KFK39278.1|  hypothetical protein AALP_AA3G223600                    235   1e-71    Arabis alpina [alpine rockcress]
gb|EYU37659.1|  hypothetical protein MIMGU_mgv1a019070mg                201   2e-59    Erythranthe guttata [common monkey flower]
emb|CBI32390.3|  unnamed protein product                                189   4e-54    Vitis vinifera
ref|XP_009416906.1|  PREDICTED: U-box domain-containing protein 26      143   2e-36    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001778934.1|  predicted protein                                  130   1e-33    
gb|ABK24171.1|  unknown                                                 132   4e-33    Picea sitchensis
gb|ABK25582.1|  unknown                                                 133   6e-33    Picea sitchensis
ref|XP_008784183.1|  PREDICTED: U-box domain-containing protein 2...    132   1e-32    Phoenix dactylifera
ref|XP_004952703.1|  PREDICTED: U-box domain-containing protein 2...    130   8e-32    Setaria italica
dbj|BAJ97989.1|  predicted protein                                      128   3e-31    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010481065.1|  PREDICTED: U-box domain-containing protein 2...    127   6e-31    Camelina sativa [gold-of-pleasure]
gb|EMS66308.1|  U-box domain-containing protein 25                      127   1e-30    Triticum urartu
gb|EMT28323.1|  U-box domain-containing protein 25                      126   1e-30    
ref|XP_001752821.1|  predicted protein                                  124   4e-29    
ref|XP_009403520.1|  PREDICTED: U-box domain-containing protein 2...    122   5e-29    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001762017.1|  predicted protein                                  118   4e-27    
ref|XP_009406118.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    115   2e-26    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002974135.1|  ubiquitin-protein ligase, PUB26                    114   2e-26    
ref|XP_003575105.1|  PREDICTED: U-box domain-containing protein 2...    114   3e-26    Brachypodium distachyon [annual false brome]
ref|XP_002968838.1|  ubiquitin-protein ligase, PUB26                    114   3e-26    
ref|XP_010489938.1|  PREDICTED: U-box domain-containing protein 2...    111   2e-25    Camelina sativa [gold-of-pleasure]
ref|XP_010912457.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    111   3e-25    
ref|XP_002453962.1|  hypothetical protein SORBIDRAFT_04g022280          110   1e-24    Sorghum bicolor [broomcorn]
ref|XP_002991371.1|  hypothetical protein SELMODRAFT_133552             108   3e-24    Selaginella moellendorffii
ref|XP_002988236.1|  hypothetical protein SELMODRAFT_44944              105   3e-23    
ref|XP_001776109.1|  predicted protein                                  102   6e-22    
ref|NP_001047085.2|  Os02g0548700                                       101   1e-21    
dbj|BAD16187.1|  putative immediate-early fungal elicitor protein...    101   1e-21    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751378.1|  predicted protein                                94.7    1e-20    
ref|XP_004501176.1|  PREDICTED: uncharacterized protein LOC101503409  97.4    1e-20    Cicer arietinum [garbanzo]
ref|XP_003636449.1|  U-box domain-containing protein                  96.7    2e-20    
gb|KEH36040.1|  hypothetical protein MTR_3g110138                     95.9    5e-20    Medicago truncatula
ref|NP_001148065.1|  ubiquitin-protein ligase                         95.5    1e-19    
ref|XP_003523734.1|  PREDICTED: U-box domain-containing protein 2...  94.4    2e-19    Glycine max [soybeans]
gb|AFW71736.1|  ubiquitin-protein ligase                              95.1    2e-19    
ref|XP_006476069.1|  PREDICTED: U-box domain-containing protein 2...  93.6    4e-19    Citrus sinensis [apfelsine]
ref|XP_002885649.1|  hypothetical protein ARALYDRAFT_899024           88.6    7e-19    
ref|XP_007137194.1|  hypothetical protein PHAVU_009G107700g           91.7    2e-18    Phaseolus vulgaris [French bean]
ref|XP_002976345.1|  hypothetical protein SELMODRAFT_416243           92.8    2e-18    Selaginella moellendorffii
gb|EYU29273.1|  hypothetical protein MIMGU_mgv1a021565mg              90.9    3e-18    Erythranthe guttata [common monkey flower]
ref|XP_002308611.2|  hypothetical protein POPTR_0006s25710g           89.7    9e-18    Populus trichocarpa [western balsam poplar]
ref|XP_006826592.1|  hypothetical protein AMTR_s00138p00053700        90.1    1e-17    Amborella trichopoda
ref|XP_008466051.1|  PREDICTED: U-box domain-containing protein 26    89.0    1e-17    Cucumis melo [Oriental melon]
ref|XP_003527831.1|  PREDICTED: uncharacterized protein LOC100814020  88.6    2e-17    Glycine max [soybeans]
ref|XP_002987240.1|  hypothetical protein SELMODRAFT_125560           89.7    2e-17    
ref|XP_002976407.1|  hypothetical protein SELMODRAFT_104879           89.4    2e-17    Selaginella moellendorffii
ref|XP_011019811.1|  PREDICTED: uncharacterized protein LOC105122418  89.7    3e-17    Populus euphratica
ref|XP_004136217.1|  PREDICTED: U-box domain-containing protein 2...  87.8    4e-17    Cucumis sativus [cucumbers]
ref|XP_001764309.1|  predicted protein                                88.6    5e-17    
ref|XP_002962287.1|  hypothetical protein SELMODRAFT_403954           89.4    7e-17    
gb|KDP34197.1|  hypothetical protein JCGZ_07768                       86.3    1e-16    Jatropha curcas
ref|XP_010668167.1|  PREDICTED: U-box domain-containing protein 26    86.3    2e-16    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002987189.1|  hypothetical protein SELMODRAFT_46743            82.0    6e-16    
ref|XP_011090755.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     84.0    8e-16    Sesamum indicum [beniseed]
ref|XP_003636401.1|  U-box domain-containing protein                  83.6    8e-16    
ref|XP_002281453.1|  PREDICTED: U-box domain-containing protein 25    84.0    9e-16    Vitis vinifera
ref|XP_006450657.1|  hypothetical protein CICLE_v10008902mg           82.4    3e-15    Citrus clementina [clementine]
emb|CDP16178.1|  unnamed protein product                              81.6    6e-15    Coffea canephora [robusta coffee]
ref|XP_002862799.1|  hypothetical protein ARALYDRAFT_920258           79.7    1e-14    
ref|XP_006340423.1|  PREDICTED: U-box domain-containing protein 2...  79.7    2e-14    
gb|KHN31155.1|  U-box domain-containing protein 26                    79.0    2e-14    Glycine soja [wild soybean]
gb|KDP34438.1|  hypothetical protein JCGZ_12798                       80.1    4e-14    Jatropha curcas
ref|XP_004251181.1|  PREDICTED: U-box domain-containing protein 26    79.0    5e-14    Solanum lycopersicum
ref|XP_001783217.1|  predicted protein                                79.3    6e-14    
ref|XP_009801169.1|  PREDICTED: uncharacterized protein LOC104246952  78.6    8e-14    Nicotiana sylvestris
ref|NP_196716.1|  uncharacterized protein                             77.8    9e-14    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009403145.1|  PREDICTED: U-box domain-containing protein 2...  79.3    1e-13    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010249635.1|  PREDICTED: U-box domain-containing protein 26    78.2    1e-13    Nelumbo nucifera [Indian lotus]
ref|XP_010456493.1|  PREDICTED: uncharacterized protein LOC104737947  77.0    1e-13    
ref|XP_003522485.1|  PREDICTED: U-box domain-containing protein 2...  78.6    1e-13    Glycine max [soybeans]
ref|XP_006847226.1|  hypothetical protein AMTR_s00017p00257160        78.6    1e-13    Amborella trichopoda
ref|XP_010028074.1|  PREDICTED: U-box domain-containing protein 30    78.6    2e-13    Eucalyptus grandis [rose gum]
ref|XP_006289615.1|  hypothetical protein CARUB_v10003173mg           77.0    2e-13    Capsella rubella
ref|XP_006410763.1|  hypothetical protein EUTSA_v10016730mg           78.2    2e-13    Eutrema salsugineum [saltwater cress]
ref|XP_006399662.1|  hypothetical protein EUTSA_v10014169mg           76.6    2e-13    Eutrema salsugineum [saltwater cress]
ref|XP_003517356.1|  PREDICTED: U-box domain-containing protein 3...  78.2    2e-13    Glycine max [soybeans]
ref|XP_010491888.1|  PREDICTED: uncharacterized protein LOC104769387  76.6    3e-13    Camelina sativa [gold-of-pleasure]
ref|XP_010453204.1|  PREDICTED: uncharacterized protein LOC104735168  76.3    3e-13    Camelina sativa [gold-of-pleasure]
ref|XP_007137800.1|  hypothetical protein PHAVU_009G156600g           77.4    4e-13    Phaseolus vulgaris [French bean]
ref|XP_009603741.1|  PREDICTED: uncharacterized protein LOC104098657  76.6    4e-13    Nicotiana tomentosiformis
ref|XP_010419728.1|  PREDICTED: uncharacterized protein LOC104705421  76.3    4e-13    Camelina sativa [gold-of-pleasure]
ref|XP_009141534.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  77.0    5e-13    Brassica rapa
ref|XP_002873519.1|  hypothetical protein ARALYDRAFT_487992           75.5    6e-13    
ref|XP_011022933.1|  PREDICTED: U-box domain-containing protein 2...  76.6    6e-13    Populus euphratica
ref|XP_009133058.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     76.6    6e-13    Brassica rapa
ref|XP_002965206.1|  hypothetical protein SELMODRAFT_439085           77.4    6e-13    
ref|XP_008680442.1|  PREDICTED: U-box domain-containing protein 2...  76.3    6e-13    
ref|XP_009367895.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  75.5    6e-13    Pyrus x bretschneideri [bai li]
emb|CDX84587.1|  BnaA03g16430D                                        76.6    6e-13    
emb|CDY32070.1|  BnaC04g44960D                                        76.6    7e-13    Brassica napus [oilseed rape]
ref|XP_006403803.1|  hypothetical protein EUTSA_v10010389mg           76.3    1e-12    Eutrema salsugineum [saltwater cress]
emb|CDX85708.1|  BnaA02g01050D                                        74.7    1e-12    
ref|XP_009125812.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  74.7    1e-12    Brassica rapa
emb|CDY68531.1|  BnaCnng59400D                                        74.3    1e-12    Brassica napus [oilseed rape]
ref|XP_006841078.1|  hypothetical protein AMTR_s00086p00031680        75.1    1e-12    
gb|KDO79762.1|  hypothetical protein CISIN_1g044095mg                 74.3    2e-12    Citrus sinensis [apfelsine]
ref|XP_006380377.1|  hypothetical protein POPTR_0007s04220g           75.1    2e-12    Populus trichocarpa [western balsam poplar]
ref|XP_009136678.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  75.1    2e-12    Brassica rapa
gb|KFK34491.1|  hypothetical protein AALP_AA5G152500                  75.1    3e-12    Arabis alpina [alpine rockcress]
ref|XP_010526330.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     75.1    3e-12    Tarenaya hassleriana [spider flower]
ref|XP_009419493.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  74.7    3e-12    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009125026.1|  PREDICTED: U-box domain-containing protein 4     73.9    3e-12    Brassica rapa
ref|XP_004511816.1|  PREDICTED: U-box domain-containing protein 3...  74.7    3e-12    Cicer arietinum [garbanzo]
ref|XP_008393879.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  73.6    3e-12    
ref|XP_006295808.1|  hypothetical protein CARUB_v10024934mg           74.3    3e-12    Capsella rubella
gb|KHN13011.1|  U-box domain-containing protein 30                    74.7    4e-12    Glycine soja [wild soybean]
emb|CDX91209.1|  BnaC02g03880D                                        73.2    4e-12    
ref|XP_003539260.2|  PREDICTED: U-box domain-containing protein 3...  74.7    4e-12    Glycine max [soybeans]
emb|CDY28679.1|  BnaCnng05650D                                        72.4    5e-12    Brassica napus [oilseed rape]
emb|CDY59599.1|  BnaCnng35300D                                        73.9    5e-12    Brassica napus [oilseed rape]
emb|CDX78096.1|  BnaA09g32910D                                        73.9    5e-12    
ref|XP_010509533.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.9    5e-12    Camelina sativa [gold-of-pleasure]
ref|XP_010505120.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     73.9    6e-12    Camelina sativa [gold-of-pleasure]
gb|KJB48752.1|  hypothetical protein B456_008G084500                  73.9    6e-12    Gossypium raimondii
ref|XP_010541260.1|  PREDICTED: formin-binding protein 4              72.8    6e-12    Tarenaya hassleriana [spider flower]
ref|XP_010516800.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  73.9    6e-12    Camelina sativa [gold-of-pleasure]
ref|XP_006382863.1|  hypothetical protein POPTR_0005s06470g           73.6    6e-12    Populus trichocarpa [western balsam poplar]
emb|CDX95337.1|  BnaC04g28210D                                        73.6    6e-12    
ref|XP_009115945.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     73.9    7e-12    Brassica rapa
ref|XP_009396054.1|  PREDICTED: U-box domain-containing protein 4...  73.9    7e-12    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003526867.1|  PREDICTED: U-box domain-containing protein 2...  73.6    7e-12    Glycine max [soybeans]
gb|KFK36486.1|  hypothetical protein AALP_AA4G130900                  73.6    7e-12    Arabis alpina [alpine rockcress]
ref|XP_002262704.2|  PREDICTED: U-box domain-containing protein 2...  73.6    8e-12    Vitis vinifera
emb|CAN66286.1|  hypothetical protein VITISV_011184                   73.2    8e-12    Vitis vinifera
gb|AES94509.2|  E3 ubiquitin ligase PUB14                             73.6    9e-12    Medicago truncatula
ref|XP_011078792.1|  PREDICTED: U-box domain-containing protein 2...  73.2    9e-12    Sesamum indicum [beniseed]
gb|AEW09062.1|  hypothetical protein CL3508Contig1_02                 69.3    1e-11    Pinus radiata
ref|XP_003611551.1|  U-box domain-containing protein                  73.6    1e-11    
gb|EPS58757.1|  hypothetical protein M569_16054                       72.0    1e-11    Genlisea aurea
ref|XP_010503987.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  71.2    1e-11    
emb|CDX84168.1|  BnaC04g09300D                                        72.8    1e-11    
ref|XP_010541793.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  72.8    1e-11    Tarenaya hassleriana [spider flower]
ref|XP_004498998.1|  PREDICTED: U-box domain-containing protein 4...  72.4    1e-11    Cicer arietinum [garbanzo]
ref|XP_011031181.1|  PREDICTED: U-box domain-containing protein 2...  72.0    1e-11    Populus euphratica
gb|AEW09063.1|  hypothetical protein CL3508Contig1_02                 68.9    2e-11    Pinus lambertiana
emb|CDX79645.1|  BnaC03g19810D                                        72.4    2e-11    
ref|XP_009139452.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  72.8    2e-11    Brassica rapa
ref|XP_002452587.1|  hypothetical protein SORBIDRAFT_04g028560        72.8    2e-11    Sorghum bicolor [broomcorn]
ref|XP_011031180.1|  PREDICTED: U-box domain-containing protein 2...  72.0    2e-11    Populus euphratica
ref|XP_002526642.1|  Spotted leaf protein, putative                   71.6    3e-11    Ricinus communis
gb|AFW73318.1|  immediate-early fungal elicitor protein CMPG1         72.0    3e-11    
ref|NP_181137.2|  E3 ubiquitin-protein ligase PUB23                   71.6    3e-11    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293176.1|  hypothetical protein CARUB_v10019493mg           71.6    3e-11    Capsella rubella
gb|AAD21464.1|  unknown protein                                       71.6    3e-11    Arabidopsis thaliana [mouse-ear cress]
gb|AFG69255.1|  hypothetical protein 0_14991_01                       66.6    3e-11    Pinus taeda
ref|XP_002524056.1|  Spotted leaf protein, putative                   71.6    3e-11    Ricinus communis
ref|XP_009343842.1|  PREDICTED: U-box domain-containing protein 1...  70.5    3e-11    Pyrus x bretschneideri [bai li]
ref|XP_002877862.1|  U-box domain-containing protein                  71.6    4e-11    
ref|XP_007047580.1|  ARM repeat superfamily protein isoform 2         70.5    4e-11    
ref|XP_010515711.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  71.2    4e-11    Camelina sativa [gold-of-pleasure]
ref|XP_010426860.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     71.2    4e-11    Camelina sativa [gold-of-pleasure]
ref|XP_010688093.1|  PREDICTED: U-box domain-containing protein 4...  70.9    4e-11    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_190813.1|  E3 ubiquitin-protein ligase PUB22                   71.2    5e-11    Arabidopsis thaliana [mouse-ear cress]
emb|CDY23218.1|  BnaA04g05410D                                        70.9    5e-11    Brassica napus [oilseed rape]
ref|XP_010273225.1|  PREDICTED: U-box domain-containing protein 30    70.9    6e-11    Nelumbo nucifera [Indian lotus]
gb|KHG16185.1|  U-box domain-containing 4 -like protein               70.5    6e-11    Gossypium arboreum [tree cotton]
gb|KDP44223.1|  hypothetical protein JCGZ_05690                       71.2    6e-11    Jatropha curcas
ref|XP_008784119.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  70.9    7e-11    
gb|ADI46216.1|  CMPG1a                                                70.5    7e-11    Solanum tuberosum [potatoes]
gb|ABK25393.1|  unknown                                               70.5    7e-11    Picea sitchensis
gb|KJB63943.1|  hypothetical protein B456_010G025700                  70.1    8e-11    Gossypium raimondii
ref|XP_007047579.1|  ARM repeat superfamily protein isoform 1         70.5    8e-11    Theobroma cacao [chocolate]
ref|XP_002267145.2|  PREDICTED: U-box domain-containing protein 30    70.5    9e-11    Vitis vinifera
ref|XP_007224929.1|  hypothetical protein PRUPE_ppa021688mg           68.9    9e-11    
ref|XP_003537115.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  70.1    1e-10    Glycine max [soybeans]
ref|XP_002320032.2|  hypothetical protein POPTR_0014s01670g           69.7    1e-10    Populus trichocarpa [western balsam poplar]
ref|XP_004292853.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     69.7    1e-10    Fragaria vesca subsp. vesca
gb|KHN48421.1|  E3 ubiquitin-protein ligase PUB23                     70.1    1e-10    Glycine soja [wild soybean]
ref|XP_010999871.1|  PREDICTED: U-box domain-containing protein 4...  69.7    1e-10    Populus euphratica
ref|XP_010278617.1|  PREDICTED: U-box domain-containing protein 2...  67.0    1e-10    Nelumbo nucifera [Indian lotus]
gb|KDP36106.1|  hypothetical protein JCGZ_08750                       70.1    1e-10    Jatropha curcas
ref|XP_006494889.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  69.7    1e-10    Citrus sinensis [apfelsine]
ref|XP_007160909.1|  hypothetical protein PHAVU_001G027300g           69.3    1e-10    Phaseolus vulgaris [French bean]
ref|XP_003589079.1|  U-box domain-containing protein                  69.3    1e-10    
ref|XP_009599897.1|  PREDICTED: U-box domain-containing protein 1...  70.5    1e-10    Nicotiana tomentosiformis
ref|XP_006424086.1|  hypothetical protein CICLE_v10028557mg           69.7    1e-10    Citrus clementina [clementine]
ref|XP_004251095.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  69.7    1e-10    Solanum lycopersicum
ref|XP_002881419.1|  hypothetical protein ARALYDRAFT_482563           69.7    1e-10    
gb|EEE65449.1|  hypothetical protein OsJ_20813                        69.3    1e-10    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008357382.1|  PREDICTED: U-box domain-containing protein 1...  68.9    1e-10    Malus domestica [apple tree]
ref|XP_008357389.1|  PREDICTED: U-box domain-containing protein 1...  68.9    1e-10    Malus domestica [apple tree]
gb|KDO46582.1|  hypothetical protein CISIN_1g040073mg                 69.7    1e-10    Citrus sinensis [apfelsine]
emb|CDX69749.1|  BnaA10g20980D                                        68.9    1e-10    
gb|AES59330.2|  armadillo/beta-catenin-like repeat protein            69.3    1e-10    Medicago truncatula
ref|XP_003564002.1|  PREDICTED: U-box domain-containing protein 21    69.7    2e-10    Brachypodium distachyon [annual false brome]
ref|XP_009395597.1|  PREDICTED: U-box domain-containing protein 4...  69.7    2e-10    
ref|NP_001057289.1|  Os06g0248500                                     69.7    2e-10    
ref|XP_008237598.1|  PREDICTED: U-box domain-containing protein 30    69.7    2e-10    Prunus mume [ume]
ref|XP_010279125.1|  PREDICTED: U-box domain-containing protein 2...  69.7    2e-10    Nelumbo nucifera [Indian lotus]
emb|CDP20283.1|  unnamed protein product                              69.7    2e-10    Coffea canephora [robusta coffee]
ref|XP_009803459.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  69.7    2e-10    Nicotiana sylvestris
gb|EAZ00358.1|  hypothetical protein OsI_22374                        69.7    2e-10    Oryza sativa Indica Group [Indian rice]
ref|XP_004294506.1|  PREDICTED: U-box domain-containing protein 13    70.1    2e-10    Fragaria vesca subsp. vesca
ref|XP_003518177.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  69.3    2e-10    Glycine max [soybeans]
emb|CDP04681.1|  unnamed protein product                              69.3    2e-10    Coffea canephora [robusta coffee]
ref|XP_002323382.1|  U-box domain-containing family protein           69.3    2e-10    Populus trichocarpa [western balsam poplar]
ref|XP_002298264.1|  hypothetical protein POPTR_0001s22370g           69.3    2e-10    Populus trichocarpa [western balsam poplar]
ref|XP_003524698.1|  PREDICTED: U-box domain-containing protein 3...  69.3    2e-10    
ref|XP_004502944.1|  PREDICTED: U-box domain-containing protein 2...  69.3    2e-10    Cicer arietinum [garbanzo]
ref|XP_009341425.1|  PREDICTED: U-box domain-containing protein 1...  68.2    2e-10    Pyrus x bretschneideri [bai li]
ref|XP_002974352.1|  hypothetical protein SELMODRAFT_414754           69.3    2e-10    
ref|XP_009121936.1|  PREDICTED: uncharacterized protein LOC103846711  68.9    2e-10    Brassica rapa
gb|KHN20357.1|  U-box domain-containing protein 30                    69.3    2e-10    Glycine soja [wild soybean]
ref|XP_002987239.1|  hypothetical protein SELMODRAFT_426053           69.3    2e-10    
ref|XP_007207456.1|  hypothetical protein PRUPE_ppa005655mg           68.9    2e-10    Prunus persica
ref|XP_002516555.1|  conserved hypothetical protein                   68.9    2e-10    
ref|XP_010271201.1|  PREDICTED: U-box domain-containing protein 2...  68.9    3e-10    Nelumbo nucifera [Indian lotus]
ref|XP_008357448.1|  PREDICTED: U-box domain-containing protein 1...  69.3    3e-10    
ref|XP_007152651.1|  hypothetical protein PHAVU_004G147500g           68.9    3e-10    Phaseolus vulgaris [French bean]
ref|XP_006432191.1|  hypothetical protein CICLE_v10001406mg           68.9    3e-10    
gb|KDO51673.1|  hypothetical protein CISIN_1g015728mg                 68.9    3e-10    
ref|XP_011042586.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22     68.9    3e-10    
ref|XP_002976406.1|  hypothetical protein SELMODRAFT_416356           68.9    3e-10    
gb|KEH30143.1|  armadillo/beta-catenin repeat protein                 69.3    3e-10    
ref|XP_006465012.1|  PREDICTED: U-box domain-containing protein 2...  68.9    3e-10    
ref|XP_006362850.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  68.9    3e-10    
gb|EYU30497.1|  hypothetical protein MIMGU_mgv1a007556mg              68.6    3e-10    
ref|XP_010106916.1|  U-box domain-containing protein 30               68.6    3e-10    
emb|CDP09042.1|  unnamed protein product                              69.3    3e-10    
ref|NP_001147860.1|  immediate-early fungal elicitor protein CMPG1    68.6    4e-10    
ref|XP_011094237.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  68.6    4e-10    
ref|XP_011089810.1|  PREDICTED: U-box domain-containing protein 13    68.9    4e-10    
ref|XP_010906325.1|  PREDICTED: U-box domain-containing protein 2...  68.6    4e-10    
ref|XP_007145787.1|  hypothetical protein PHAVU_007G267700g           68.6    4e-10    
gb|AFK46109.1|  unknown                                               68.2    4e-10    
gb|KGN57521.1|  hypothetical protein Csa_3G203520                     64.7    4e-10    
ref|XP_006466465.1|  PREDICTED: U-box domain-containing protein 3...  68.2    4e-10    
ref|XP_006426094.1|  hypothetical protein CICLE_v10025589mg           68.2    4e-10    
ref|XP_007204993.1|  hypothetical protein PRUPE_ppa003509mg           68.6    4e-10    
ref|XP_011021423.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  68.2    5e-10    
ref|XP_004238092.1|  PREDICTED: U-box domain-containing protein 4...  67.8    5e-10    
ref|XP_007018507.1|  ARM repeat superfamily protein                   67.8    5e-10    
ref|XP_006424806.1|  hypothetical protein CICLE_v10027966mg           68.6    5e-10    
gb|KDO78935.1|  hypothetical protein CISIN_1g041252mg                 68.2    5e-10    
ref|XP_002298363.1|  armadillo/beta-catenin repeat family protein     68.6    5e-10    
gb|ADI46214.1|  CMPG1b                                                68.2    5e-10    
ref|XP_002510072.1|  E3 ubiquitin ligase PUB14, putative              68.2    5e-10    
gb|EYU38686.1|  hypothetical protein MIMGU_mgv1a020011mg              68.2    5e-10    
ref|XP_002990839.1|  hypothetical protein SELMODRAFT_429186           68.2    6e-10    
ref|XP_007155812.1|  hypothetical protein PHAVU_003G233800g           68.2    6e-10    
ref|XP_010932523.1|  PREDICTED: U-box domain-containing protein 2...  68.2    6e-10    
ref|XP_004503116.1|  PREDICTED: U-box domain-containing protein 2...  67.8    6e-10    
ref|XP_004172231.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  67.8    6e-10    
ref|XP_011000261.1|  PREDICTED: U-box domain-containing protein 1...  68.2    6e-10    
gb|AGT17408.1|  hypothetical protein SHCRBa_230_N09_R_300             67.8    6e-10    
gb|KJB53072.1|  hypothetical protein B456_008G291900                  67.8    7e-10    
ref|XP_009593988.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  67.8    7e-10    
ref|XP_008385130.1|  PREDICTED: U-box domain-containing protein 1...  68.2    7e-10    
ref|XP_008223401.1|  PREDICTED: U-box domain-containing protein 13    68.2    7e-10    
ref|XP_002465578.1|  hypothetical protein SORBIDRAFT_01g041450        67.8    7e-10    
ref|XP_009592688.1|  PREDICTED: U-box domain-containing protein 2...  67.8    7e-10    
ref|XP_003550308.1|  PREDICTED: U-box domain-containing protein 4     67.4    8e-10    
ref|XP_006424807.1|  hypothetical protein CICLE_v10027966mg           67.8    8e-10    
ref|XP_010260460.1|  PREDICTED: U-box domain-containing protein 2...  67.4    8e-10    
ref|XP_010942967.1|  PREDICTED: U-box domain-containing protein 4...  68.2    8e-10    
ref|XP_001775881.1|  predicted protein                                67.4    9e-10    
gb|KJB55896.1|  hypothetical protein B456_009G100000                  67.4    9e-10    
gb|KJB58632.1|  hypothetical protein B456_009G219600                  67.0    1e-09    
gb|KHG00011.1|  U-box domain-containing 4 -like protein               67.0    1e-09    
ref|XP_010322360.1|  PREDICTED: U-box domain-containing protein 1...  67.4    1e-09    
ref|XP_010471108.1|  PREDICTED: U-box domain-containing protein 1...  67.4    1e-09    
emb|CDX74298.1|  BnaA03g27490D                                        66.6    1e-09    
ref|XP_003533316.1|  PREDICTED: U-box domain-containing protein 2...  67.0    1e-09    
ref|XP_009348934.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  67.0    1e-09    
ref|XP_009353692.1|  PREDICTED: U-box domain-containing protein 1...  67.4    1e-09    
ref|XP_006364055.1|  PREDICTED: U-box domain-containing protein 2...  67.0    1e-09    
gb|KJB55894.1|  hypothetical protein B456_009G100000                  67.0    1e-09    
ref|XP_010463527.1|  PREDICTED: U-box domain-containing protein 4...  66.6    1e-09    
emb|CAA16672.1|  predicted protein                                    67.4    1e-09    
ref|XP_004241233.1|  PREDICTED: U-box domain-containing protein 1...  67.4    1e-09    
ref|XP_008379758.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  66.6    1e-09    
ref|XP_004505870.1|  PREDICTED: U-box domain-containing protein 1...  67.0    1e-09    
gb|KHN43695.1|  E3 ubiquitin-protein ligase PUB22                     66.6    1e-09    
ref|XP_010485548.1|  PREDICTED: U-box domain-containing protein 4...  66.6    1e-09    
ref|XP_007016447.1|  U-box domain-containing protein 13 isoform 1     67.0    2e-09    
ref|XP_011042684.1|  PREDICTED: U-box domain-containing protein 1...  67.0    2e-09    
ref|XP_007016448.1|  Plant U-box 13 isoform 2                         67.0    2e-09    
ref|XP_009777581.1|  PREDICTED: U-box domain-containing protein 1...  67.0    2e-09    
gb|KHG14011.1|  U-box domain-containing 13 -like protein              67.0    2e-09    
ref|XP_010431524.1|  PREDICTED: U-box domain-containing protein 4...  66.2    2e-09    
ref|XP_009380658.1|  PREDICTED: protein spotted leaf 11-like          67.0    2e-09    
ref|XP_009395652.1|  PREDICTED: U-box domain-containing protein 3...  66.2    2e-09    
ref|XP_010685786.1|  PREDICTED: U-box domain-containing protein 13    66.6    2e-09    
ref|XP_006300236.1|  hypothetical protein CARUB_v10016476mg           65.9    2e-09    
ref|NP_566136.1|  armadillo/beta-catenin-like repeat-containing p...  65.9    2e-09    
ref|XP_006381941.1|  U-box domain-containing family protein           66.2    2e-09    
gb|AAM64910.1|  unknown                                               65.9    2e-09    
gb|KJB55893.1|  hypothetical protein B456_009G100000                  66.6    2e-09    
ref|XP_009395651.1|  PREDICTED: U-box domain-containing protein 3...  66.2    2e-09    
ref|XP_006387887.1|  hypothetical protein POPTR_0497s00200g           66.2    2e-09    
ref|XP_002534105.1|  Spotted leaf protein, putative                   66.6    2e-09    
ref|XP_006408499.1|  hypothetical protein EUTSA_v10021975mg           65.9    2e-09    
ref|XP_007215376.1|  hypothetical protein PRUPE_ppa005711mg           66.2    2e-09    
ref|XP_008444561.1|  PREDICTED: U-box domain-containing protein 4     65.9    2e-09    
gb|AAL16172.1|AF428404_1  AT3g01400/T13O15_4                          65.9    2e-09    
ref|XP_006857112.1|  hypothetical protein AMTR_s00065p00128940        66.2    2e-09    
ref|XP_010247286.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  65.9    2e-09    
ref|XP_009353694.1|  PREDICTED: U-box domain-containing protein 1...  66.6    2e-09    
ref|XP_010463781.1|  PREDICTED: U-box domain-containing protein 31    66.2    2e-09    
ref|XP_009410070.1|  PREDICTED: U-box domain-containing protein 2...  65.9    2e-09    
ref|XP_008230336.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  65.9    3e-09    
ref|XP_002510099.1|  E3 ubiquitin ligase PUB14, putative              65.5    3e-09    
ref|XP_004145841.1|  PREDICTED: U-box domain-containing protein 2...  65.9    3e-09    
ref|XP_009379827.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  65.9    3e-09    
ref|XP_006656843.1|  PREDICTED: U-box domain-containing protein 2...  64.7    3e-09    
ref|XP_007227457.1|  hypothetical protein PRUPE_ppa007890mg           65.5    3e-09    
ref|XP_009337706.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  65.9    3e-09    
ref|XP_009368334.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  65.9    3e-09    
gb|KHN43656.1|  U-box domain-containing protein 20                    65.9    3e-09    
ref|XP_008220387.1|  PREDICTED: U-box domain-containing protein 3...  65.9    3e-09    
ref|XP_008350837.1|  PREDICTED: U-box domain-containing protein 2...  65.9    3e-09    
gb|KHN34082.1|  U-box domain-containing protein 25                    65.5    3e-09    
ref|XP_009781197.1|  PREDICTED: U-box domain-containing protein 2...  65.9    3e-09    
ref|XP_002991626.1|  hypothetical protein SELMODRAFT_133879           65.5    3e-09    
ref|XP_006350763.1|  PREDICTED: U-box domain-containing protein 1...  65.9    3e-09    
ref|XP_007207682.1|  hypothetical protein PRUPE_ppa023672mg           65.5    3e-09    
ref|XP_010106453.1|  U-box domain-containing protein 13               65.9    3e-09    
ref|XP_002301150.2|  hypothetical protein POPTR_0002s11960g           65.5    3e-09    
ref|XP_010911942.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  65.5    3e-09    
gb|AAP03884.1|  Avr9/Cf-9 rapidly elicited protein 74                 65.5    4e-09    
ref|XP_008460887.1|  PREDICTED: U-box domain-containing protein 2...  65.5    4e-09    
gb|AAM61258.1|  unknown                                               65.5    4e-09    
ref|XP_002510071.1|  E3 ubiquitin ligase PUB14, putative              65.5    4e-09    
ref|XP_007132072.1|  hypothetical protein PHAVU_011G064700g           65.9    4e-09    
ref|XP_011046430.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  65.5    4e-09    
ref|XP_008220327.1|  PREDICTED: U-box domain-containing protein 4     65.1    4e-09    
ref|XP_010925800.1|  PREDICTED: U-box domain-containing protein 2...  65.5    4e-09    
ref|XP_008793948.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  65.1    4e-09    
ref|XP_008365622.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  65.1    4e-09    
ref|XP_010090837.1|  U-box domain-containing protein 25               65.1    4e-09    
ref|XP_008812599.1|  PREDICTED: U-box domain-containing protein 2...  65.5    4e-09    
ref|XP_004513351.1|  PREDICTED: U-box domain-containing protein 2...  65.5    4e-09    
gb|KEH35601.1|  E3 ubiquitin ligase PUB14                             64.7    4e-09    
ref|XP_006350762.1|  PREDICTED: U-box domain-containing protein 1...  65.5    4e-09    
ref|XP_009375140.1|  PREDICTED: U-box domain-containing protein 3...  65.1    4e-09    
ref|XP_002283992.1|  PREDICTED: U-box domain-containing protein 13    65.5    4e-09    
ref|XP_006607012.1|  PREDICTED: U-box domain-containing protein 4...  64.3    5e-09    
ref|NP_001234240.1|  Avr9/Cf-9 rapidly elicited protein               65.1    5e-09    
ref|XP_009382986.1|  PREDICTED: U-box domain-containing protein 2...  65.1    5e-09    
ref|XP_007204425.1|  hypothetical protein PRUPE_ppa1027169mg          65.1    5e-09    
emb|CDP01660.1|  unnamed protein product                              65.1    5e-09    
ref|XP_010444614.1|  PREDICTED: U-box domain-containing protein 3...  65.1    5e-09    
ref|XP_010936614.1|  PREDICTED: U-box domain-containing protein 4     65.1    5e-09    
ref|XP_011017118.1|  PREDICTED: U-box domain-containing protein 4...  64.7    6e-09    
ref|XP_010091242.1|  U-box domain-containing protein 4                64.7    6e-09    
ref|XP_004236923.1|  PREDICTED: U-box domain-containing protein 2...  65.1    6e-09    
ref|XP_010547560.1|  PREDICTED: U-box domain-containing protein 30    65.1    6e-09    
emb|CDP10593.1|  unnamed protein product                              64.7    6e-09    
ref|XP_002990179.1|  ubiquitin-protein ligase, PUB2                   65.5    6e-09    
ref|XP_002527537.1|  Spotted leaf protein, putative                   64.7    6e-09    
gb|EMS67443.1|  E3 ubiquitin-protein ligase PUB22                     64.7    6e-09    
ref|XP_002992508.1|  ubiquitin-protein ligase, PUB2                   65.1    6e-09    
ref|XP_009415651.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  64.7    7e-09    
ref|XP_010936891.1|  PREDICTED: U-box domain-containing protein 2...  64.7    7e-09    
ref|XP_009354088.1|  PREDICTED: U-box domain-containing protein 4...  64.3    7e-09    
ref|XP_003537996.1|  PREDICTED: U-box domain-containing protein 1...  65.1    7e-09    
ref|XP_008391980.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  64.7    7e-09    
gb|EMT15255.1|  U-box domain-containing protein 22                    64.7    7e-09    
ref|XP_010043987.1|  PREDICTED: U-box domain-containing protein 2...  64.7    7e-09    
ref|XP_008367613.1|  PREDICTED: U-box domain-containing protein 2...  64.7    7e-09    
ref|XP_010427916.1|  PREDICTED: U-box domain-containing protein 10    65.1    7e-09    
ref|XP_009803619.1|  PREDICTED: U-box domain-containing protein 4...  64.3    7e-09    
ref|XP_004953855.1|  PREDICTED: U-box domain-containing protein 2...  64.7    8e-09    
ref|XP_010415797.1|  PREDICTED: U-box domain-containing protein 1...  64.7    8e-09    
ref|XP_003602626.1|  U-box domain-containing protein                  64.3    8e-09    
ref|XP_010912561.1|  PREDICTED: E3 ubiquitin-protein ligase PUB22...  64.7    8e-09    
ref|XP_004240176.1|  PREDICTED: U-box domain-containing protein 2...  64.3    8e-09    
ref|XP_008798480.1|  PREDICTED: U-box domain-containing protein 4     64.7    8e-09    
ref|XP_010556449.1|  PREDICTED: U-box domain-containing protein 4...  64.3    8e-09    
ref|XP_010042637.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  61.6    8e-09    
ref|XP_008382858.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  65.1    8e-09    
ref|XP_008393710.1|  PREDICTED: U-box domain-containing protein 3...  64.3    8e-09    
gb|EPS70781.1|  hypothetical protein M569_03979                       65.1    8e-09    
ref|XP_006355051.1|  PREDICTED: U-box domain-containing protein 2...  64.3    9e-09    
ref|XP_002313440.1|  armadillo/beta-catenin repeat family protein     64.7    9e-09    
gb|ADI46213.1|  CMPG1a                                                64.3    9e-09    
ref|XP_010556451.1|  PREDICTED: U-box domain-containing protein 4...  63.9    9e-09    
ref|XP_011006317.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  64.3    9e-09    
gb|KDP41625.1|  hypothetical protein JCGZ_16032                       63.9    1e-08    
ref|XP_011099937.1|  PREDICTED: U-box domain-containing protein 2...  64.3    1e-08    
ref|XP_010685445.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  64.3    1e-08    
ref|XP_009370082.1|  PREDICTED: U-box domain-containing protein 21    64.3    1e-08    
ref|XP_010935918.1|  PREDICTED: U-box domain-containing protein 3...  64.7    1e-08    
ref|XP_004142305.1|  PREDICTED: U-box domain-containing protein 2...  64.3    1e-08    
ref|XP_006433633.1|  hypothetical protein CICLE_v10001676mg           63.9    1e-08    
ref|XP_006854597.1|  hypothetical protein AMTR_s00030p00130440        63.9    1e-08    
ref|XP_003531998.1|  PREDICTED: U-box domain-containing protein 2...  63.9    1e-08    
ref|XP_007225763.1|  hypothetical protein PRUPE_ppa005536mg           63.9    1e-08    
ref|XP_008346169.1|  PREDICTED: U-box domain-containing protein 3...  64.3    1e-08    
ref|XP_002526006.1|  E3 ubiquitin ligase PUB14, putative              64.3    1e-08    
ref|XP_009360045.1|  PREDICTED: U-box domain-containing protein 2...  63.9    1e-08    
gb|EYU36380.1|  hypothetical protein MIMGU_mgv1a009210mg              63.5    1e-08    
ref|XP_007036951.1|  ARM repeat superfamily protein                   63.9    1e-08    
ref|XP_008393732.1|  PREDICTED: U-box domain-containing protein 4...  63.5    1e-08    
ref|XP_006404100.1|  hypothetical protein EUTSA_v10010374mg           63.9    1e-08    
ref|XP_009343248.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23     63.9    1e-08    
ref|XP_006356861.1|  PREDICTED: U-box domain-containing protein 4...  63.5    1e-08    
ref|XP_011083032.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  64.3    1e-08    
gb|KDP28458.1|  hypothetical protein JCGZ_14229                       63.5    1e-08    
ref|XP_009789261.1|  PREDICTED: U-box domain-containing protein 2...  63.5    1e-08    
ref|XP_004515619.1|  PREDICTED: U-box domain-containing protein 1...  63.9    1e-08    
ref|XP_003530079.1|  PREDICTED: U-box domain-containing protein 2...  63.5    1e-08    
gb|KHN08833.1|  U-box domain-containing protein 4                     62.4    1e-08    
ref|XP_009336069.1|  PREDICTED: U-box domain-containing protein 4...  63.9    1e-08    
ref|XP_009603721.1|  PREDICTED: U-box domain-containing protein 4     63.5    2e-08    
ref|XP_010246789.1|  PREDICTED: U-box domain-containing protein 3...  63.9    2e-08    
ref|XP_004252739.1|  PREDICTED: U-box domain-containing protein 4...  63.5    2e-08    
ref|XP_009367873.1|  PREDICTED: U-box domain-containing protein 4...  63.9    2e-08    
ref|XP_010319902.1|  PREDICTED: U-box domain-containing protein 4...  63.9    2e-08    
dbj|BAJ91241.1|  predicted protein                                    63.5    2e-08    
dbj|BAJ90807.1|  predicted protein                                    63.5    2e-08    
gb|KHN25100.1|  U-box domain-containing protein 21                    63.5    2e-08    
ref|XP_009380073.1|  PREDICTED: U-box domain-containing protein 2...  63.5    2e-08    
ref|XP_010530486.1|  PREDICTED: U-box domain-containing protein 4...  63.2    2e-08    
ref|XP_004287978.1|  PREDICTED: U-box domain-containing protein 4...  63.9    2e-08    
ref|XP_008345702.1|  PREDICTED: U-box domain-containing protein 3...  63.5    2e-08    
gb|KJB35467.1|  hypothetical protein B456_006G116400                  63.5    2e-08    
ref|XP_006356848.1|  PREDICTED: U-box domain-containing protein 3...  63.5    2e-08    
ref|XP_009367853.1|  PREDICTED: U-box domain-containing protein 4...  63.9    2e-08    
ref|XP_009336148.1|  PREDICTED: U-box domain-containing protein 3...  63.9    2e-08    
ref|XP_011463613.1|  PREDICTED: U-box domain-containing protein 4...  63.9    2e-08    
gb|EYU43705.1|  hypothetical protein MIMGU_mgv1a006344mg              63.5    2e-08    
ref|XP_009390871.1|  PREDICTED: U-box domain-containing protein 2...  63.5    2e-08    
ref|XP_008381777.1|  PREDICTED: U-box domain-containing protein 2...  63.5    2e-08    
ref|XP_008457035.1|  PREDICTED: U-box domain-containing protein 2...  63.5    2e-08    
ref|XP_006361218.1|  PREDICTED: U-box domain-containing protein 4...  63.9    2e-08    
ref|XP_004985053.1|  PREDICTED: U-box domain-containing protein 2...  63.2    2e-08    
ref|XP_008790249.1|  PREDICTED: U-box domain-containing protein 3...  63.2    2e-08    
ref|XP_010912070.1|  PREDICTED: E3 ubiquitin-protein ligase PUB23...  63.2    2e-08    
gb|KJB08865.1|  hypothetical protein B456_001G109500                  63.5    2e-08    
ref|XP_008238495.1|  PREDICTED: U-box domain-containing protein 4     63.5    2e-08    



>ref|XP_004230770.1| PREDICTED: U-box domain-containing protein 26-like [Solanum lycopersicum]
Length=415

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L +PS+DVR+NSAALIE+V++G RSPE RAQISNAD++FEG+VGILN PL+Y RALK+G+
Sbjct  201  LFHPSIDVRVNSAALIETVVAGMRSPEFRAQISNADDVFEGVVGILNYPLAYPRALKVGI  260

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ+R +AV+AGAVEALIDRLQDF+KCDAERALAT+ELL RIPSGCAA A+H
Sbjct  261  KALFALCLVKQHRQRAVSAGAVEALIDRLQDFEKCDAERALATIELLSRIPSGCAALASH  320

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVKIILKIS RATEYAAGALLS+CSASEQAQ+EA AAGV+ QLLLLVQSDCTER
Sbjct  321  ALTVPLLVKIILKISERATEYAAGALLSLCSASEQAQKEAVAAGVLIQLLLLVQSDCTER  380

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLK LRDCWPED    +DD+ CS VVPF
Sbjct  381  AKRKAQMLLKQLRDCWPEDSIANTDDFACSDVVPF  415



>ref|XP_006346399.1| PREDICTED: U-box domain-containing protein 26-like [Solanum tuberosum]
Length=415

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 195/215 (91%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L +PS+DVR+NSAALIE V++G RS ELRAQISNAD++FEG+VGILN PL+Y RALK+G+
Sbjct  201  LFHPSIDVRVNSAALIEIVVAGMRSSELRAQISNADDVFEGVVGILNYPLAYPRALKVGI  260

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ+R +AVTAGAVEALIDRLQDF+KCDAERALAT+ELL RIPSGCAA A+H
Sbjct  261  KALFALCLVKQHRQRAVTAGAVEALIDRLQDFEKCDAERALATIELLSRIPSGCAALASH  320

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVKIILKIS RATEYAAGALLS+CSASEQAQ+EA AAGV+ QLLLLVQSDCTER
Sbjct  321  ALTVPLLVKIILKISERATEYAAGALLSLCSASEQAQKEAVAAGVLIQLLLLVQSDCTER  380

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLK LRDCWPED    SDD+ CS VVPF
Sbjct  381  AKRKAQMLLKQLRDCWPEDSIANSDDFACSDVVPF  415



>ref|XP_010107920.1| U-box domain-containing protein 26 [Morus notabilis]
 gb|EXC17320.1| U-box domain-containing protein 26 [Morus notabilis]
Length=416

 Score =   313 bits (803),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 164/216 (76%), Positives = 191/216 (88%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+DVR+NSAA+IE V++GTR+PELR+QISN DEIFEG++ IL  P++Y RALK+G+
Sbjct  201  LFHSSIDVRVNSAAMIEIVVAGTRTPELRSQISNVDEIFEGVIEILRSPIAYPRALKVGI  260

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFA+CL KQ RHKA+ AGA E LIDRL DF+KCDAERALATVELLCRIP+GC+A AAH
Sbjct  261  KALFAMCLVKQTRHKAIAAGAAEILIDRLADFEKCDAERALATVELLCRIPAGCSALAAH  320

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVKIILKIS RATEYAAGAL+S+CSASEQ+QREA AAG++TQLLLLVQSDCT+R
Sbjct  321  ALTVPLLVKIILKISDRATEYAAGALVSLCSASEQSQREAVAAGILTQLLLLVQSDCTDR  380

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  646
            AKRKAQ+LLKLLRD WPED    SDD+ CS  VVPF
Sbjct  381  AKRKAQLLLKLLRDSWPEDSIRNSDDFACSEVVVPF  416



>ref|XP_011000686.1| PREDICTED: U-box domain-containing protein 26-like isoform X1 
[Populus euphratica]
 ref|XP_011000695.1| PREDICTED: U-box domain-containing protein 26-like isoform X2 
[Populus euphratica]
Length=413

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 187/215 (87%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+NSAALIE+V++GTRSP+LR QISN + IF+G++ IL  PLS  RALK+G+
Sbjct  199  LFHSSIEVRVNSAALIENVIAGTRSPDLRLQISNTEIIFQGVIEILKNPLSSPRALKVGI  258

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RHKAVTAGA E LIDRL DFDKCDAERALAT+ELLCRI  GCAAFAAH
Sbjct  259  KALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDAERALATIELLCRIQVGCAAFAAH  318

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK ILKIS RATEYAAGALL++CSASE +Q+EA  AG++TQLLLLVQSDCT+R
Sbjct  319  ALTVPLLVKTILKISDRATEYAAGALLALCSASELSQKEAVCAGILTQLLLLVQSDCTDR  378

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLKLLRD WPED  G SDD+ CS VVPF
Sbjct  379  AKRKAQMLLKLLRDAWPEDSVGNSDDFLCSDVVPF  413



>gb|ABK93469.1| unknown [Populus trichocarpa]
Length=413

 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+NSAALIE+V++GTRS +LR QISN + IFEG++ IL  PLS  RALKIG+
Sbjct  199  LFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNTEIIFEGVIEILKNPLSSPRALKIGI  258

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RHKAVTAGA E LIDRL DFDKCDAERALAT+ELLCRI  GCAAFAAH
Sbjct  259  KALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDAERALATIELLCRIQVGCAAFAAH  318

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK ILKIS RATEYAAGALL++CSASE +Q+EA  AG++TQLLLLVQSDCT+R
Sbjct  319  ALTVPLLVKTILKISDRATEYAAGALLALCSASELSQKEAVCAGILTQLLLLVQSDCTDR  378

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLKLLRD WPED  G SDD+ CS VVPF
Sbjct  379  AKRKAQMLLKLLRDAWPEDSVGNSDDFLCSEVVPF  413



>ref|XP_002313124.2| U-box domain-containing family protein [Populus trichocarpa]
 gb|EEE87079.2| U-box domain-containing family protein [Populus trichocarpa]
Length=413

 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+NSAALIE+V++GTRS +LR QISN + IFEG++ IL  PLS  RALKIG+
Sbjct  199  LFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNTEIIFEGVIEILKNPLSSPRALKIGI  258

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RHKAVTAGA E LIDRL DFDKCDAERALAT+ELLCRI  GCAAFAAH
Sbjct  259  KALFALCLVKQTRHKAVTAGAAETLIDRLADFDKCDAERALATIELLCRIQVGCAAFAAH  318

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK ILKIS RATEYAAGALL++CSASE +Q+EA  AG++TQLLLLVQSDCT+R
Sbjct  319  ALTVPLLVKTILKISDRATEYAAGALLALCSASELSQKEAVCAGILTQLLLLVQSDCTDR  378

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLKLLRD WPED  G SDD+ CS VVPF
Sbjct  379  AKRKAQMLLKLLRDAWPEDSVGNSDDFLCSEVVPF  413



>gb|KDP32265.1| hypothetical protein JCGZ_14786 [Jatropha curcas]
Length=416

 Score =   311 bits (798),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = +2

Query  14   SVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALF  193
            S++VR+NSAALIE V++GT+S +LRAQIS+ DEIFEG++ +L  P+SY RALKIG+KALF
Sbjct  206  SIEVRVNSAALIEIVVAGTKSSDLRAQISSVDEIFEGVIEMLKNPISYPRALKIGIKALF  265

Query  194  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTV  373
            ALCL KQ RHKAV+AGA + LIDRL DFDKCDAERALAT+ELLCR+P+GC AFA HALTV
Sbjct  266  ALCLVKQTRHKAVSAGAADILIDRLADFDKCDAERALATIELLCRVPTGCTAFAGHALTV  325

Query  374  PLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRK  553
            PLLVK ILKIS RATEYAAGALL++C++SEQ+QREA +AG++TQLLLLVQSDCT+RAKRK
Sbjct  326  PLLVKKILKISDRATEYAAGALLALCTSSEQSQREAVSAGILTQLLLLVQSDCTDRAKRK  385

Query  554  AQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AQMLLKLLRD WPED +  SDD+ CS VVPF
Sbjct  386  AQMLLKLLRDSWPEDSSANSDDFICSEVVPF  416



>ref|XP_011005992.1| PREDICTED: U-box domain-containing protein 26-like [Populus euphratica]
Length=413

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+NSAALIE+V++GTRS +LR QISN + IFEG++ IL  PLS  RALKIG+
Sbjct  199  LFHSSIEVRVNSAALIENVVAGTRSSDLRLQISNREIIFEGVIDILKNPLSSPRALKIGI  258

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            K LFALCL KQ RHKAV+AGA E LIDRL D DKCDAERALAT+ELLCRI  GCAAFAAH
Sbjct  259  KGLFALCLGKQTRHKAVSAGAAETLIDRLADLDKCDAERALATIELLCRIQVGCAAFAAH  318

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK ILKIS RATEYAAGALL++CSASEQ+Q+EA  AG++TQLLLLVQSDCT+R
Sbjct  319  ALTVPLLVKTILKISDRATEYAAGALLALCSASEQSQKEAVCAGILTQLLLLVQSDCTDR  378

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLKLLRD WPED  G SDD+ CS VVPF
Sbjct  379  AKRKAQMLLKLLRDSWPEDSVGNSDDFVCSEVVPF  413



>ref|XP_010270217.1| PREDICTED: U-box domain-containing protein 26-like [Nelumbo nucifera]
Length=428

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            LS+ S++VR+N+AALIE V +GTRS E R  I NAD + EGI  IL+ PL+Y RALK+G+
Sbjct  214  LSHSSIEVRVNAAALIEIVAAGTRSVEHRILIGNADGVMEGITRILSNPLAYPRALKVGI  273

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RHKAV+AGAV+ALIDRL DF+KCDAERALATVELLCRIP GCAAFA H
Sbjct  274  KALFALCLVKQSRHKAVSAGAVDALIDRLADFEKCDAERALATVELLCRIPEGCAAFAEH  333

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVKIILKIS RATEYAAGALLS+CSAS+Q QR+A AAGV+TQLLLLVQSDCTER
Sbjct  334  ALTVPLLVKIILKISDRATEYAAGALLSLCSASKQLQRDAVAAGVVTQLLLLVQSDCTER  393

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQ+LLKLLRD WP+D    SDD+ CS V PF
Sbjct  394  AKRKAQLLLKLLRDSWPDDSIANSDDFGCSDVSPF  428



>ref|XP_002306161.2| hypothetical protein POPTR_0004s14720g [Populus trichocarpa]
 gb|EEE86672.2| hypothetical protein POPTR_0004s14720g [Populus trichocarpa]
Length=413

 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+NSAALIE+V++GTRS +LR QISN + IFEG++ IL  PLS  RALKIG+
Sbjct  199  LFHSSIEVRVNSAALIENVIAGTRSSDLRLQISNMEIIFEGVIDILKNPLSSPRALKIGI  258

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            K LFALCL KQ RHKAV+AGA E LIDRL D DKCDAERALAT+ELLCRI  GCAAF AH
Sbjct  259  KGLFALCLVKQTRHKAVSAGAAETLIDRLADLDKCDAERALATIELLCRIQVGCAAFVAH  318

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK ILKIS RATEYAAGALL++CSASEQ+Q+EA  AG++TQLLLLVQSDCT+R
Sbjct  319  ALTVPLLVKTILKISDRATEYAAGALLALCSASEQSQKEAVCAGILTQLLLLVQSDCTDR  378

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLKLLRD WPED  G SDD+ CS VVPF
Sbjct  379  AKRKAQMLLKLLRDSWPEDSAGNSDDFVCSEVVPF  413



>emb|CDO97189.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            LS+ SVDVR+NSAA+IE  +SGTRSPELR+Q+SNA+ IFEG++GILN PL+Y RA KIGV
Sbjct  198  LSHSSVDVRVNSAAVIEMAVSGTRSPELRSQVSNAEGIFEGVIGILNYPLAYPRASKIGV  257

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ+R +AVTAGAV+AL+D L DF+KCDAERALATVELLCRIPSGC AF+AH
Sbjct  258  KALFALCLVKQHRQRAVTAGAVDALVDGLADFEKCDAERALATVELLCRIPSGCEAFSAH  317

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVKIILKIS RATEYAAGALLS+CSAS+QAQR+A  AGV+TQLLLLVQSDCT+R
Sbjct  318  ALTVPLLVKIILKISDRATEYAAGALLSLCSASDQAQRDAVVAGVLTQLLLLVQSDCTDR  377

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLKLLRD WPED  G SDD+ CS VV F
Sbjct  378  AKRKAQMLLKLLRDSWPEDSIGNSDDFGCSDVVAF  412



>ref|XP_007042451.1| Plant U-box 26 [Theobroma cacao]
 gb|EOX98282.1| Plant U-box 26 [Theobroma cacao]
Length=416

 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+NSA+LIE V++GTRS +LRAQISN DEIFEG+  +L    SY RALKI +
Sbjct  202  LFHSSIEVRVNSASLIEIVVAGTRSSDLRAQISNVDEIFEGVTDLLKNLNSYPRALKISI  261

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            +ALFALCL KQ RHKAV AGA E LIDRL D DKCDAERALAT+ELLCRIPSGC+AFAAH
Sbjct  262  RALFALCLVKQTRHKAVQAGAAETLIDRLADLDKCDAERALATIELLCRIPSGCSAFAAH  321

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK ILKIS RATE++AGAL+++CS SEQ+QR+A +AG++TQLLLLVQSDCT+R
Sbjct  322  ALTVPLLVKTILKISDRATEHSAGALVALCSESEQSQRDAVSAGILTQLLLLVQSDCTDR  381

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQ LLKLLRD WPED  G SDD+ CS VVPF
Sbjct  382  AKRKAQTLLKLLRDSWPEDSIGNSDDFACSEVVPF  416



>ref|XP_011088242.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=415

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+DVR+NSAA+IE V++G RSPELR QIS+AD +FEGIVGILN PL YSRALKIG+
Sbjct  201  LFHSSIDVRVNSAAMIEIVVAGIRSPELRVQISSADGVFEGIVGILNYPLLYSRALKIGI  260

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ+R KAV AGAVEALID+L +F+KCDAERALATVELLCRIPSGCAAFA+H
Sbjct  261  KALFALCLVKQHRQKAVAAGAVEALIDKLAEFEKCDAERALATVELLCRIPSGCAAFASH  320

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVKIILKIS RATEYAAGALLS+CSASE+AQ+EA AAGV+TQLLLLVQSDCTER
Sbjct  321  ALTVPLLVKIILKISDRATEYAAGALLSLCSASERAQQEAVAAGVLTQLLLLVQSDCTER  380

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLKLLR+ WP D    SDDY  S VVPF
Sbjct  381  AKRKAQMLLKLLRNSWPHDSLANSDDYAGSDVVPF  415



>ref|XP_011092561.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=415

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/215 (80%), Positives = 191/215 (89%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + SVD+R+NSAA+IE+V++G RS ELRAQIS+AD +FEGIVGILN PL Y RALKIG+
Sbjct  201  LFHSSVDIRVNSAAVIETVVAGIRSSELRAQISSADGVFEGIVGILNYPLVYPRALKIGI  260

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ+RHKAV AGAVEALIDRL +F+KCD+ERALATVELLCRIPSGCAAF +H
Sbjct  261  KALFALCLVKQHRHKAVAAGAVEALIDRLPEFEKCDSERALATVELLCRIPSGCAAFESH  320

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVKIILKIS RATEYAAGALLS+CSASE+AQ +A AAGV+TQLLLLVQSDCTER
Sbjct  321  ALTVPLLVKIILKISDRATEYAAGALLSLCSASERAQADAVAAGVLTQLLLLVQSDCTER  380

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLKLLRD WP D    SDD+  S VVPF
Sbjct  381  AKRKAQMLLKLLRDSWPRDSIARSDDFAGSDVVPF  415



>gb|EPS57772.1| hypothetical protein M569_17045 [Genlisea aurea]
Length=414

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 188/213 (88%), Gaps = 0/213 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+DVR+NSAA++E  ++G RSPELRA+IS+ D +F GIVGILN PL+Y  ALKIG+
Sbjct  201  LFHSSIDVRVNSAAVVEVTVAGIRSPELRARISSLDGVFRGIVGILNYPLAYPHALKIGI  260

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCLAKQ+RH+AV+AGAVE+LIDRL +F+KCDAERALATVELLCR+P GCAAFA+H
Sbjct  261  KALFALCLAKQHRHRAVSAGAVESLIDRLAEFEKCDAERALATVELLCRVPDGCAAFASH  320

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVKIILKIS RATEYAAGALLS+CSASEQ+Q EA AAGV+TQL+LLVQSDCTER
Sbjct  321  ALTVPLLVKIILKISDRATEYAAGALLSLCSASEQSQGEAVAAGVLTQLILLVQSDCTER  380

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  640
            AKRKAQMLLKLLR+ WP +    SDD+  S VV
Sbjct  381  AKRKAQMLLKLLRNSWPLESMCNSDDFAGSDVV  413



>ref|XP_009627648.1| PREDICTED: U-box domain-containing protein 26-like [Nicotiana 
tomentosiformis]
Length=417

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 192/216 (89%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L +PS+DVR+NSAALIE V++G RS ELRAQISN D++FEG+VGILN PL+Y RALK+G+
Sbjct  202  LFHPSIDVRVNSAALIEVVVAGIRSSELRAQISNIDDVFEGVVGILNYPLAYPRALKVGI  261

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ+R KAV AGAVEALIDRLQDF+KCDAERALAT+ELL RIPSGCAA A+H
Sbjct  262  KALFALCLVKQHRQKAVAAGAVEALIDRLQDFEKCDAERALATIELLARIPSGCAALASH  321

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK ILK+S RATEYAAGALLS+C ASEQAQ+EA AAGV+TQLLLLVQSDCT+R
Sbjct  322  ALTVPLLVKTILKVSERATEYAAGALLSLCLASEQAQKEAVAAGVLTQLLLLVQSDCTDR  381

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNC-SYVVPF  646
            AKRKAQMLLK LRDCWPE+ T  SDDY   S VVPF
Sbjct  382  AKRKAQMLLKQLRDCWPEESTANSDDYFAYSDVVPF  417



>gb|KJB79347.1| hypothetical protein B456_013G045000 [Gossypium raimondii]
Length=416

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+NSA+LIE+VLSGTRSP+LRAQISNADEIFEG+V IL    SY RAL+IGV
Sbjct  202  LFHSSIEVRINSASLIENVLSGTRSPDLRAQISNADEIFEGVVDILRNLNSYPRALRIGV  261

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            +ALFALCL KQ RHKAV AGA   LIDRL D DKCDAERALAT+ELLCRIPSGC+AFAAH
Sbjct  262  RALFALCLVKQTRHKAVQAGAPATLIDRLADLDKCDAERALATIELLCRIPSGCSAFAAH  321

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK ILKIS RATEYAAGAL+++CS SE +QREA +AGV+TQLLLLVQSDCTER
Sbjct  322  ALTVPLLVKTILKISDRATEYAAGALMALCSESEGSQREAVSAGVLTQLLLLVQSDCTER  381

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLKLLRD WPED  G SDD+ CS +VPF
Sbjct  382  AKRKAQMLLKLLRDSWPEDSIGNSDDFACSEIVPF  416



>ref|XP_002285110.1| PREDICTED: U-box domain-containing protein 26 [Vitis vinifera]
Length=415

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+NSAALIE V++GTRS +LRAQISN DEIFEGI GILN PL+Y RALK+G+
Sbjct  201  LFHASIEVRVNSAALIEIVVAGTRSLDLRAQISNVDEIFEGITGILNYPLAYPRALKVGI  260

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCLAKQ RHKAV AGAV ALIDRL DF+KCD ERALATVELLCR+P+GCAAFAAH
Sbjct  261  KALFALCLAKQSRHKAVAAGAVTALIDRLADFEKCDVERALATVELLCRVPAGCAAFAAH  320

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLV+ ILK+S RATEYAAGALLS+CSA+EQ+QREA +AGV+TQLLLLVQSDCTER
Sbjct  321  ALTVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQREAVSAGVVTQLLLLVQSDCTER  380

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQ+LLKLLRD WPED    SDD+ CS VVPF
Sbjct  381  AKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVVPF  415



>ref|XP_004309747.1| PREDICTED: U-box domain-containing protein 26 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = +2

Query  14   SVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALF  193
            S++VR+NSAALIE++L+G+R+ ELRAQISN DEI  G++ IL  P+++ RALKIG+KALF
Sbjct  206  SMEVRVNSAALIENLLAGSRTAELRAQISNVDEIHHGVIEILRNPIAHPRALKIGIKALF  265

Query  194  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTV  373
            ALCL KQ R KAV AGA E LI+ L DF+KCD+ERALAT+ELLCR+P GCAAFAAHALTV
Sbjct  266  ALCLVKQTRDKAVAAGAPETLINTLADFEKCDSERALATIELLCRVPEGCAAFAAHALTV  325

Query  374  PLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRK  553
            PLLVK ILKIS RATEYAAGALLS+CS SEQ+Q +A AAG+MTQLLLLVQSDCT+RAKRK
Sbjct  326  PLLVKTILKISDRATEYAAGALLSLCSESEQSQNDAVAAGIMTQLLLLVQSDCTDRAKRK  385

Query  554  AQMLLKLLRDCWPEDFTGISDDYNCSYVV  640
            AQ+LLKLLRD WPED  G SDD+ CS VV
Sbjct  386  AQLLLKLLRDSWPEDSVGNSDDFVCSDVV  414



>ref|XP_010263503.1| PREDICTED: U-box domain-containing protein 26-like [Nelumbo nucifera]
Length=416

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 183/215 (85%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            LS+  ++VR+N+AALIE V++GTRS E R  I NAD + EGI  ILN PL+Y RALK+G+
Sbjct  202  LSHSCIEVRVNAAALIEMVVAGTRSLENRILIGNADGVLEGITRILNHPLAYPRALKVGI  261

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RH AV+AGAVEALID+L DF+KCDAERALATVELLCRIP+G +AFA H
Sbjct  262  KALFALCLVKQNRHMAVSAGAVEALIDKLADFEKCDAERALATVELLCRIPAGRSAFAEH  321

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVKIILKIS RATEYA GAL+S+CSASEQ QR+A AAGV+TQLLLLVQSDCTER
Sbjct  322  ALTVPLLVKIILKISDRATEYATGALVSLCSASEQLQRDAVAAGVVTQLLLLVQSDCTER  381

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQ+LLKLLRD WPED    SDD+ CS V PF
Sbjct  382  AKRKAQLLLKLLRDSWPEDSIANSDDFACSDVAPF  416



>emb|CAN74163.1| hypothetical protein VITISV_026443 [Vitis vinifera]
Length=476

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 192/215 (89%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+NSAALIE V++GTRS +LRAQISN DEIFEGI GILN PL+Y RALK+G+
Sbjct  262  LFHASIEVRVNSAALIEIVVAGTRSLDLRAQISNVDEIFEGITGILNYPLAYPRALKVGI  321

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCLAKQ RHKAV AGAV ALIDRL DF+KCD ERALATVELLCR+P+GCAAFAAH
Sbjct  322  KALFALCLAKQSRHKAVAAGAVTALIDRLADFEKCDVERALATVELLCRVPAGCAAFAAH  381

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLV+ ILK+S RATEYAAGALLS+CSA+EQ+QREA +AGV+TQLLLLVQSDCTER
Sbjct  382  ALTVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQREAVSAGVVTQLLLLVQSDCTER  441

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQ+LLKLLRD WPED    SDD+ CS VVPF
Sbjct  442  AKRKAQLLLKLLRDSWPEDSVVNSDDFGCSDVVPF  476



>ref|XP_009792112.1| PREDICTED: U-box domain-containing protein 26-like [Nicotiana 
sylvestris]
Length=415

 Score =   292 bits (748),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 192/216 (89%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L +PS+DVR+NSAALIE V++G RS ELRAQIS+ D++FEG+VGILN PL+Y RALK+G+
Sbjct  201  LFHPSIDVRVNSAALIEVVVAGIRS-ELRAQISSIDDVFEGVVGILNYPLAYPRALKVGI  259

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ+R KAV AGAVEALIDRLQDF+KCDAERALAT+ELL RIPSGCAA A+H
Sbjct  260  KALFALCLVKQHRQKAVAAGAVEALIDRLQDFEKCDAERALATIELLSRIPSGCAALASH  319

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK ILK+S RATEYAAGALLS+C ASEQAQ+EAAAAGV+TQLLLLVQSDCTER
Sbjct  320  ALTVPLLVKTILKVSERATEYAAGALLSLCLASEQAQKEAAAAGVLTQLLLLVQSDCTER  379

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNC-SYVVPF  646
            AKRKAQ+LLK LRDCWPED    SDDY   S VVPF
Sbjct  380  AKRKAQLLLKQLRDCWPEDSIANSDDYFAYSDVVPF  415



>ref|XP_007153588.1| hypothetical protein PHAVU_003G048200g [Phaseolus vulgaris]
 gb|ESW25582.1| hypothetical protein PHAVU_003G048200g [Phaseolus vulgaris]
Length=413

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            LS+ S+DVR+NSAALIE V++GT SPELRA +S  DEI++G+V +L  P+SY RALKIG+
Sbjct  197  LSHNSLDVRVNSAALIEIVVAGTHSPELRACVSEVDEIYDGVVDLLRSPISYPRALKIGI  256

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RHKAV AGA   L+DRL DF+KCDAERALATVELLCRIP+GC AFA H
Sbjct  257  KALFALCLVKQTRHKAVAAGAPAVLVDRLADFEKCDAERALATVELLCRIPAGCEAFAGH  316

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVP+LVKIILKISHRATEYAAGALLS+CS SE+ QREA  AGV+TQLLLLVQSDCTER
Sbjct  317  ALTVPMLVKIILKISHRATEYAAGALLSLCSESERCQREAVTAGVLTQLLLLVQSDCTER  376

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSY--VVPF  646
            AKRKAQMLLKLLRD WP+D  G SDD+ CS   VVPF
Sbjct  377  AKRKAQMLLKLLRDSWPQDCIGNSDDFACSQVVVVPF  413



>ref|XP_008456137.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis melo]
Length=425

 Score =   288 bits (736),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 182/216 (84%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+N+AALIE+V++GTR+ ELR QI   DE+FEG+V IL  P +Y RALK+GV
Sbjct  209  LFDSSIEVRINAAALIETVIAGTRASELRTQICGIDELFEGVVEILRDPTAYPRALKVGV  268

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RHKAV+AGA E +IDR  D +K DAERALAT+EL+CR+P+GC AFAAH
Sbjct  269  KALFALCLVKQTRHKAVSAGAAEIIIDRFPDLEKYDAERALATIELICRVPTGCDAFAAH  328

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK+ILKIS RATE A GAL+S+CSASE+ +REA AAG++TQLLLLVQSDCTER
Sbjct  329  ALTVPLLVKVILKISDRATESAVGALVSLCSASEENRREAVAAGILTQLLLLVQSDCTER  388

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  646
             KRK+Q+LLKLLRD WP++  G SDDY CS  VVPF
Sbjct  389  VKRKSQVLLKLLRDSWPQESVGNSDDYGCSEIVVPF  424



>ref|XP_004140703.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 ref|XP_004171341.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 gb|KGN57520.1| hypothetical protein Csa_3G203270 [Cucumis sativus]
Length=425

 Score =   285 bits (729),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 181/216 (84%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AALIE+V++GTR+ ELR QI   DE+FEG+V IL  P +Y RALK+GV
Sbjct  209  LFDSSIEDRINAAALIETVIAGTRASELRTQICGIDELFEGVVEILRDPTAYPRALKVGV  268

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RHKAV+AGA E +IDR  D +K DAERALAT+EL+CRIP+GC AFAAH
Sbjct  269  KALFALCLVKQTRHKAVSAGAAEIIIDRFPDLEKYDAERALATIELICRIPTGCDAFAAH  328

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK+ILKIS RATE A GAL+S+CSASE+ +REA AAG++TQLLLLVQSDCTER
Sbjct  329  ALTVPLLVKVILKISDRATESAVGALVSLCSASEENRREAVAAGILTQLLLLVQSDCTER  388

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  646
             KRK+Q+LLKLLRD WP++  G SDDY CS  VVPF
Sbjct  389  VKRKSQVLLKLLRDSWPQESVGNSDDYACSEIVVPF  424



>ref|XP_006422990.1| hypothetical protein CICLE_v10028522mg [Citrus clementina]
 gb|ESR36230.1| hypothetical protein CICLE_v10028522mg [Citrus clementina]
Length=418

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = +2

Query  17   VDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFA  196
            ++VR+NSAALIE VL+G RS ELRAQISN DEIFEG++ IL    SY R LK+G+KALFA
Sbjct  209  IEVRVNSAALIEIVLAGMRSQELRAQISNLDEIFEGVIDILKNLSSYPRGLKVGIKALFA  268

Query  197  LCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVP  376
            LCL KQ RHKAV AGA E L+DRL DFDKCDAERALATVELLCRIP+GCA FA HALTVP
Sbjct  269  LCLVKQTRHKAVAAGAAETLVDRLADFDKCDAERALATVELLCRIPAGCAEFAEHALTVP  328

Query  377  LLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKA  556
            LLVK ILKIS RATEYAAGAL ++CSASE+ QR+A +AGV+TQLLLLVQSDCT+RAKRKA
Sbjct  329  LLVKTILKISDRATEYAAGALAALCSASERCQRDAVSAGVLTQLLLLVQSDCTDRAKRKA  388

Query  557  QMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            Q+LLKLLRD WP+D  G SDD+ CS VVPF
Sbjct  389  QLLLKLLRDSWPQDSIGNSDDFACSEVVPF  418



>gb|KJB32363.1| hypothetical protein B456_005G237200 [Gossypium raimondii]
Length=416

 Score =   283 bits (724),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++VR+NSA+LIE+VL+G RS +LRA+I N DEIF G+  IL    SY RAL+IGV
Sbjct  202  LFHSSIEVRVNSASLIETVLAGMRSSDLRAEICNVDEIFAGVTDILKNLSSYPRALRIGV  261

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            +ALFALCL KQ RHKAV AGA E LIDRL D DKCDAERALAT+ELLCRIPSGC+AFA+H
Sbjct  262  RALFALCLLKQTRHKAVQAGAAETLIDRLTDLDKCDAERALATIELLCRIPSGCSAFASH  321

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVPLLVK IL+IS RATEYAAGAL+++CS SEQ+Q++A +AGV+TQLLLLVQSDCT+R
Sbjct  322  ALTVPLLVKTILRISDRATEYAAGALMALCSESEQSQKDAVSAGVLTQLLLLVQSDCTDR  381

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQMLLKLLRD WPED  G SDD+ CS +VPF
Sbjct  382  AKRKAQMLLKLLRDSWPEDSIGNSDDFACSEIVPF  416



>ref|XP_009341339.1| PREDICTED: U-box domain-containing protein 26 [Pyrus x bretschneideri]
Length=395

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 188/216 (87%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            + +PS++V++NSAALIE+VL+G+R+ ELRAQ+SN DEI  G+V IL  P++Y RAL+IGV
Sbjct  180  VQHPSMEVQVNSAALIENVLAGSRTAELRAQVSNVDEIHHGVVSILRNPIAYPRALRIGV  239

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KA+FALCL K+ R+KAV+AGA E LI+ L DF+KCD+ERALAT+ELLCR+P GCAAFAAH
Sbjct  240  KAVFALCLVKETRNKAVSAGAPETLINVLADFEKCDSERALATIELLCRVPEGCAAFAAH  299

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
             LTVPLLVK ILKIS RATEYAAGALLS+CSASE+++ EA AAGV+TQLLLLVQSDCTER
Sbjct  300  GLTVPLLVKTILKISDRATEYAAGALLSLCSASEKSKNEAVAAGVLTQLLLLVQSDCTER  359

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  646
            AKRKAQ+LLKLLRD WPED  G SDD+ CS  VVPF
Sbjct  360  AKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  395



>ref|XP_004505237.1| PREDICTED: U-box domain-containing protein 26-like [Cicer arietinum]
Length=415

 Score =   283 bits (723),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 185/217 (85%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            LS+ S DVR+NSAALIE V++GT SPE+RAQ+SN D I++G+V IL  P+SY RALK+G+
Sbjct  199  LSHSSFDVRVNSAALIEFVVAGTHSPEIRAQVSNVDGIYDGVVEILKNPISYPRALKVGI  258

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RH+AV AGA   L+DRL DF+KCDAERALATVELLCR+P+G  AFA H
Sbjct  259  KALFALCLVKQTRHRAVAAGAPVVLVDRLADFEKCDAERALATVELLCRVPAGITAFAGH  318

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVP+LVKIILKIS RATEYAAGALL++CS SE+ QREA AAGV+TQLLLLVQSDCTER
Sbjct  319  ALTVPMLVKIILKISDRATEYAAGALLALCSESERCQREAVAAGVLTQLLLLVQSDCTER  378

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSY--VVPF  646
            AKRKAQ+LLKLLRD WP+D  G SDD+ CS   VVPF
Sbjct  379  AKRKAQLLLKLLRDSWPQDSIGNSDDFACSQVVVVPF  415



>ref|XP_007199948.1| hypothetical protein PRUPE_ppa006352mg [Prunus persica]
 gb|EMJ01147.1| hypothetical protein PRUPE_ppa006352mg [Prunus persica]
Length=416

 Score =   282 bits (722),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 186/212 (88%), Gaps = 1/212 (0%)
 Frame = +2

Query  14   SVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALF  193
            S++VR+NSAALIE+VL+G+R+ ELRA+ISN DEI +G+V IL  P++Y RALKIG+KALF
Sbjct  205  SMEVRVNSAALIENVLAGSRTAELRAEISNVDEIHQGVVSILRNPIAYPRALKIGIKALF  264

Query  194  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTV  373
            ALCL KQ R+KAV+AGA E LI+ L DF+KCD+ERALAT+ELLCR+P GC AFAAHALTV
Sbjct  265  ALCLVKQTRNKAVSAGAPETLINTLADFEKCDSERALATIELLCRVPDGCTAFAAHALTV  324

Query  374  PLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRK  553
            PLLVK ILKIS RATEYAAGALLS+CSASE++Q +A AAGV+TQLLLLVQSDCT+RAKRK
Sbjct  325  PLLVKTILKISDRATEYAAGALLSLCSASEKSQNDAVAAGVLTQLLLLVQSDCTDRAKRK  384

Query  554  AQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  646
            AQ+LLKLLRD WPED  G SDD+ CS  VVPF
Sbjct  385  AQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  416



>ref|XP_008236490.1| PREDICTED: U-box domain-containing protein 26-like [Prunus mume]
Length=436

 Score =   283 bits (723),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 186/212 (88%), Gaps = 1/212 (0%)
 Frame = +2

Query  14   SVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALF  193
            S++VR+NSAALIE+VL+G+R+ ELRA+ISN DEI +G+V IL  P++Y RALKIG+KALF
Sbjct  225  SMEVRVNSAALIENVLAGSRTAELRAEISNVDEIHQGVVSILRNPIAYPRALKIGIKALF  284

Query  194  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTV  373
            ALCL KQ R+KAV+AGA E LI+ L DF+KCD+ERALAT+ELLCR+P GC AFAAHALTV
Sbjct  285  ALCLVKQTRNKAVSAGAPETLINTLADFEKCDSERALATIELLCRVPDGCTAFAAHALTV  344

Query  374  PLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRK  553
            PLLVK ILKIS RATEYAAGALLS+CSASE++Q +A AAGV+TQLLLLVQSDCT+RAKRK
Sbjct  345  PLLVKTILKISDRATEYAAGALLSLCSASEKSQNDAVAAGVLTQLLLLVQSDCTDRAKRK  404

Query  554  AQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  646
            AQ+LLKLLRD WPED  G SDD+ CS  VVPF
Sbjct  405  AQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  436



>ref|XP_008373128.1| PREDICTED: U-box domain-containing protein 26-like [Malus domestica]
Length=416

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 185/216 (86%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            + +PS++VR+NSAALIE+VL+G+R+ ELRAQ+SN DEI  G+V IL  P +Y RALKIGV
Sbjct  201  VQHPSMEVRVNSAALIENVLAGSRTAELRAQVSNVDEIHHGVVSILRNPJAYPRALKIGV  260

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KA+FALCL K+ R+KAV+AGA E LI+ L DF+K D+ERALAT+ELLCR+P GCAAFAAH
Sbjct  261  KAVFALCLVKETRNKAVSAGAPETLINVLADFEKYDSERALATIELLCRVPEGCAAFAAH  320

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
             LTVPLLVK ILKIS RATEYAAGALLS+CSASE+ Q EA AAGV+TQLLLLVQSDCTER
Sbjct  321  GLTVPLLVKTILKISDRATEYAAGALLSLCSASEKNQNEAVAAGVLTQLLLLVQSDCTER  380

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCS-YVVPF  646
            AKRKAQ+LLKLLRD WPED  G SDD+ CS  VVPF
Sbjct  381  AKRKAQLLLKLLRDSWPEDSVGNSDDFVCSELVVPF  416



>ref|XP_006487052.1| PREDICTED: U-box domain-containing protein 26-like [Citrus sinensis]
 gb|KDO59728.1| hypothetical protein CISIN_1g014817mg [Citrus sinensis]
Length=418

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = +2

Query  17   VDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFA  196
            ++VR+NSAALIE VL+G RS ELRAQISN DEIFEG++ IL    SY R LK+G+KALFA
Sbjct  209  IEVRVNSAALIEIVLAGMRSQELRAQISNLDEIFEGVIDILKNLSSYPRGLKVGIKALFA  268

Query  197  LCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVP  376
            LCL KQ R+KAV AGA E L+DRL DFDKCDAERALATVELLCRIP+GCA FA HALTVP
Sbjct  269  LCLVKQTRYKAVAAGAAETLVDRLADFDKCDAERALATVELLCRIPAGCAEFAEHALTVP  328

Query  377  LLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKA  556
            LLVK ILKIS RATEYAAGAL ++CSASE+ QR+A +AGV+TQLLLLVQSDCT+RAKRKA
Sbjct  329  LLVKTILKISDRATEYAAGALAALCSASERCQRDAVSAGVLTQLLLLVQSDCTDRAKRKA  388

Query  557  QMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            Q+LLKLLRD WP+D  G SDD+ CS VVPF
Sbjct  389  QLLLKLLRDSWPQDSIGNSDDFACSEVVPF  418



>ref|XP_003529402.1| PREDICTED: U-box domain-containing protein 26-like isoform X1 
[Glycine max]
Length=414

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 187/217 (86%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L++ S DVR+NSAAL+E V+ GT SPELRA++S+ DEI++G+V +L  P+S+ RALKIG+
Sbjct  198  LAHNSFDVRVNSAALVEIVVVGTHSPELRAEVSSVDEIYDGVVDLLRSPISHPRALKIGI  257

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL K  R KAV AGA   L+DRL DF+KCDAERALATVELLCRIP+GCAAFAAH
Sbjct  258  KALFALCLVKNTRQKAVAAGAPAVLVDRLADFEKCDAERALATVELLCRIPAGCAAFAAH  317

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVP+LVKIILKIS+RATEYAAGALLS+CS SE+ QREA AAGV+TQLLLL+QSDCTER
Sbjct  318  ALTVPMLVKIILKISNRATEYAAGALLSLCSESERCQREAVAAGVLTQLLLLMQSDCTER  377

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSY--VVPF  646
            AKRKAQMLLKLLRD WP+D  G SDD+ CS   VVPF
Sbjct  378  AKRKAQMLLKLLRDSWPQDSVGNSDDFACSQVVVVPF  414



>gb|AES90137.2| plant U-box protein [Medicago truncatula]
Length=410

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 155/211 (73%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            LS+ S DVR+NSAALIE +++GT SPE+R Q+SN D I++G+V IL  P+SY RALKIG+
Sbjct  198  LSHDSFDVRVNSAALIEIIVAGTHSPEIRLQVSNVDGIYDGVVEILKNPISYPRALKIGI  257

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RH+AV+AGA   LIDRL DF+KCDAERALATVELLCR+P+GCA+FA H
Sbjct  258  KALFALCLVKQTRHRAVSAGAPVVLIDRLADFEKCDAERALATVELLCRVPAGCASFAGH  317

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVP+LVKIILKIS RATEYAAGAL+++CS SE+ QREA AAGV+TQLLLLVQSDCTER
Sbjct  318  ALTVPMLVKIILKISDRATEYAAGALMALCSESERCQREAVAAGVLTQLLLLVQSDCTER  377

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSY  634
            AKRKAQ+LLKLLRD WP+D  G SDD+ C +
Sbjct  378  AKRKAQLLLKLLRDSWPQDSVGNSDDFACRH  408



>ref|XP_006583889.1| PREDICTED: U-box domain-containing protein 26-like isoform X2 
[Glycine max]
Length=444

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 185/213 (87%), Gaps = 0/213 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L++ S DVR+NSAAL+E V+ GT SPELRA++S+ DEI++G+V +L  P+S+ RALKIG+
Sbjct  198  LAHNSFDVRVNSAALVEIVVVGTHSPELRAEVSSVDEIYDGVVDLLRSPISHPRALKIGI  257

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL K  R KAV AGA   L+DRL DF+KCDAERALATVELLCRIP+GCAAFAAH
Sbjct  258  KALFALCLVKNTRQKAVAAGAPAVLVDRLADFEKCDAERALATVELLCRIPAGCAAFAAH  317

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVP+LVKIILKIS+RATEYAAGALLS+CS SE+ QREA AAGV+TQLLLL+QSDCTER
Sbjct  318  ALTVPMLVKIILKISNRATEYAAGALLSLCSESERCQREAVAAGVLTQLLLLMQSDCTER  377

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  640
            AKRKAQMLLKLLRD WP+D  G SDD+ CS VV
Sbjct  378  AKRKAQMLLKLLRDSWPQDSVGNSDDFACSQVV  410



>gb|EPS67592.1| hypothetical protein M569_07183, partial [Genlisea aurea]
Length=419

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 176/207 (85%), Gaps = 0/207 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            LS+ S+DVR+NSAA IE +++G RS +LRAQI + D +FEGIVGILN PL+   ALKIG+
Sbjct  211  LSHSSIDVRINSAAAIEMIVAGVRSSDLRAQIGSLDGVFEGIVGILNYPLANPHALKIGI  270

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCLAKQ+RH AV+AGA  ++I+RL +F+KC+AE+ALATVELLCRIP G AAFA+H
Sbjct  271  KALFALCLAKQHRHVAVSAGAAGSIINRLAEFEKCEAEKALATVELLCRIPDGRAAFASH  330

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
             LT+PLLVKIILKIS RATEYA+GALLS+C+ S+Q Q EA AAGV+ QL+LLVQSDCTER
Sbjct  331  PLTIPLLVKIILKISDRATEYASGALLSLCTMSDQTQAEAVAAGVLNQLILLVQSDCTER  390

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDY  622
            AKRKAQMLLKLLR+ WP+D     DD+
Sbjct  391  AKRKAQMLLKLLRNSWPQDDFEYHDDF  417



>ref|XP_003518699.1| PREDICTED: U-box domain-containing protein 26-like [Glycine max]
Length=415

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 184/218 (84%), Gaps = 3/218 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L++ S DVR+NSAALIE V++GT SPELRA++S+ DEI++G+V +L  P+S+ RALKIG+
Sbjct  198  LTHNSFDVRVNSAALIEIVVAGTHSPELRAEVSSVDEIYDGVVDLLRSPISHPRALKIGI  257

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL K  R KAV AG    L+DRL DF+KCDAERALATVELLCRIP+GC AFA H
Sbjct  258  KALFALCLVKNTRQKAVDAGTPAVLVDRLADFEKCDAERALATVELLCRIPAGCEAFAGH  317

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVP+LVKIILKIS RATEYAAGALLS+CS SE+ QREA AAGV+TQLLLLVQSDCTER
Sbjct  318  ALTVPMLVKIILKISDRATEYAAGALLSLCSESERCQREAVAAGVLTQLLLLVQSDCTER  377

Query  542  AKRKAQMLLKLLRDCWPEDFTG-ISDDYNCSY--VVPF  646
            AKRKAQMLLKLLRD WP+D  G  SDD+ CS   VVPF
Sbjct  378  AKRKAQMLLKLLRDSWPQDSIGNNSDDFACSQVVVVPF  415



>ref|XP_003607940.1| U-box domain-containing protein [Medicago truncatula]
Length=451

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 182/211 (86%), Gaps = 0/211 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            LS+ S DVR+NSAALIE +++GT SPE+R Q+SN D I++G+V IL  P+SY RALKIG+
Sbjct  198  LSHDSFDVRVNSAALIEIIVAGTHSPEIRLQVSNVDGIYDGVVEILKNPISYPRALKIGI  257

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ RH+AV+AGA   LIDRL DF+KCDAERALATVELLCR+P+GCA+FA H
Sbjct  258  KALFALCLVKQTRHRAVSAGAPVVLIDRLADFEKCDAERALATVELLCRVPAGCASFAGH  317

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            ALTVP+LVKIILKIS RATEYAAGAL+++CS SE+ QREA AAGV+TQLLLLVQSDCTER
Sbjct  318  ALTVPMLVKIILKISDRATEYAAGALMALCSESERCQREAVAAGVLTQLLLLVQSDCTER  377

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSY  634
            AKRKAQ+LLKLLRD WP+D  G SDD+   +
Sbjct  378  AKRKAQLLLKLLRDSWPQDSVGNSDDFGIWF  408



>ref|XP_010690605.1| PREDICTED: U-box domain-containing protein 26 [Beta vulgaris 
subsp. vulgaris]
Length=427

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 180/213 (85%), Gaps = 2/213 (1%)
 Frame = +2

Query  14   SVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALF  193
            S+D+R+NSAALIES+++GT+SP+LR+ I  ++EI+ G+V IL  P    RALKIGVK LF
Sbjct  215  SIDIRVNSAALIESIIAGTKSPDLRSFICTSEEIYVGVVSILTNPTPSPRALKIGVKTLF  274

Query  194  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTV  373
            ALCL+KQ+RHKA++AGAV ALI RL + DKCD ERALATVELLCR+P GC++F +HALTV
Sbjct  275  ALCLSKQHRHKAISAGAVNALISRLTELDKCDCERALATVELLCRVPQGCSSFGSHALTV  334

Query  374  PLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRK  553
            PLLVK ILK+S RATEYAAGALLS+ S+SE+ QREA  AGV+TQLLLLVQSDCTERAKRK
Sbjct  335  PLLVKTILKVSDRATEYAAGALLSLASSSERLQREAVNAGVLTQLLLLVQSDCTERAKRK  394

Query  554  AQMLLKLLRDCWPEDFT--GISDDYNCSYVVPF  646
            AQMLLKLLRD WP++ +    SDD+ CS +VPF
Sbjct  395  AQMLLKLLRDSWPDEKSIGNYSDDFYCSDIVPF  427



>ref|XP_010538612.1| PREDICTED: U-box domain-containing protein 26-like [Tarenaya 
hassleriana]
Length=434

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 178/225 (79%), Gaps = 10/225 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLS-YSRALKIG  178
            L + S++VR+N+AA+IE VL+G++S +L+  IS +  IFEG++ +L  P+S + RALK+G
Sbjct  210  LFDSSIEVRVNAAAMIEMVLTGSKSMDLKRLISGSGTIFEGVLDLLQNPISSFPRALKVG  269

Query  179  VKALFALCLAKQYRHKAVTAGAVEALIDRLQ---------DFDKCDAERALATVELLCRI  331
            +KALFALCL K  RH A++AGA   L+DRL          DFD+C  ERALATVELLCRI
Sbjct  270  IKALFALCLVKHTRHLAISAGAPAVLVDRLAAGLVDRIAADFDRCATERALATVELLCRI  329

Query  332  PSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLL  511
            P GC+AFA HALTVP+LVK IL++S RATEYAAGALL +CSA+E  +REAAAAGV+TQLL
Sbjct  330  PVGCSAFAEHALTVPVLVKTILRVSDRATEYAAGALLGLCSAAEHCRREAAAAGVVTQLL  389

Query  512  LLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            LLVQSDCTERAKRKAQMLLKLLRD WP+D  GISD++  S + PF
Sbjct  390  LLVQSDCTERAKRKAQMLLKLLRDSWPDDSLGISDEFGLSEIAPF  434



>ref|XP_002894216.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70475.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=421

 Score =   256 bits (655),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 178/216 (82%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+++R+N+AALIE VL+G++S +L+  IS +D IFEG++ +L  P+S  RALKIG+
Sbjct  206  LFDSSIEIRVNAAALIEMVLTGSKSMDLKLIISGSDSIFEGVLDLLKNPISSRRALKIGI  265

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER LATVELLCR+P GCAAF  
Sbjct  266  KAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGE  325

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EAAAAG++TQLLLLVQSDCTE
Sbjct  326  HALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTE  385

Query  539  RAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            RAKRKAQMLLKLLRD WP+D T  SDD+N S V PF
Sbjct  386  RAKRKAQMLLKLLRDSWPDDSTVNSDDFNRSEVAPF  421



>ref|NP_175400.1| U-box domain-containing protein 26 [Arabidopsis thaliana]
 sp|Q9FXA4.1|PUB26_ARATH RecName: Full=U-box domain-containing protein 26; AltName: Full=Plant 
U-box protein 26 [Arabidopsis thaliana]
 gb|AAG13057.1|AC011807_16 Hypothetical protein [Arabidopsis thaliana]
 gb|ABI93922.1| At1g49780 [Arabidopsis thaliana]
 gb|AEE32475.1| U-box domain-containing protein 26 [Arabidopsis thaliana]
Length=421

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 177/216 (82%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+++R+N+AALIE VL+G +S +L+  IS +D IFEG++ +L  P+S  RALKIG+
Sbjct  206  LFDSSIEIRVNAAALIEMVLTGAKSMDLKLIISGSDSIFEGVLDLLKNPISSRRALKIGI  265

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER LATVELLCR+P GCAAF  
Sbjct  266  KAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGE  325

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EAAAAG++TQLLLLVQSDCTE
Sbjct  326  HALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTE  385

Query  539  RAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            RAKRKAQMLLKLLRD WP+D T  SDD+N S V PF
Sbjct  386  RAKRKAQMLLKLLRDSWPDDSTVHSDDFNRSEVAPF  421



>dbj|BAC42960.1| unknown protein [Arabidopsis thaliana]
Length=421

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 176/216 (81%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+++R+N+AALIE VL+G +S +L+  IS +D IFEG++ +L  P+S  RALKIG+
Sbjct  206  LFDSSIEIRVNAAALIEMVLTGAKSMDLKLIISGSDSIFEGVLDLLKNPISSRRALKIGI  265

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KA+FALCL KQ RH A++AG    LIDRL  DFD+CD ER LATVELLCR+P GCAAF  
Sbjct  266  KAIFALCLVKQTRHLAISAGVPGILIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGE  325

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EAAAAG++TQLLLLVQSDCTE
Sbjct  326  HALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTE  385

Query  539  RAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            RAKRKAQMLLKLLRD WP+D T  SDD+N S V PF
Sbjct  386  RAKRKAQMLLKLLRDSWPDDSTVHSDDFNRSEVAPF  421



>ref|XP_010500528.1| PREDICTED: U-box domain-containing protein 26-like [Camelina 
sativa]
Length=422

 Score =   252 bits (643),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 178/217 (82%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+++R+N+AAL+E VL+G++S +L+  IS +D IFEG++ +L  P+S  RALKIG+
Sbjct  206  LFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISGSDSIFEGVLDLLRNPISSRRALKIGI  265

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER LATVELLCR+P GCAAF  
Sbjct  266  KAIFALCLVKQTRHLAISAGAAGILIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGE  325

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EAAAAG++TQLLLLVQSDCTE
Sbjct  326  HALTVPLMVKTILRVSDRATEYAAGALLALCTAEERFRDEAAAAGLVTQLLLLVQSDCTE  385

Query  539  RAKRKAQMLLKLLRDCWPEDFTGI-SDDYNCSYVVPF  646
            RAKRKAQMLLKLLRD WP+D + + SDD+  + V PF
Sbjct  386  RAKRKAQMLLKLLRDSWPDDSSTVNSDDFGRTEVAPF  422



>ref|XP_010461826.1| PREDICTED: U-box domain-containing protein 26 [Camelina sativa]
Length=422

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 178/217 (82%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+++R+N+AAL+E VL+G++S +L+  IS +D IFEG++ +L  P+S  RALKIG+
Sbjct  206  LFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISGSDSIFEGVLDLLRNPISSRRALKIGI  265

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER LATVELLCR+P GCAAF  
Sbjct  266  KAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGE  325

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EAAAAG++TQLLLLVQSDCTE
Sbjct  326  HALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTE  385

Query  539  RAKRKAQMLLKLLRDCWPEDFTGI-SDDYNCSYVVPF  646
            RAKRKAQMLLKLLRD WP+D + + SDD+  + V PF
Sbjct  386  RAKRKAQMLLKLLRDSWPDDSSTVNSDDFGRTEVAPF  422



>ref|XP_006306175.1| hypothetical protein CARUB_v10011740mg [Capsella rubella]
 gb|EOA39073.1| hypothetical protein CARUB_v10011740mg [Capsella rubella]
Length=422

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 176/216 (81%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+++R+N+AALIE VL+G++S +L+  IS +D IF G++ +L  P+S  RALKIG+
Sbjct  207  LFDSSIEIRVNAAALIEMVLTGSKSMDLKLIISGSDSIFVGVLDLLKNPISSRRALKIGI  266

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER LATVELLCR+P GCAAF  
Sbjct  267  KAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGE  326

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPL+VK IL++S RATEYAAGALL++C+A E+ + EAAAAG++TQLLLLVQSDCTE
Sbjct  327  HALTVPLMVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTE  386

Query  539  RAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            RAKRKAQMLLKLLRD WP+D T  SDD+  + V PF
Sbjct  387  RAKRKAQMLLKLLRDSWPDDSTANSDDFARTEVAPF  422



>ref|XP_009145797.1| PREDICTED: U-box domain-containing protein 25 [Brassica rapa]
 ref|XP_009145799.1| PREDICTED: U-box domain-containing protein 25 [Brassica rapa]
Length=422

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 168/219 (77%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL---SYSRALK  172
            L + S++ R+N+AALIE V++GT++ +++  +  ++ IFEG++ +L  P    S  RALK
Sbjct  204  LFDSSIETRVNAAALIEMVVTGTKAADIKGTVLTSECIFEGVIDLLRNPTVTSSPRRALK  263

Query  173  IGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAA  349
            IGVKALFALCL K  RH AV++GA E LIDRL    D+CD ERALATVELLCR P GCAA
Sbjct  264  IGVKALFALCLVKNTRHLAVSSGAPEILIDRLAAGLDRCDTERALATVELLCRTPEGCAA  323

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  529
            F  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EA AAGV+ QLLL+VQS+
Sbjct  324  FGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAVAAGVVVQLLLMVQSE  383

Query  530  CTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            CTERAKRK Q LLKLLRD WP+     SDD+ CS VVPF
Sbjct  384  CTERAKRKGQKLLKLLRDSWPDYSFANSDDFGCSEVVPF  422



>ref|XP_006393215.1| hypothetical protein EUTSA_v10011515mg [Eutrema salsugineum]
 gb|ESQ30501.1| hypothetical protein EUTSA_v10011515mg [Eutrema salsugineum]
Length=422

 Score =   249 bits (635),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 177/217 (82%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSR-ALKIG  178
            L + S++VR+N+AALIE VL+G++S +L+  IS +D +FEG++ +L  P+S SR ALKIG
Sbjct  206  LFDSSIEVRVNAAALIEMVLTGSKSTDLKLVISGSDSVFEGVLDLLKNPISSSRRALKIG  265

Query  179  VKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFA  355
            +KALFALCL KQ RH A++AGA   LIDRL  DFD+CD ER LATVELLCR+P GC+ F 
Sbjct  266  IKALFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERGLATVELLCRLPEGCSGFG  325

Query  356  AHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCT  535
             HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAAAAG++TQLLLLVQS+CT
Sbjct  326  EHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSECT  385

Query  536  ERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            ERAKRKAQMLLKLLRD WP+D    SDD+  S VVPF
Sbjct  386  ERAKRKAQMLLKLLRDSWPDDTLVNSDDFGRSEVVPF  422



>emb|CDX99233.1| BnaC05g33480D [Brassica napus]
Length=421

 Score =   245 bits (625),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 169/219 (77%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL---SYSRALK  172
            L + S++ R+N+AALIE V++G+++ +++  +  ++ IFEG++ +L  P    S  RALK
Sbjct  203  LFDSSIETRVNAAALIEMVVTGSKTADIKGTVLTSECIFEGVIDLLRNPTVTSSPRRALK  262

Query  173  IGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAA  349
            IGVKALFALCLAK  R  AV++GA E LIDRL    D+CDAERALATVELLCR   GCAA
Sbjct  263  IGVKALFALCLAKNTRRIAVSSGAPEILIDRLAAGLDRCDAERALATVELLCRTAEGCAA  322

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  529
            F  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EA AAGV+ QLLL+VQS+
Sbjct  323  FGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWRDEAVAAGVVVQLLLMVQSE  382

Query  530  CTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            CTERAKRKAQ LLKLLRD WP+     SDD+ CS VVPF
Sbjct  383  CTERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  421



>ref|XP_006847114.1| hypothetical protein AMTR_s00017p00223570 [Amborella trichopoda]
 gb|ERN08695.1| hypothetical protein AMTR_s00017p00223570 [Amborella trichopoda]
Length=420

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 164/215 (76%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+DVR N+AA++E+ LS  R  E RA I   D +   +V +L  PL++ RALK+ V
Sbjct  209  LVHASLDVRANTAAIVEAALSSGR--ESRAIIGATDGLIPALVNLLREPLAHPRALKLAV  266

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            K+LF+LCLAK  R  A+ AGA  AL++RL D D+CDAERALAT+ELLCR P+GCAAF AH
Sbjct  267  KSLFSLCLAKPNRELAIEAGAASALVERLVDLDRCDAERALATIELLCRTPAGCAAFEAH  326

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
            AL VPLLVK+ILK+S RATE AAGALL++C+ SE  Q+EA   GV+TQLLLLVQS+CT R
Sbjct  327  ALAVPLLVKMILKVSDRATESAAGALLAVCATSEATQKEAVTVGVVTQLLLLVQSECTAR  386

Query  542  AKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            AKRKAQ+LLKLLRD WP++    S DY CS +VPF
Sbjct  387  AKRKAQLLLKLLRDAWPDESVANS-DYACSDIVPF  420



>emb|CDY16513.1| BnaA08g02540D [Brassica napus]
Length=423

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AAL+E VL+G++S +L+  IS +  +FEG++ +L   +S  RALKIG+
Sbjct  208  LFDSSIENRVNAAALVEMVLTGSKSTDLKMIISGSGSVFEGVMDLLRSSVSSRRALKIGI  267

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KALFALCL KQ RH A++AGA   LIDRL  DFD+CD ER LATVELLCR+P GCAAF  
Sbjct  268  KALFALCLVKQTRHLAISAGAPGTLIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGE  327

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAAAAG++TQLLLLVQSDCTE
Sbjct  328  HALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTE  387

Query  539  RAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            RAKRKAQMLLKLLRD WP+D    SD++  S V PF
Sbjct  388  RAKRKAQMLLKLLRDSWPDDTLVNSDEFGRSEVAPF  423



>ref|XP_002518745.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF43670.1| Spotted leaf protein, putative [Ricinus communis]
Length=420

 Score =   244 bits (622),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 155/177 (88%), Gaps = 1/177 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLS-YSRALKIG  178
            L + S+++R+NSAALIE+V++GT+S +LRAQ SN DEI EG++ +L  P+S Y RALKIG
Sbjct  198  LFHSSIEIRVNSAALIETVIAGTKSSDLRAQFSNVDEIVEGVIELLKRPISNYPRALKIG  257

Query  179  VKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAA  358
            +KALFALCL KQ RHKAV+AGAVE LIDRL DFDKCDAERALAT+ELLCR+P G A FA 
Sbjct  258  IKALFALCLVKQTRHKAVSAGAVETLIDRLADFDKCDAERALATIELLCRVPEGVAEFAE  317

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  529
            HALTVPLLVK ILKIS RATEYAAGALL++C+ASE++QREA +AG++TQLLLLVQSD
Sbjct  318  HALTVPLLVKTILKISDRATEYAAGALLALCTASEKSQREAVSAGILTQLLLLVQSD  374



>emb|CDY59286.1| BnaCnng34640D [Brassica napus]
Length=423

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AAL+E VL+G++S +L+  IS +  +FEG++ +L   +S  RALKIG+
Sbjct  208  LFDSSIENRVNAAALVEMVLTGSKSTDLKMIISGSGSVFEGVMDLLRSSVSSRRALKIGI  267

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KALFALCL KQ RH A++AGA   LIDRL  DFD+CD ER LATVELLCR+P GCAAF  
Sbjct  268  KALFALCLVKQTRHLAISAGAPGTLIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGE  327

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAAAAG++TQLLLLVQSDCTE
Sbjct  328  HALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTE  387

Query  539  RAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            RAKRKAQMLLKLLRD WP+D     D++  S VVPF
Sbjct  388  RAKRKAQMLLKLLRDSWPDDTLVNDDEFGRSEVVPF  423



>ref|XP_009107285.1| PREDICTED: U-box domain-containing protein 26 [Brassica rapa]
Length=472

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AAL+E VL+G++S +L+  IS +  +FEG++ +L   +S  RALKIG+
Sbjct  257  LFDSSIENRVNAAALVEMVLTGSKSTDLKMIISGSGSVFEGVMDLLRSSVSSRRALKIGI  316

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KALFALCL KQ RH A++AGA   LIDRL  DFD+CD ER LATVELLCR+P GCAAF  
Sbjct  317  KALFALCLVKQTRHLAISAGAPGTLIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGE  376

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAAAAG++TQLLLLVQSDCTE
Sbjct  377  HALTVPLLVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTE  436

Query  539  RAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            RAKRKAQMLLKLLRD WP+D    SD++  S V PF
Sbjct  437  RAKRKAQMLLKLLRDSWPDDTLVNSDEFGRSEVAPF  472



>ref|XP_009111906.1| PREDICTED: U-box domain-containing protein 25-like [Brassica 
rapa]
Length=417

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 168/218 (77%), Gaps = 8/218 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY--SRALKI  175
            L + SV+ R+N+AALIE  ++G++       +S+++ IFEG++ +L  P S    RALKI
Sbjct  205  LFDSSVETRVNAAALIEMAVTGSKE-----TVSSSESIFEGVLDLLRNPASSYPRRALKI  259

Query  176  GVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAF  352
            G+KALFALCL+K  RH AV+AGA E LIDRL    D+CD ERALATVE+LCR P GCAAF
Sbjct  260  GIKALFALCLSKNTRHVAVSAGAPEILIDRLAAGLDRCDTERALATVEILCRSPEGCAAF  319

Query  353  AAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDC  532
              HALTVP+LVK IL++S RATEYAAGALL++C+A E+ + EAAAAGV+ QLLL+VQS+C
Sbjct  320  GEHALTVPVLVKTILRVSDRATEYAAGALLALCTAEERWRDEAAAAGVVVQLLLMVQSEC  379

Query  533  TERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            TERAKRKAQ LLKLLRD WP+     SDD+ CS VVPF
Sbjct  380  TERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  417



>gb|ABV89622.1| U-box domain-containing protein [Brassica rapa]
Length=417

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 168/218 (77%), Gaps = 8/218 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY--SRALKI  175
            L + SV+ R+N+AALIE  ++G++       +S+++ IFEG++ +L  P S    RALKI
Sbjct  205  LFDSSVETRVNAAALIEMAVTGSKE-----TVSSSESIFEGVLDLLRNPASSYPRRALKI  259

Query  176  GVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAF  352
            G+KALFALCL+K  RH AV+AGA E LIDRL    D+CD ERALATVE+LCR P GCAAF
Sbjct  260  GIKALFALCLSKNTRHVAVSAGAPEILIDRLAAGLDRCDTERALATVEILCRSPEGCAAF  319

Query  353  AAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDC  532
              HALTVP+LVK IL++S RATEYAAGALL++C+A E+ + EAAAAGV+ QLLL+VQS+C
Sbjct  320  GEHALTVPVLVKTILRVSDRATEYAAGALLALCTAEERWRDEAAAAGVVVQLLLMVQSEC  379

Query  533  TERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            TERAKRKAQ LLKLLRD WP+     SDD+ CS VVPF
Sbjct  380  TERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  417



>ref|XP_006299353.1| hypothetical protein CARUB_v10015518mg [Capsella rubella]
 gb|EOA32251.1| hypothetical protein CARUB_v10015518mg [Capsella rubella]
Length=425

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 174/223 (78%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AALIE V +GT+S +L    SN++ +FEG++ +L  P+S  RALKIG+
Sbjct  204  LFDSSIETRVNAAALIEIVSTGTKSADLVGMFSNSESVFEGVLDLLRNPISSRRALKIGI  263

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KALFALCLAKQ RH A+TAGA E LIDRL  DFD+CD ERALATVELLCR P GCAAF  
Sbjct  264  KALFALCLAKQTRHLAITAGAPEILIDRLAADFDRCDTERALATVELLCRTPEGCAAFGE  323

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAA AGV+ QLLL+VQS+CTE
Sbjct  324  HALTVPLLVKTILRVSDRATEYAAGALLTLCTAEERWREEAAGAGVVVQLLLMVQSECTE  383

Query  539  RAKRKAQMLLKLLRDCWPE-------DFTGISDDYNCSYVVPF  646
            RAK+KAQ LLKLLR+ WP+        F   SDD+ CS VVPF
Sbjct  384  RAKKKAQKLLKLLRNSWPDYNHHNNSSFAN-SDDFACSQVVPF  425



>emb|CDY50158.1| BnaA01g26180D [Brassica napus]
Length=417

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 168/218 (77%), Gaps = 8/218 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY--SRALKI  175
            L + SV+ R+N+AALIE  ++G++       +S+++ IFEG++ +L  P S    RALKI
Sbjct  205  LFDSSVETRVNAAALIEMAVTGSKE-----TVSSSESIFEGVLDLLRNPASSYPRRALKI  259

Query  176  GVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAF  352
            G+KALFALCL+KQ R  AV+AGA E LIDRL    D+CD ERALATVE+LCR P GCAAF
Sbjct  260  GIKALFALCLSKQTRRIAVSAGAPEILIDRLAAGLDRCDTERALATVEILCRSPEGCAAF  319

Query  353  AAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDC  532
              HALTVP+LVK IL++S RATEYAAGALL++C+A E+ + EAAAAGV+ QLLL+VQS+C
Sbjct  320  GEHALTVPVLVKTILRVSDRATEYAAGALLALCTAEERWRDEAAAAGVVVQLLLMVQSEC  379

Query  533  TERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            TERAKRKAQ LLKLLRD WP+     SDD+ CS VVPF
Sbjct  380  TERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  417



>emb|CDX92328.1| BnaA05g20790D [Brassica napus]
Length=423

 Score =   241 bits (615),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 166/220 (75%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPEL-RAQISNADEIFEGIVGILNCPL---SYSRAL  169
            L + S++ R+N+AALIE V++GT++ ++ +  +   + IFEG++ +L  P    S  RAL
Sbjct  204  LFDSSIETRVNAAALIEMVVTGTKTADIIKGTVLTTEYIFEGVIDLLRNPTVTSSPRRAL  263

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCA  346
            KIGVKALFALCL K  R  AV++GA E LIDRL    D+CD ERALATVELLCR P GC 
Sbjct  264  KIGVKALFALCLVKNTRQLAVSSGAPEILIDRLAAGLDRCDTERALATVELLCRTPEGCV  323

Query  347  AFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQS  526
            AF  HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EA AAGV+ QLLL+VQS
Sbjct  324  AFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAVAAGVVVQLLLMVQS  383

Query  527  DCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            +CTERAKRKAQ LLKLLRD WP+     S+D+ CS VVPF
Sbjct  384  ECTERAKRKAQKLLKLLRDSWPDYSFANSNDFGCSEVVPF  423



>gb|KFK35978.1| hypothetical protein AALP_AA4G062500 [Arabis alpina]
Length=432

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 167/212 (79%), Gaps = 2/212 (1%)
 Frame = +2

Query  17   VDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSR-ALKIGVKALF  193
            +D R+N+AALIE VL+G +S +L+  IS +D +FEG++ +L  P S SR ALKIG+K++F
Sbjct  221  IDNRVNAAALIEMVLTGVKSHDLKLMISGSDSVFEGVLDLLKNPNSSSRRALKIGIKSVF  280

Query  194  ALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAAHALT  370
            ALCL KQ RH AV+AG    LIDRL  DFD+CD ER LATVELLCR+P GCAAF+ HALT
Sbjct  281  ALCLVKQSRHLAVSAGVPAVLIDRLAADFDRCDTERGLATVELLCRLPEGCAAFSEHALT  340

Query  371  VPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKR  550
            V  LVK IL++S RATEYAAGALL++C+A E+ + EA   G++TQLLLLVQSDCTERAKR
Sbjct  341  VDFLVKTILRVSERATEYAAGALLALCTAEERCREEAVTVGLVTQLLLLVQSDCTERAKR  400

Query  551  KAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            KAQMLLKLLRD WPE+  G SD++  S V PF
Sbjct  401  KAQMLLKLLRDSWPENNLGNSDEFGRSEVAPF  432



>ref|XP_006406505.1| hypothetical protein EUTSA_v10022190mg [Eutrema salsugineum]
 gb|ESQ47958.1| hypothetical protein EUTSA_v10022190mg [Eutrema salsugineum]
Length=420

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 174/218 (80%), Gaps = 3/218 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY--SRALKI  175
            L + S++ R+N+AALIE V +G++SP+L+   SN++ +FEG++ +L  P+S    RALKI
Sbjct  203  LFDSSLETRVNAAALIEMVSTGSKSPDLKGMFSNSESVFEGVLDLLRNPISSYPRRALKI  262

Query  176  GVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAF  352
            G+K LFALCL K  RH AV+AGA E LIDRL  DFD+CD ERALATVELLCR+P GCAAF
Sbjct  263  GIKTLFALCLPKNTRHIAVSAGAPEILIDRLAADFDRCDTERALATVELLCRLPEGCAAF  322

Query  353  AAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDC  532
              HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAAAAGV+ QLLL+VQS+C
Sbjct  323  GEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWRDEAAAAGVVVQLLLIVQSEC  382

Query  533  TERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            TERAK+KAQ LLKLLRD WP+     SDD+ CS VVPF
Sbjct  383  TERAKKKAQKLLKLLRDSWPDYSFANSDDFVCSQVVPF  420



>emb|CDX95458.1| BnaC01g33500D [Brassica napus]
Length=417

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 167/218 (77%), Gaps = 8/218 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY--SRALKI  175
            L + SV+ R+N+AALIE  ++G++       +SN++ IFEG++ +L  P S    RALKI
Sbjct  205  LFDSSVETRVNAAALIEMAVTGSKE-----TVSNSESIFEGVLDLLRNPASSYPRRALKI  259

Query  176  GVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAF  352
            G+KALFALCL+K  RH AV+AGA E LIDRL    D+CD ERALATVE+LCR   GCAAF
Sbjct  260  GIKALFALCLSKNTRHVAVSAGAPEILIDRLAAGLDRCDTERALATVEILCRSLEGCAAF  319

Query  353  AAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDC  532
              HALTVP+LVK IL++S RATEYAAGALL++C+A ++ + EAAAAGV+ QLLL+VQS+C
Sbjct  320  GEHALTVPVLVKTILRVSDRATEYAAGALLALCTAEDRWRDEAAAAGVVVQLLLMVQSEC  379

Query  533  TERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            TERAKRKAQ LLKLLRD WP+     SDD+ CS VVPF
Sbjct  380  TERAKRKAQKLLKLLRDSWPDYSFANSDDFACSEVVPF  417



>ref|XP_010468287.1| PREDICTED: U-box domain-containing protein 25-like, partial [Camelina 
sativa]
Length=412

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 170/222 (77%), Gaps = 8/222 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AALIE V +GT+S + +   SN + +FEG++ +L  P+S  RALKIG+
Sbjct  192  LFDSSIETRVNAAALIEIVTTGTKSEDPKGTFSNYESVFEGVLDLLRNPISSRRALKIGI  251

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KALF+LC AKQ RH A+ AGA E LIDRL  DFD+CD ERALATVELLCR P GCAAF  
Sbjct  252  KALFSLCSAKQTRHLAINAGAPEILIDRLAADFDRCDTERALATVELLCRTPEGCAAFGE  311

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPLLVK IL++S RATEYAAGALL+IC+  E+ + EAA AGV+ QLLL+VQS+CTE
Sbjct  312  HALTVPLLVKTILRVSDRATEYAAGALLAICTEEERWREEAAGAGVVVQLLLMVQSECTE  371

Query  539  RAKRKAQMLLKLLRDCWPE------DFTGISDDYNCSYVVPF  646
            RAK+KAQ LLKLLRD WP+       F   SDD+ CS VVPF
Sbjct  372  RAKKKAQKLLKLLRDSWPDYNNHNSSFAN-SDDFACSQVVPF  412



>dbj|BAF01749.1| hypothetical protein [Arabidopsis thaliana]
Length=419

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 172/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AALIE V +GT+S +L+  ISN++ +FEG++ +L  P+S  RALKIG+
Sbjct  202  LFDSSIETRVNAAALIEIVSTGTKSADLKGSISNSESVFEGVLDLLRNPISSRRALKIGI  261

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            K LFALC  K  RH A+TAGA E LIDRL  DFD+CD ERALATVELLCR P GCAAF  
Sbjct  262  KTLFALCSVKSTRHIAITAGAPEILIDRLAADFDRCDTERALATVELLCRTPEGCAAFGE  321

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAA AGV+ QLLL+VQS+CTE
Sbjct  322  HALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAAGAGVVVQLLLMVQSECTE  381

Query  539  RAKRKAQMLLKLLRDCWPEDFTGI--SDDYNC-SYVVPF  646
            RAK+KAQ LLKLLRD WP D+     SDD+ C S VVPF
Sbjct  382  RAKKKAQKLLKLLRDSWP-DYNSFANSDDFGCSSQVVPF  419



>ref|NP_566632.1| U-box domain-containing protein 25 [Arabidopsis thaliana]
 sp|Q9LT79.1|PUB25_ARATH RecName: Full=U-box domain-containing protein 25; AltName: Full=Plant 
U-box protein 25 [Arabidopsis thaliana]
 dbj|BAB02462.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM63504.1| unknown [Arabidopsis thaliana]
 gb|ABG25071.1| At3g19380 [Arabidopsis thaliana]
 gb|AEE76233.1| U-box domain-containing protein 25 [Arabidopsis thaliana]
Length=421

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 140/219 (64%), Positives = 172/219 (79%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AALIE V +GT+S +L+  ISN++ +FEG++ +L  P+S  RALKIG+
Sbjct  204  LFDSSIETRVNAAALIEIVSTGTKSADLKGSISNSESVFEGVLDLLRNPISSRRALKIGI  263

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            K LFALC  K  RH A+TAGA E LIDRL  DFD+CD ERALATVELLCR P GCAAF  
Sbjct  264  KTLFALCSVKSTRHIAITAGAPEILIDRLAADFDRCDTERALATVELLCRTPEGCAAFGE  323

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPLLVK IL++S RATEYAAGALL++C+A E+ + EAA AGV+ QLLL+VQS+CTE
Sbjct  324  HALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAAGAGVVVQLLLMVQSECTE  383

Query  539  RAKRKAQMLLKLLRDCWPEDFTGI--SDDYNC-SYVVPF  646
            RAK+KAQ LLKLLRD WP D+     SDD+ C S VVPF
Sbjct  384  RAKKKAQKLLKLLRDSWP-DYNSFANSDDFGCSSQVVPF  421



>ref|XP_010466083.1| PREDICTED: U-box domain-containing protein 25 [Camelina sativa]
Length=424

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 170/222 (77%), Gaps = 8/222 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AALIE V +GT+S + +   SN + +FEG++ +L  P+S  RALKIG+
Sbjct  204  LFDSSIETRVNAAALIEIVTTGTKSEDPKGTFSNYESVFEGVLDLLRNPISSRRALKIGI  263

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KALF+LC AKQ RH A+ AGA E LIDRL  DFD+CD ERALATVELLCR P GCAAF  
Sbjct  264  KALFSLCSAKQTRHLAINAGAPEILIDRLAADFDRCDTERALATVELLCRTPEGCAAFGE  323

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPLLVK IL++S RATEYAAGALL+IC+  E+ + EAA AGV+ QLLL+VQS+CTE
Sbjct  324  HALTVPLLVKTILRVSDRATEYAAGALLAICTEEERWREEAAGAGVVVQLLLMVQSECTE  383

Query  539  RAKRKAQMLLKLLRDCWPE------DFTGISDDYNCSYVVPF  646
            RAK+KAQ LLKLLRD WP+       F   SDD+ CS VVPF
Sbjct  384  RAKKKAQKLLKLLRDSWPDYNNHNSSFAN-SDDFACSQVVPF  424



>ref|XP_002885309.1| hypothetical protein ARALYDRAFT_479456 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61568.1| hypothetical protein ARALYDRAFT_479456 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 174/221 (79%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRA--QISNADEIFEGIVGILNCPLSYSRALKI  175
            L + S+D R+N+AALIE V +GT+S +L+    ISN++ +FEG++ +L  P+S  RALKI
Sbjct  178  LFDSSIDTRVNAAALIEIVSTGTKSADLKGMFSISNSESVFEGVLDLLRNPISSRRALKI  237

Query  176  GVKALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAF  352
            G+K LFALCL K  RH A+TAGA E LIDRL  DFD+CD ERALATVELLCR P GCAAF
Sbjct  238  GIKTLFALCLVKSTRHIAITAGAPEILIDRLAADFDRCDTERALATVELLCRSPEGCAAF  297

Query  353  AAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDC  532
              HALTVPLLVK IL++S R+TEYAAGALL++C+A E+ + EAAAAGV+ QLLL+VQS+C
Sbjct  298  GEHALTVPLLVKTILRVSDRSTEYAAGALLALCTAEERWREEAAAAGVVVQLLLMVQSEC  357

Query  533  TERAKRKAQMLLKLLRDCWPEDFTGI--SDDYNC-SYVVPF  646
            TERAK+KAQ LLKLLRD WP D+     SDD+ C S VVPF
Sbjct  358  TERAKKKAQKLLKLLRDSWP-DYNSFANSDDFGCSSQVVPF  397



>ref|XP_010507691.1| PREDICTED: U-box domain-containing protein 25-like [Camelina 
sativa]
Length=425

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 169/223 (76%), Gaps = 9/223 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AALIE V +GT+S + +   SN + +FEG++ +L  P+S  RALKIG+
Sbjct  204  LFDSSIETRVNAAALIEIVSTGTKSEDPKGTFSNYESVFEGVLNLLRNPISSRRALKIGI  263

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQ-DFDKCDAERALATVELLCRIPSGCAAFAA  358
            KALF+LC AKQ RH A+ AGA E LIDRL  DFD+CD ERALATVELLCR P GCAAF  
Sbjct  264  KALFSLCSAKQTRHLAINAGAPEILIDRLAADFDRCDTERALATVELLCRTPEGCAAFGE  323

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
            HALTVPLLVK IL++S RATEYAAGALL+IC+  E+ + EAA AGV+ QLLL+VQS+CTE
Sbjct  324  HALTVPLLVKTILRVSDRATEYAAGALLAICTEEERWREEAAGAGVVVQLLLMVQSECTE  383

Query  539  RAKRKAQMLLKLLRDCWPE-------DFTGISDDYNCSYVVPF  646
            RAK+KAQ LLKLLRD WP+        F   SDD+ CS V PF
Sbjct  384  RAKKKAQKLLKLLRDSWPDYNNHNNNSFAN-SDDFACSQVAPF  425



>gb|KFK39278.1| hypothetical protein AALP_AA3G223600 [Arabis alpina]
Length=418

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 173/218 (79%), Gaps = 3/218 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY--SRALKI  175
            L + S++ R+N+AALIE VL+GT+S +L+  ISN++ +F+G++ IL  P+S    RALKI
Sbjct  201  LYDSSIETRVNAAALIEMVLTGTKSSDLKEAISNSESVFQGVLDILRNPISSYPRRALKI  260

Query  176  GVKALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDKCDAERALATVELLCRIPSGCAAF  352
            G+KALFALCL+K  RH AV +GA E LIDRL  DFD+C+ ERALATVELLCR P GCAAF
Sbjct  261  GIKALFALCLSKTARHIAVFSGAPEILIDRLASDFDRCETERALATVELLCRSPEGCAAF  320

Query  353  AAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDC  532
              HALTVPLLVK IL++S RATEYAAGALL+IC+A E+ + EAAAAGV+ QLLL+VQS+C
Sbjct  321  GDHALTVPLLVKTILRVSDRATEYAAGALLAICTAEERWREEAAAAGVVVQLLLMVQSEC  380

Query  533  TERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            TERAK+KAQ LLKLLRD WP+     S  + CS VVPF
Sbjct  381  TERAKKKAQKLLKLLRDSWPDYSFANSHHFACSQVVPF  418



>gb|EYU37659.1| hypothetical protein MIMGU_mgv1a019070mg, partial [Erythranthe 
guttata]
Length=327

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+DVR+NSAA+IE+V++G RSPE R QIS +D +FEGIVGIL+ P++Y+RALK+G+
Sbjct  201  LFHSSIDVRVNSAAVIENVVAGIRSPEFRTQISCSDGVFEGIVGILSYPVAYNRALKVGI  260

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KALFALCL KQ+RHKAV AGAVEALIDRL +F+KCDAERALATVELLCR PSGCAAFA+H
Sbjct  261  KALFALCLVKQHRHKAVAAGAVEALIDRLAEFEKCDAERALATVELLCRFPSGCAAFASH  320

Query  362  ALTVPLL  382
            ALTVPLL
Sbjct  321  ALTVPLL  327



>emb|CBI32390.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +2

Query  188  LFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHAL  367
            +F L  ++  RHKAV AGAV ALIDRL DF+KCD ERALATVELLCR+P+GCAAFAAHAL
Sbjct  226  MFPLSESECARHKAVAAGAVTALIDRLADFEKCDVERALATVELLCRVPAGCAAFAAHAL  285

Query  368  TVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAK  547
            TVPLLV+ ILK+S RATEYAAGALLS+CSA+EQ+QREA +AGV+TQLLLLVQSDCTERAK
Sbjct  286  TVPLLVRKILKVSDRATEYAAGALLSLCSAAEQSQREAVSAGVVTQLLLLVQSDCTERAK  345

Query  548  RKAQMLLKLLRDCWPEDFTGISDDYNCSYV  637
            RKAQ+LLKLLRD WPED    SDD+ CS V
Sbjct  346  RKAQLLLKLLRDSWPEDSVVNSDDFGCSDV  375



>ref|XP_009416906.1| PREDICTED: U-box domain-containing protein 26 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 135/212 (64%), Gaps = 7/212 (3%)
 Frame = +2

Query  5    SNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVK  184
             +PS + R+N+AA+IESV +GTRS E RA I   D +  G+V ++  P    RA+++G++
Sbjct  206  GHPSSEARINAAAVIESVATGTRSAETRATIGGMDGVMGGLVALVEQP-GNPRAVRVGIR  264

Query  185  ALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHA  364
             L A+CLAK+ R +AV AGA  A++ R+ +    D ERALATVELLCR   G  A  A  
Sbjct  265  GLLAMCLAKENRARAVAAGAAAAVVRRMGELSSSDLERALATVELLCRGEGGREAVVAGW  324

Query  365  LTVPLLVK-----IILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  529
                  V      +  K S RA E+AAGAL+++   SE  QREA AAGV+  LLL+VQ  
Sbjct  325  GGGAAAVAALVRLMAWKASGRAAEHAAGALVAVLGGSEALQREAVAAGVVAHLLLMVQGG  384

Query  530  CTERAKRKAQMLLKLLRDCWP-EDFTGISDDY  622
            C++RAKRKAQ+LLKLLR  WP  DF   SDD+
Sbjct  385  CSDRAKRKAQLLLKLLRPAWPYRDFIANSDDF  416



>ref|XP_001778934.1| predicted protein [Physcomitrella patens]
 gb|EDQ56270.1| predicted protein [Physcomitrella patens]
Length=206

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 114/203 (56%), Gaps = 24/203 (12%)
 Frame = +2

Query  20   DVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGI-------LNCPLSYSRALKI-  175
            D R N+ +L+E +              + +E F+G +G        LN  L   + LK+ 
Sbjct  7    DARENACSLLEKL--------------SLNEAFKGTIGACSGVMEALNTTLPDEKHLKLV  52

Query  176  --GVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
                K L ALCL ++ R +AV  GAV +L++ L       AE+ALAT+ELL  I  G AA
Sbjct  53   KMATKTLLALCLLQENRFRAVEVGAVASLLEMLPRTRSATAEKALATLELLGTIEEGKAA  112

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  529
               HAL VP+LV++IL +S R TEYAAG L S+C  +   +  A A G  T+LLLL+QSD
Sbjct  113  IIDHALAVPVLVELILTVSDRGTEYAAGTLSSMCRDNMAMREAAVAHGAPTKLLLLIQSD  172

Query  530  CTERAKRKAQMLLKLLRDCWPED  598
            CT RA RKA  LLK+L   W +D
Sbjct  173  CTARANRKANQLLKVLHKLWVQD  195



>gb|ABK24171.1| unknown [Picea sitchensis]
Length=308

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 124/211 (59%), Gaps = 16/211 (8%)
 Frame = +2

Query  23   VRMNSAALIESVLSGTRSPELRAQISNADEIFEGIV-GILNCPLSYSRALKIGVKALFAL  199
            VR+N+  L+E  L          Q S    + +G++ G++    +Y    K+ +KAL AL
Sbjct  101  VRLNALLLLEKTLV--------FQPSGGHVVVKGLMEGLVRSLPNYQ---KLVIKALLAL  149

Query  200  CLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPL  379
            CL ++ R +AV AG V+A+++ L +  +  AERALAT++LLC +  G  A   HAL VPL
Sbjct  150  CLTERNRGEAVRAGVVDAILELLPNLKEVCAERALATLDLLCTVSEGRRALREHALAVPL  209

Query  380  LVKIILKISHRATEYAAGALLSICsas---eqaqreaaaaGVMTQLLLLVQSDCTERAKR  550
            L+ +ILK+S R T YA  AL +IC        A++ A  +G  TQLLLL+QSDCT RAKR
Sbjct  210  LLDMILKVSDRGTGYAVSALCAICVHEDGGIDARKNAIQSGAFTQLLLLLQSDCTSRAKR  269

Query  551  KAQMLLKLLRDCWPEDFTGISDDYNCSYVVP  643
            KA  LLK+L   W E    I D+ NC +  P
Sbjct  270  KALQLLKVLHKVWGEGSCNIPDE-NCIFSSP  299



>gb|ABK25582.1| unknown [Picea sitchensis]
Length=413

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 111/181 (61%), Gaps = 8/181 (4%)
 Frame = +2

Query  122  GIVGILNCPLSYSRAL----KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  289
            G VG+        R+L    K+ +KAL ALCL ++ R +AV AG V+A+++ L +  +  
Sbjct  225  GHVGVKGLMEGLVRSLPNYQKLVIKALLALCLTERNRGEAVRAGVVDAILELLPNLKEVC  284

Query  290  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq-  466
            AERALAT++LLC +  G  A   HAL VPLL+ +ILK+S R TEYA  AL +IC   +  
Sbjct  285  AERALATLDLLCTVSEGRRALREHALAVPLLLDMILKVSDRGTEYAVSALCAICVHEDGG  344

Query  467  --aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVV  640
              A+  A  +G  TQLLLL+QSDCT RAKRKA  LLK+L   W E    I D+ NC +  
Sbjct  345  IDARENAIQSGAFTQLLLLLQSDCTSRAKRKALQLLKVLHKVWGEGSCNIPDE-NCIFSS  403

Query  641  P  643
            P
Sbjct  404  P  404



>ref|XP_008784183.1| PREDICTED: U-box domain-containing protein 25-like [Phoenix dactylifera]
Length=416

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 145/213 (68%), Gaps = 8/213 (4%)
 Frame = +2

Query  8    NPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKA  187
            +P+++ R+++AA++E+V +G RS E RA +   + + EG+VG++    S +RA+++G++ 
Sbjct  200  HPAMEARISAAAVLEAVAAGARSAEARAAVGATEGVMEGLVGLVEEKGSSARAVRVGIRG  259

Query  188  LFALCLAKQYRHKAVTAGAVEALIDRLQDF--DKCDAERALATVELLCRIPSG-----CA  346
            LF+LCLAK+ R +AV AGA  A++ R+ D   ++ DAERALATVELLCR   G       
Sbjct  260  LFSLCLAKENRGRAVAAGAAAAVVRRIVDLAAERGDAERALATVELLCRTEGGREAVVAG  319

Query  347  AFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQS  526
            A    A    L+  +  K S RA E+AAGAL+++   SE  QREA  AGV+TQLLL+VQ 
Sbjct  320  AGGGAAAVEALVRAMAGKASERAAEHAAGALVAVVGGSECLQREAVGAGVVTQLLLMVQG  379

Query  527  DCTERAKRKAQMLLKLLRDCWP-EDFTGISDDY  622
             C++RAKRKAQ+LLKLLR  WP +D+   SDD+
Sbjct  380  GCSDRAKRKAQVLLKLLRSAWPHDDYIANSDDF  412



>ref|XP_004952703.1| PREDICTED: U-box domain-containing protein 26-like [Setaria italica]
Length=408

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 116/182 (64%), Gaps = 3/182 (2%)
 Frame = +2

Query  95   ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  274
            +  A+ + EG+V +     +++RA+++G++ LFALCLAK+ R +AV+AGA  AL  R+ +
Sbjct  228  LGAAEGVMEGLVALAE-EKAHARAVRVGIRGLFALCLAKENRPRAVSAGAASALARRVSE  286

Query  275  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILK-ISHRATEYAAGALLSIC  451
                + ERALA VE LCR   G  A  A A   P  V  +++ +S RA E+AAGAL+++ 
Sbjct  287  GGAGEPERALAAVERLCRAEGGRDAVVAGAGGGPAAVAALVRAMSGRAAEHAAGALVAVV  346

Query  452  saseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDYNC  628
              SE  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    SDD+  
Sbjct  347  GGSEALQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPTTDCIANSDDFLQ  406

Query  629  SY  634
             Y
Sbjct  407  PY  408



>dbj|BAJ97989.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=407

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 116/186 (62%), Gaps = 4/186 (2%)
 Frame = +2

Query  86   RAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDR  265
            R  +  AD + EG+V +++   + +RA+++G++ LFALCLAK+ R +AV+AGA  AL  R
Sbjct  223  RVVLGAADGVIEGLVALVD-EKANARAVRVGIRGLFALCLAKENRQRAVSAGAASALARR  281

Query  266  LQDFD-KCDAERALATVELLCRIPSGC-AAFAAHALTVPLLVKIILKISHRATEYAAGAL  439
            + +     + ERALA VE L R   G  A  +       +++ ++  +S RA E+AAGAL
Sbjct  282  VAEGGCAGELERALAAVERLSRTDGGREAVISGAGGGAAVVIALVRAMSGRAAEHAAGAL  341

Query  440  LSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISD  616
            +++   SE  Q EA  AG M+QLL++VQ  C+ERAKRKAQ LLKLLR  WP  D    SD
Sbjct  342  VAVVGGSEVLQLEAVRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSD  401

Query  617  DYNCSY  634
            D+   Y
Sbjct  402  DFLRPY  407



>ref|XP_010481065.1| PREDICTED: U-box domain-containing protein 26-like [Camelina 
sativa]
Length=361

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 85/108 (79%), Gaps = 1/108 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+++R+N+AAL+E VL+G++S +L+  IS +D IFEG++ +L  P+S  RALKIG+
Sbjct  206  LFDSSIEIRVNAAALVEMVLTGSKSTDLKLVISGSDSIFEGVLDLLRNPISSRRALKIGI  265

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDKCDAERALATVELL  322
            KA+FALCL KQ RH A++AGA   LIDRL  DFD+CD ER LATVEL+
Sbjct  266  KAIFALCLVKQTRHLAISAGAPGILIDRLAADFDRCDTERGLATVELI  313



>gb|EMS66308.1| U-box domain-containing protein 25 [Triticum urartu]
Length=407

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 116/186 (62%), Gaps = 4/186 (2%)
 Frame = +2

Query  86   RAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDR  265
            R  +  AD + EG+V +++   + +RA++IG++ LFALCLAK+ R +AV+AGA  AL  R
Sbjct  223  RVVLGAADGVIEGLVALVD-EKANARAVRIGIRGLFALCLAKENRQRAVSAGAASALARR  281

Query  266  LQDFD-KCDAERALATVELLCRIPSGCAAFAAHALT-VPLLVKIILKISHRATEYAAGAL  439
            + +     + ERALA VE L R   G  A  + A     +++ ++  +S RA E+AAGAL
Sbjct  282  VAEGGCAGELERALAAVERLSRTEGGREAVVSGAGGGAAVVIALVRAMSGRAAEHAAGAL  341

Query  440  LSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISD  616
            +++   SE  Q EA  AG M+QLL++VQ  C+ERAKRKAQ LLKLLR  WP  D    S 
Sbjct  342  VAVVGGSEGLQLEAVRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSA  401

Query  617  DYNCSY  634
            D+   Y
Sbjct  402  DFLQPY  407



>gb|EMT28323.1| U-box domain-containing protein 25 [Aegilops tauschii]
Length=407

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 116/186 (62%), Gaps = 4/186 (2%)
 Frame = +2

Query  86   RAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDR  265
            R  +  AD + EG+V +++   + +RA++IG++ +FALCLAK+ R +AV+AGA  AL  R
Sbjct  223  RVVLGAADGVIEGLVALVD-EKANARAVRIGIRGVFALCLAKENRQRAVSAGAASALARR  281

Query  266  LQDFD-KCDAERALATVELLCRIPSGCAAFAAHALT-VPLLVKIILKISHRATEYAAGAL  439
            + +     + ERALA VE L R   G  A  + A     L++ ++  +S RA E+AAGAL
Sbjct  282  VAEGGCAGELERALAAVERLSRTEGGREAVVSGAGGGAALVIALVRAMSGRAAEHAAGAL  341

Query  440  LSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISD  616
            +++   SE  Q EA  AG M+QLL++VQ  C+ERAKRKAQ LLKLLR  WP  D    S 
Sbjct  342  VAVVGGSEVLQLEAVRAGAMSQLLMMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSA  401

Query  617  DYNCSY  634
            D+   Y
Sbjct  402  DFLQPY  407



>ref|XP_001752821.1| predicted protein [Physcomitrella patens]
 gb|EDQ82325.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 102/162 (63%), Gaps = 3/162 (2%)
 Frame = +2

Query  122  GIVGILNCPLSYSRALKI---GVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  292
            G++  LN  L + + LK+     + L ALCL ++ R +A  AGAV ++++ L       A
Sbjct  414  GVLEGLNSILLHEKHLKLVKLATRTLLALCLLRENRLRAAEAGAVASILEMLPLARSAVA  473

Query  293  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  472
            E+ALAT+ELL     G AA   HAL VP+LV++ILK+S R TEYAAG L +ICS +   Q
Sbjct  474  EKALATLELLSTTEEGKAAIIDHALAVPVLVELILKVSDRGTEYAAGTLSAICSDNLAMQ  533

Query  473  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  598
              A   G  T+LLLL+QSDCT RAKRKA  LLK+L   W ++
Sbjct  534  EAAVEHGAPTKLLLLIQSDCTARAKRKANQLLKVLHKLWMQN  575



>ref|XP_009403520.1| PREDICTED: U-box domain-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 126/212 (59%), Gaps = 7/212 (3%)
 Frame = +2

Query  5    SNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVK  184
             +PS + R+N+A +IE+V +G RS E RA +   + + EG+V ++       RA ++G++
Sbjct  207  GHPSTEARINAATVIEAVAAGARSAETRAAVGGTEGVMEGLVELV-AQRGNGRAGRVGIR  265

Query  185  ALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG-----CAA  349
             LFALCLAK+ R +A+ AGA  A++ R+ +    D ERALATVELLCR   G        
Sbjct  266  GLFALCLAKENRGRALAAGAAAAVVGRVAELASSDVERALATVELLCREDGGRDAVVAGW  325

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  529
                     L+  +  K S RA E+AA  L+++   SE    EA AAGV+  LLL+VQ  
Sbjct  326  GGGAVAVAALVRVMAGKASGRAAEHAAAVLVAVLGGSEALHAEAVAAGVVAHLLLMVQGG  385

Query  530  CTERAKRKAQMLLKLLRDCWP-EDFTGISDDY  622
            C+ERAKRKAQ+LLKL R  WP  D    SDD+
Sbjct  386  CSERAKRKAQLLLKLFRSAWPRHDTISNSDDF  417



>ref|XP_001762017.1| predicted protein [Physcomitrella patens]
 gb|EDQ73121.1| predicted protein [Physcomitrella patens]
Length=587

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 94/158 (59%), Gaps = 14/158 (9%)
 Frame = +2

Query  167  LKIGVKALFALCLAKQYRHK--------------AVTAGAVEALIDRLQDFDKCDAERAL  304
            +K+  K L ALCL ++ R +              AV  GAV +L++ L       AE+ L
Sbjct  416  VKLATKTLLALCLLRENRRRFSKSYTVQLLALSRAVEVGAVASLLEMLPWVGSATAEKVL  475

Query  305  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  484
            AT+ELL  I  G AA   HAL VP+LV++ILK+S R TEYAAG L  +CS S   +  A 
Sbjct  476  ATLELLGTIEEGKAAIIDHALAVPVLVELILKVSDRGTEYAAGTLSMMCSDSIAMREAAV  535

Query  485  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPED  598
            A G  T+LLLL+QSDCT RAKRKA  LLK+L   W +D
Sbjct  536  AHGAPTKLLLLIQSDCTARAKRKASQLLKVLHKLWVQD  573



>ref|XP_009406118.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
25-like [Musa acuminata subsp. malaccensis]
Length=421

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 105/160 (66%), Gaps = 6/160 (4%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            RA+++G++ LFALCLAK+ R +AV AGA  A++ RL +    DAERALATVELLCR+  G
Sbjct  258  RAVRVGIRGLFALCLAKENRGRAVAAGAAAAVVGRLGELASSDAERALATVELLCRVEGG  317

Query  341  CAAFAA-----HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQ  505
              A  A      A  V L+  +  K S RA E+AAGALL++   SE  Q  A AAGV+  
Sbjct  318  REAVVAGWGGGDAAVVALVRAMAGKASWRAAEHAAGALLAVLGPSEALQMVAVAAGVVGH  377

Query  506  LLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTGISDDY  622
            LL+LVQ  C++RA RKAQ+LLKLLR  WP  D    SDD+
Sbjct  378  LLMLVQGGCSDRAXRKAQLLLKLLRSAWPHYDSIANSDDF  417



>ref|XP_002974135.1| ubiquitin-protein ligase, PUB26, partial [Selaginella moellendorffii]
 gb|EFJ25090.1| ubiquitin-protein ligase, PUB26, partial [Selaginella moellendorffii]
Length=405

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 126/201 (63%), Gaps = 8/201 (4%)
 Frame = +2

Query  14   SVDVRMNSAALIESVLSGTRSPEL-RAQISNADEIFEGIVGILNCPLS--YSRALKIGVK  184
            S+D R+N+A L+E + S   +PE  +  +     + EG+V +L    S    RA K GVK
Sbjct  207  SMDARINAAVLVEKIASD--APEAAKLAMGQIPGLLEGLVDLLRGDHSAVSPRAPKSGVK  264

Query  185  ALFALCL--AKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAA  358
            ALF+LCL  A     +AV+AGA  AL++ L      DA+R L  +ELLCR  +G    A 
Sbjct  265  ALFSLCLCSAASNSERAVSAGAAAALVEHLPAAQHGDADRTLGALELLCRTRAGREVVAQ  324

Query  359  HALTVPLLVKIIL-KISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCT  535
            HAL VP LV  I  + S +A E AAG LL++CS SE+ Q  AA AGV+TQLLLL+QSDCT
Sbjct  325  HALAVPALVAAIQCRSSFQAAECAAGTLLAVCSGSEEVQLAAAEAGVLTQLLLLIQSDCT  384

Query  536  ERAKRKAQMLLKLLRDCWPED  598
            +RAKRKA  LLKLLR  W ED
Sbjct  385  DRAKRKAVELLKLLRRWWAED  405



>ref|XP_003575105.1| PREDICTED: U-box domain-containing protein 25-like [Brachypodium 
distachyon]
Length=412

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 116/186 (62%), Gaps = 3/186 (2%)
 Frame = +2

Query  86   RAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDR  265
            R  +  A+ + EG+V +++   + +RA+++G++ LFALCLAK+ R +AV AGA  AL  R
Sbjct  227  RVVLGVAEGVMEGLVALVDEKGNNARAVRVGIRGLFALCLAKENRPRAVAAGAASALARR  286

Query  266  LQDFD-KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILK-ISHRATEYAAGAL  439
            + +     + ERALA VE LCR   G  A  + A      V  +++ +S RA E+AAGAL
Sbjct  287  VAEGGCAGEPERALAAVERLCRTEGGRDAVVSGAGGGATAVTALVRAMSGRAAEHAAGAL  346

Query  440  LSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISD  616
            +++   SE  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    SD
Sbjct  347  VAVVGGSEALQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPTTDSMANSD  406

Query  617  DYNCSY  634
            D+   Y
Sbjct  407  DFLNPY  412



>ref|XP_002968838.1| ubiquitin-protein ligase, PUB26 [Selaginella moellendorffii]
 gb|EFJ29954.1| ubiquitin-protein ligase, PUB26 [Selaginella moellendorffii]
Length=396

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 126/201 (63%), Gaps = 8/201 (4%)
 Frame = +2

Query  14   SVDVRMNSAALIESVLSGTRSPEL-RAQISNADEIFEGIVGILNCPLS--YSRALKIGVK  184
            S+D R+N+A L+E + S   +PE  +  +     + EG+V +L    S    RA K GVK
Sbjct  184  SMDARINAAVLVEKIASD--APEAAKLAMGQIPGLLEGLVDLLRGDHSAVSPRAPKSGVK  241

Query  185  ALFALCL--AKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAA  358
            ALF+LCL  A     +AV+AGA  AL++ L      DA+R L  +ELLCR  +G    A 
Sbjct  242  ALFSLCLCSAASNSERAVSAGAAAALVEHLPAAQHGDADRTLGALELLCRTRAGREVVAQ  301

Query  359  HALTVPLLVKIIL-KISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCT  535
            HAL VP LV  I  + S +A E AAG LL++CS SE+ Q  AA AGV+TQLLLL+QSDCT
Sbjct  302  HALAVPALVAAIQCRSSFQAAECAAGTLLAVCSGSEEVQLAAAEAGVLTQLLLLIQSDCT  361

Query  536  ERAKRKAQMLLKLLRDCWPED  598
            +RAKRKA  LLKLLR  W ED
Sbjct  362  DRAKRKAVELLKLLRRWWAED  382



>ref|XP_010489938.1| PREDICTED: U-box domain-containing protein 25-like, partial [Camelina 
sativa]
Length=302

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S++ R+N+AALIE V +GT+S + +   SN + +FEG++ +L  P+S  RALKIG+
Sbjct  204  LFDSSIETRVNAAALIEIVTTGTKSEDPKGTFSNYESVFEGVLDLLRNPISSRRALKIGI  263

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRL-QDFDKCDAE  295
            KALF+LC AKQ RH A+ AGA E LIDRL  DFD+CD E
Sbjct  264  KALFSLCSAKQTRHLAINAGAPEILIDRLAADFDRCDTE  302



>ref|XP_010912457.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
25-like [Elaeis guineensis]
Length=411

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 8/178 (4%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC--  286
            + EG+VG+L    S +RA++ G++ LF+LCLAK+ R +AV AGA  A++   +       
Sbjct  230  VMEGLVGLLEEKGSSARAVRAGIRGLFSLCLAKENRGRAVAAGAAAAVVXADRGAGGXAR  289

Query  287  DAERALATVELLCRIPSG-----CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  451
            DAERALATVELLCR   G       A    A  V L+  +  K S RA E+AAGAL+++ 
Sbjct  290  DAERALATVELLCRTEGGREAVVAGAGGGAAAVVALVRAMAGKASERAAEHAAGALVAVV  349

Query  452  saseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGISDDY  622
              SE  QREA  AG++TQLLL+VQ  C++RAKRKAQ+LLKLLR  WP  D    SDD+
Sbjct  350  GGSEWLQREAVGAGLVTQLLLMVQGGCSDRAKRKAQLLLKLLRSAWPHHDSIANSDDF  407



>ref|XP_002453962.1| hypothetical protein SORBIDRAFT_04g022280 [Sorghum bicolor]
 gb|EES06938.1| hypothetical protein SORBIDRAFT_04g022280 [Sorghum bicolor]
Length=407

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = +2

Query  95   ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  274
            +  A+ + +G+V ++    + +RA+++G++ALFALCLAK+ R +AV AGA  AL  R+ +
Sbjct  227  LGAAEGVMDGLVALVE-EKANARAVRVGIRALFALCLAKENRPRAVAAGAASALARRVAE  285

Query  275  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILK-ISHRATEYAAGALLSIC  451
                + ERALA VE LCR   G  A  A A      V  +++ +S RA E+AAGAL+++ 
Sbjct  286  GGAGEPERALAAVERLCRAEGGRDAVVAGAGGGSAAVTALVRAMSGRAAEHAAGALVAVV  345

Query  452  saseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE-DFTGISDDYNC  628
              SE  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    SDD+  
Sbjct  346  GGSEALQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPNTDCIANSDDFLQ  405

Query  629  SY  634
             Y
Sbjct  406  HY  407



>ref|XP_002991371.1| hypothetical protein SELMODRAFT_133552 [Selaginella moellendorffii]
 gb|EFJ07483.1| hypothetical protein SELMODRAFT_133552 [Selaginella moellendorffii]
Length=417

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 116/207 (56%), Gaps = 8/207 (4%)
 Frame = +2

Query  26   RMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCL  205
            ++N+A L+E V +   S   ++ +   + +  G+V ++    +Y RA++  + AL A+  
Sbjct  219  QINAARLLELVATDDES---KSMVGATERLIPGLVKLVKEDSAYPRAVRASLTALLAIVS  275

Query  206  AKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLV  385
             ++   KAV  G V  LI+ L +  + + ERALA +E + R   G  A   H+L+VP+LV
Sbjct  276  CRKNLVKAVQGGVVPPLIELLSEASRLNTERALAVLEFVARCAEGREALMDHSLSVPMLV  335

Query  386  KIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQML  565
            KIIL +S  A+E A G LL +C A +   + AA+ G  TQ++LL+Q+D T     +A+  
Sbjct  336  KIILTVSDLASERAVGILLLMCQADDSVVQAAASEGAFTQMILLIQADNTSETNHRARQF  395

Query  566  LKLLRDCWPEDFTGISDDYNCSYVVPF  646
            LKLLR   P +       ++ ++ +PF
Sbjct  396  LKLLRGAVPRECM-----HDFAFTMPF  417



>ref|XP_002988236.1| hypothetical protein SELMODRAFT_44944, partial [Selaginella moellendorffii]
 gb|EFJ10655.1| hypothetical protein SELMODRAFT_44944, partial [Selaginella moellendorffii]
Length=392

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 108/189 (57%), Gaps = 3/189 (2%)
 Frame = +2

Query  26   RMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCL  205
            ++N+A L+E V +   S   ++ +   + +  G+V ++    +Y RA++  + AL A+  
Sbjct  207  QINAARLLELVATDDES---KSMMGATERLIPGLVKLVKEDSAYPRAVRASLTALLAIVS  263

Query  206  AKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLV  385
             ++   KAV  G V  LI+ L +  + + ERALA +E + R   G  A   H+L+VP+LV
Sbjct  264  CRKNLVKAVQGGVVPPLIELLSEASRLNTERALAVLEFVARCAEGREALMDHSLSVPMLV  323

Query  386  KIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQML  565
            KIIL +S  A+E A G LL +C A +   + AA+ G  TQ++LL+Q+D T     +A+  
Sbjct  324  KIILTVSDLASERAVGILLLMCQADDSVVQAAASEGAFTQMILLIQADNTSETNHRARQF  383

Query  566  LKLLRDCWP  592
            LKLLR   P
Sbjct  384  LKLLRGAVP  392



>ref|XP_001776109.1| predicted protein [Physcomitrella patens]
 gb|EDQ59020.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 120/214 (56%), Gaps = 12/214 (6%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L++ S++ ++N+A +I ++     +P ++A + +       IV +L   L Y RA++ G+
Sbjct  189  LASGSLEGKVNAADIIHALCK--ENPRVKAAVGDLPGAIRAIVNLLREDL-YPRAVQSGL  245

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            + L ++CL+++ R  A+    +  L+  L + DK + ER  A +E+L     G  A + H
Sbjct  246  RCLQSMCLSRRNRVTAINCRTITTLVALLPNTDKRNKERVFALLEILANCAEGREAISNH  305

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICs--aseqaqreaaaaGVMTQLLLLVQSDCT  535
            AL +P++VK +L +SHRATEYA  AL  + S  ++      A  AG  T LL+L+ S C+
Sbjct  306  ALAIPVMVKSMLGVSHRATEYAVAALWLVLSYASNRNVINTALQAGAFTNLLMLLSSQCS  365

Query  536  ERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYV  637
            + AK++AQ  +KLL +        + D Y C +V
Sbjct  366  QLAKKRAQDSVKLLNEV-------VLDTYTCRHV  392



>ref|NP_001047085.2| Os02g0548700 [Oryza sativa Japonica Group]
 dbj|BAF08999.2| Os02g0548700 [Oryza sativa Japonica Group]
Length=417

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 114/187 (61%), Gaps = 5/187 (3%)
 Frame = +2

Query  86   RAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDR  265
            RA +  A+ + EG+V ++    +++RA+++G++ LFALCLAK+ R +AV AGA  AL  R
Sbjct  232  RAVLGAAEGVMEGLVALVE-EKAHARAVRVGIRGLFALCLAKENRPRAVAAGAAAALARR  290

Query  266  LQDFDKCDA--ERALATVELLCRIPSGC-AAFAAHALTVPLLVKIILKISHRATEYAAGA  436
            + +        ERALA VE LCR   G  A  A        +  ++  +S R+ E+AAGA
Sbjct  291  VAEGGGGAGEPERALAAVERLCRTEGGRDAVVAGAGGGAAAVCALVRAMSGRSAEHAAGA  350

Query  437  LLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGIS  613
            L+++   SE  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    S
Sbjct  351  LVAVVGGSEPLQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPAADSIANS  410

Query  614  DDYNCSY  634
            DD+   Y
Sbjct  411  DDFLQPY  417



>dbj|BAD16187.1| putative immediate-early fungal elicitor protein CMPG1 [Oryza 
sativa Japonica Group]
 dbj|BAD16270.1| putative immediate-early fungal elicitor protein CMPG1 [Oryza 
sativa Japonica Group]
Length=423

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 114/187 (61%), Gaps = 5/187 (3%)
 Frame = +2

Query  86   RAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDR  265
            RA +  A+ + EG+V ++    +++RA+++G++ LFALCLAK+ R +AV AGA  AL  R
Sbjct  238  RAVLGAAEGVMEGLVALVE-EKAHARAVRVGIRGLFALCLAKENRPRAVAAGAAAALARR  296

Query  266  LQDFDKCDA--ERALATVELLCRIPSGC-AAFAAHALTVPLLVKIILKISHRATEYAAGA  436
            + +        ERALA VE LCR   G  A  A        +  ++  +S R+ E+AAGA
Sbjct  297  VAEGGGGAGEPERALAAVERLCRTEGGRDAVVAGAGGGAAAVCALVRAMSGRSAEHAAGA  356

Query  437  LLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWP-EDFTGIS  613
            L+++   SE  Q EA  AG M+QLLL+VQ  C+ERAKRKAQ LLKLLR  WP  D    S
Sbjct  357  LVAVVGGSEPLQVEAVRAGAMSQLLLMVQGGCSERAKRKAQHLLKLLRSAWPAADSIANS  416

Query  614  DDYNCSY  634
            DD+   Y
Sbjct  417  DDFLQPY  423



>ref|XP_001751378.1| predicted protein [Physcomitrella patens]
 gb|EDQ83695.1| predicted protein [Physcomitrella patens]
Length=146

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = +2

Query  290  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  469
            AE+ALA +ELL  I  G AA   +AL VP+LV++ILK+S R TEYAAG L  +CS S   
Sbjct  30   AEKALAILELLGTIEEGKAAIIDYALAVPVLVELILKVSDRGTEYAAGTLRMMCSDSIAM  89

Query  470  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
            +  A A G  T+LLL +QSDCT RAKRKA  LLK+L   W +
Sbjct  90   REAAVAHGAPTKLLLHIQSDCTARAKRKASQLLKVLHKIWTQ  131



>ref|XP_004501176.1| PREDICTED: uncharacterized protein LOC101503409 [Cicer arietinum]
Length=308

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 77/141 (55%), Gaps = 0/141 (0%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K   K LFALCL++  R  AV AGAV A+++   + D   AERALA +EL+C +P G
Sbjct  158  REAKPATKILFALCLSEANRRVAVEAGAVGAVVESAPELDGAPAERALAALELMCTVPEG  217

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
                 AHAL VP++V ++ K   R  EYA G L  I       Q  A    V   + L +
Sbjct  218  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDVGEQLTAPPEEVARAVELAL  277

Query  521  QSDCTERAKRKAQMLLKLLRD  583
            Q +C+ R KRK   LLK+L+ 
Sbjct  278  QGECSARGKRKGAQLLKMLQH  298



>ref|XP_003636449.1| U-box domain-containing protein [Medicago truncatula]
Length=288

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 76/140 (54%), Gaps = 0/140 (0%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K   K LFALCL++  R  AV AGAV A+++   + +   AERALA +EL+C +P G
Sbjct  138  RESKPATKILFALCLSEANRRVAVEAGAVGAVVESAPELEGAPAERALAALELMCTVPEG  197

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
                 AHAL VP++V ++ K   R  EYA G L  I        + A    V   + L +
Sbjct  198  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDMGDMQTAPPEEVARAVELAL  257

Query  521  QSDCTERAKRKAQMLLKLLR  580
            Q DC+ R KRK   LLK L+
Sbjct  258  QGDCSARGKRKGAQLLKTLQ  277



>gb|KEH36040.1| hypothetical protein MTR_3g110138 [Medicago truncatula]
Length=302

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 76/140 (54%), Gaps = 0/140 (0%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K   K LFALCL++  R  AV AGAV A+++   + +   AERALA +EL+C +P G
Sbjct  152  RESKPATKILFALCLSEANRRVAVEAGAVGAVVESAPELEGAPAERALAALELMCTVPEG  211

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
                 AHAL VP++V ++ K   R  EYA G L  I        + A    V   + L +
Sbjct  212  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDMGDMQTAPPEEVARAVELAL  271

Query  521  QSDCTERAKRKAQMLLKLLR  580
            Q DC+ R KRK   LLK L+
Sbjct  272  QGDCSARGKRKGAQLLKTLQ  291



>ref|NP_001148065.1| ubiquitin-protein ligase [Zea mays]
 gb|ACG29626.1| ubiquitin-protein ligase [Zea mays]
Length=416

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 120/212 (57%), Gaps = 7/212 (3%)
 Frame = +2

Query  17   VDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNC-PLSYSRALKIGVKALF  193
            ++ R+N+ A++E+V S + + E RA +  A+ + +G+V +      + +RA+++GV+ALF
Sbjct  204  LEARVNAGAVVEAVASASGA-EARAALGGAEGVMDGLVALAEEEKANNARAVRVGVRALF  262

Query  194  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG----CAAFAAH  361
            ALCLAK+ R +AV AGA  AL  R+ +    + ERALA VE LCR   G     A     
Sbjct  263  ALCLAKENRARAVAAGAAAALARRVAEGGAGEPERALAAVERLCRAEGGRDAVVAGAGGG  322

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
               V  LV+ +          A  A++     SE  Q EA  AG M +LLL+VQ  C+ER
Sbjct  323  PAAVAALVRAMSGRGAEHAAGALAAVVVGAGGSEALQAEAVRAGAMGRLLLMVQGGCSER  382

Query  542  AKRKAQMLLKLLRDCWPE-DFTGISDDYNCSY  634
            AKRKAQ LLKLLR  WP  D    SDD+   Y
Sbjct  383  AKRKAQHLLKLLRSAWPSADCVANSDDFLQHY  414



>ref|XP_003523734.1| PREDICTED: U-box domain-containing protein 25-like [Glycine max]
Length=287

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 78/139 (56%), Gaps = 1/139 (1%)
 Frame = +2

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            K   K LFALCL+   R  AV AGAV A+++   D D   AERALA +EL+C +P G   
Sbjct  132  KPATKILFALCLSDANRRVAVEAGAVSAVVEAAPDLDGAPAERALAALELMCTLPEGAEE  191

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSI-CsaseqaqreaaaaGVMTQLLLLVQS  526
              AHAL VP++V ++ K + R  EYA GAL  +  +A  +    A    V   + L +Q 
Sbjct  192  LRAHALAVPVMVTMMAKTAARGKEYAIGALAVVYGAAGAENHYTAPPEEVARAVELALQG  251

Query  527  DCTERAKRKAQMLLKLLRD  583
            +C+ R +RK   LLK L+ 
Sbjct  252  ECSARGRRKGTQLLKTLQQ  270



>gb|AFW71736.1| ubiquitin-protein ligase [Zea mays]
Length=418

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 120/212 (57%), Gaps = 7/212 (3%)
 Frame = +2

Query  17   VDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNC-PLSYSRALKIGVKALF  193
            ++ R+N+ A++E+V S + + E RA +  A+ + +G+V +      + +RA+++GV+ALF
Sbjct  206  LEARVNAGAVVEAVASASGA-EARAALGGAEGVMDGLVALAEEEKANNARAVRVGVRALF  264

Query  194  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG----CAAFAAH  361
            ALCLAK+ R +AV AGA  AL  R+ +    + ERALA VE LCR   G     A     
Sbjct  265  ALCLAKENRARAVAAGAAAALARRVAEGGAGEPERALAAVERLCRAEGGRDAVVAGAGGG  324

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
               V  LV+ +          A  A++     SE  Q EA  AG M +LLL+VQ  C+ER
Sbjct  325  PAAVAALVRAMSGRGAEHAAGALAAVVVGAGGSEALQAEAVRAGAMGRLLLMVQGGCSER  384

Query  542  AKRKAQMLLKLLRDCWPE-DFTGISDDYNCSY  634
            AKRKAQ LLKLLR  WP  D    SDD+   Y
Sbjct  385  AKRKAQHLLKLLRSAWPSADCVANSDDFLQHY  416



>ref|XP_006476069.1| PREDICTED: U-box domain-containing protein 26-like [Citrus sinensis]
Length=328

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 89/172 (52%), Gaps = 6/172 (3%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  289
            E+  G+VG L        A KI    L ALCLA+  R  AV AGAV A+I+ + + D   
Sbjct  159  ELMRGVVGNLKNKAGAKPATKI----LLALCLAESNRRVAVEAGAVGAVIEVVAELDGAA  214

Query  290  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  469
             ERALA +EL+C +  G     AHAL VP++V ++ +++ R  EYA   L  I    +Q 
Sbjct  215  GERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQL  274

Query  470  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYN  625
               A    V   + L +Q +CT R +RK   LLK L++    D T   D+ N
Sbjct  275  VVAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTT--QDEMN  324



>ref|XP_002885649.1| hypothetical protein ARALYDRAFT_899024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61908.1| hypothetical protein ARALYDRAFT_899024 [Arabidopsis lyrata subsp. 
lyrata]
Length=96

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L + S+++++N AALIE VL+G++  +L+  IS +D IFEG++ +L   +S  RAL+IG+
Sbjct  5    LFDSSIEIKVNGAALIEMVLTGSKLMDLKLIISGSDSIFEGVLDLLKILISSRRALQIGI  64

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDR  265
            KA+FALCL KQ +H A++ GA   LID 
Sbjct  65   KAIFALCLVKQKKHLAISTGAPGILIDH  92



>ref|XP_007137194.1| hypothetical protein PHAVU_009G107700g [Phaseolus vulgaris]
 gb|ESW09188.1| hypothetical protein PHAVU_009G107700g [Phaseolus vulgaris]
Length=315

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 77/138 (56%), Gaps = 0/138 (0%)
 Frame = +2

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            K   K LFALCL+   R  AV  GAV A+++   + D   AERALA +EL+C +P G   
Sbjct  166  KPATKILFALCLSDVNRRVAVETGAVSAVVEAALELDGAPAERALAALELMCTLPDGAHE  225

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  529
              AHAL VP++V ++ K + RA EYA G L  +   S   Q  A    V   + L +Q +
Sbjct  226  VRAHALAVPVMVTMMGKTAARAKEYAIGVLAVVYGGSASDQHTAPPEEVARAVELALQGE  285

Query  530  CTERAKRKAQMLLKLLRD  583
            C+ RA+RK   L+K L+ 
Sbjct  286  CSARARRKGAQLMKTLKQ  303



>ref|XP_002976345.1| hypothetical protein SELMODRAFT_416243 [Selaginella moellendorffii]
 gb|EFJ22605.1| hypothetical protein SELMODRAFT_416243 [Selaginella moellendorffii]
Length=465

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 104/178 (58%), Gaps = 10/178 (6%)
 Frame = +2

Query  68   TRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAV  247
            ++S E +    +A    E +VG+L+      + +K GVKAL ALCL+K  R  AV AG V
Sbjct  264  SQSEEQQVDTLDAGSFLEAVVGLLS--EREEQLVKCGVKALLALCLSKDNRVAAVKAGVV  321

Query  248  EALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYA  427
             +L++ L +     +ER LAT+ELL     G AA   HAL +PLL+ +IL++S R TEYA
Sbjct  322  ASLLELLTEAKGVTSERILATLELLSTTLEGRAAILRHALAIPLLLSMILRVSDRGTEYA  381

Query  428  AGALLS-ICsaseqaqreaaaaGVM-------TQLLLLVQSDCTERAKRKAQMLLKLL  577
            AG L S IC+ +         A  M       T LLLL+QS CT+RA+RKA  LLK+L
Sbjct  382  AGVLCSVICTDTSTPLDSNEEALEMAFQARASTSLLLLLQSHCTQRARRKAVKLLKVL  439



>gb|EYU29273.1| hypothetical protein MIMGU_mgv1a021565mg [Erythranthe guttata]
Length=345

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 85/153 (56%), Gaps = 1/153 (1%)
 Frame = +2

Query  125  IVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  304
            + G++ C L    A K   K L ALCL +  R  AV AGAV A+++ L D +   AER+L
Sbjct  183  VGGVVAC-LREGVARKAASKVLLALCLVEMNRRAAVEAGAVTAVVEALTDAEIAVAERSL  241

Query  305  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  484
            A +ELLC    G A   AHAL VP++V+++ ++  R  E+A   L  I    E+    A 
Sbjct  242  AALELLCTTAEGTAEVRAHALAVPMMVQVMGRMEGRGKEHAISVLAVIYGGLEEGVAVAP  301

Query  485  aaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  583
            A  V   ++L +Q DC+ R +RK   LLK+L+ 
Sbjct  302  AEQVARAVMLALQGDCSARGRRKGAHLLKILQQ  334



>ref|XP_002308611.2| hypothetical protein POPTR_0006s25710g [Populus trichocarpa]
 gb|EEE92134.2| hypothetical protein POPTR_0006s25710g [Populus trichocarpa]
Length=352

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 83/165 (50%), Gaps = 9/165 (5%)
 Frame = +2

Query  104  ADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDK  283
            + E+  G+V  L         +K   K L ALCLA+  RH AV AGAV  +++   + D 
Sbjct  178  SPELMRGVVANLK----NKAGVKPATKVLLALCLAEANRHVAVEAGAVGTVVEVAMELDG  233

Query  284  CDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI-----  448
              AERALA +EL C +  G A    HAL VP++V ++ K++ R  EYA  AL  I     
Sbjct  234  SPAERALAALELTCTVAEGAAELRNHALAVPVMVTMMGKMAGRGKEYAISALAVIYGSGG  293

Query  449  CsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  583
              +  +    A    V   +   +Q DCT R +RK   LLK L++
Sbjct  294  VGSDGEQTLHAPPEEVARAVAFALQGDCTARGRRKGAQLLKALQE  338



>ref|XP_006826592.1| hypothetical protein AMTR_s00138p00053700 [Amborella trichopoda]
 gb|ERM93829.1| hypothetical protein AMTR_s00138p00053700 [Amborella trichopoda]
Length=428

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/218 (33%), Positives = 113/218 (52%), Gaps = 15/218 (7%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L   ++++R NSA LI+ + S     EL       D +FE ++ I+  P+  S +LK  +
Sbjct  215  LRQGNLELRKNSALLIKEIASNG---ELTIDFRKIDGLFESLLQIIRDPICSS-SLKASL  270

Query  182  KALFALCLA-KQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAA  358
              +F +C + ++ R KAV  G + A++D L D D+   E+A+A ++ LC+   G A  + 
Sbjct  271  ITVFYVCSSDEEIRAKAVKLGFISAILDILPDSDRSVCEKAMAAIDALCKSKEGRAKASE  330

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsase---qaqreaaaaGVMTQLLLLVQSD  529
            HAL VPL+VK I ++S   TE +   L  +C   E   ++  EA   G   +LLLL+Q  
Sbjct  331  HALMVPLVVKKIFRVSDLVTELSVTVLWRLCKDEECKLKSVSEALQVGAFQKLLLLLQVG  390

Query  530  CTERAKRKAQMLLKL---LRDCW----PEDFTGISDDY  622
            C  + K K   LLK+    R+ W      DF G+   +
Sbjct  391  CEGKIKEKVTDLLKVTNSYRERWECVDSGDFKGLKRPF  428



>ref|XP_008466051.1| PREDICTED: U-box domain-containing protein 26 [Cucumis melo]
Length=326

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 91/169 (54%), Gaps = 8/169 (5%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  289
            E+  G++   N       A KI    L ALCLA+  RH AV AGAV A+I+ L + +   
Sbjct  159  ELMRGLIESFNIKTGSKPATKI----LLALCLAEGNRHVAVEAGAVGAVIESLPEMEDAA  214

Query  290  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI----Csa  457
            AERALA++EL+C +  G A   AHAL+VP +V ++ +++ R  E A   L  I     S+
Sbjct  215  AERALASLELMCTVAEGAAEVRAHALSVPAMVTMMGRMAARGKESAISVLGVIYDNGVSS  274

Query  458  seqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  604
              ++   A    V   ++L +Q D + R +RK   LLK L++   E FT
Sbjct  275  EAKSAVTAPPEEVARAVVLALQGDSSVRGRRKGARLLKTLQEQQDEFFT  323



>ref|XP_003527831.1| PREDICTED: uncharacterized protein LOC100814020 [Glycine max]
Length=307

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 74/140 (53%), Gaps = 2/140 (1%)
 Frame = +2

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            K   K LFALCL+   R  AV  GAV A+++   D D   AERALA +EL+C +P G   
Sbjct  151  KPATKILFALCLSDANRRVAVETGAVSAVVEAAPDLDGAPAERALAALELMCTLPEGAEE  210

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSI--CsaseqaqreaaaaGVMTQLLLLVQ  523
              AHAL VP++V ++ K + R  EYA G L  +       +    A    V   + L +Q
Sbjct  211  LRAHALAVPVMVTMMAKTAARGKEYAIGVLAVVYGSVGGGEEHHTAPPEEVARAVELALQ  270

Query  524  SDCTERAKRKAQMLLKLLRD  583
             +C+ R +RK   LLK L+ 
Sbjct  271  GECSARGRRKGAQLLKTLQQ  290



>ref|XP_002987240.1| hypothetical protein SELMODRAFT_125560 [Selaginella moellendorffii]
 gb|EFJ11816.1| hypothetical protein SELMODRAFT_125560 [Selaginella moellendorffii]
Length=434

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 106/213 (50%), Gaps = 9/213 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSR---ALK  172
            L    +  R+++AALIE +    +  E R  +     IFEG+V ++    S  R   A++
Sbjct  201  LQRGDLHTRVSAAALIEELCCADK--EARGAVGATAGIFEGLVRLVGEDHSQRRHRPAIR  258

Query  173  IGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAF  352
              ++A+ A+C   + R + V  G V  L + L + DK   E  LA +E LC    G AA 
Sbjct  259  GSLRAVLAVCPPLKNRVRLVETGVVAPLAELLVEADKVTTEAILAALECLCGCAEGRAAV  318

Query  353  AAHALTVPLLVKIILKISHRATEYAAGALLSICsa--seqaqreaaaaGVMTQLLLLVQS  526
            A HAL VP + + + K+S  ATEYA   L ++C     E  +R     G+  +L   +Q 
Sbjct  319  ARHALAVPAVARKLFKVSDMATEYAIDVLWAVCKYCPDEIVKRRMVEVGLFPKLFFFLQI  378

Query  527  DCTERAKRKAQMLLKLLRDCWPE--DFTGISDD  619
             C  R K KA  LLKLL   + E  D +G ++D
Sbjct  379  GCNPRTKHKAGDLLKLLHRAYRECIDGSGSNND  411



>ref|XP_002976407.1| hypothetical protein SELMODRAFT_104879 [Selaginella moellendorffii]
 gb|EFJ22667.1| hypothetical protein SELMODRAFT_104879 [Selaginella moellendorffii]
Length=434

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 106/213 (50%), Gaps = 9/213 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSR---ALK  172
            L    +  R+++AALIE +    +  E R  +     IFEG+V ++    S  R   A++
Sbjct  201  LQRGDLHTRVSAAALIEELCCADK--EARGAVGATAGIFEGLVRLVGEDHSQRRHRPAIR  258

Query  173  IGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAF  352
              ++A+ A+C   + R + V  G V  L + L + DK   E  LA +E LC    G AA 
Sbjct  259  GSLRAVLAVCPPLKNRVRLVETGVVAPLAELLVEADKVTTEAILAALECLCGCAEGRAAV  318

Query  353  AAHALTVPLLVKIILKISHRATEYAAGALLSICsa--seqaqreaaaaGVMTQLLLLVQS  526
            A HAL VP + + + K+S  ATEYA   L ++C     E  +R     G+  +L   +Q 
Sbjct  319  ARHALAVPAVARKLFKVSDMATEYAIDVLWAVCKYCPDEIVKRRMVEVGLFPKLFFFLQI  378

Query  527  DCTERAKRKAQMLLKLLRDCWPE--DFTGISDD  619
             C  R K KA  LLKLL   + E  D +G ++D
Sbjct  379  GCNPRTKHKAGDLLKLLHRAYRECIDGSGSNND  411



>ref|XP_011019811.1| PREDICTED: uncharacterized protein LOC105122418 [Populus euphratica]
Length=530

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 83/163 (51%), Gaps = 9/163 (6%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  289
            E+  G+V  L         LK   K L ALCLA+  RH AV AGAV  +++   + D   
Sbjct  358  ELMRGVVANLK----NKAGLKPATKVLLALCLAEANRHVAVEAGAVGTVVEVAMELDGAP  413

Query  290  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI-----Cs  454
            AERALA +EL C +  G A    HAL VP++V ++ K++ R  EYA  AL  I       
Sbjct  414  AERALAALELTCTVAEGAAELRNHALAVPVMVTMMGKMAGRGKEYAISALAVIYGGGGVE  473

Query  455  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  583
            +  +    A    V   + L ++ DCT R +RK   LLK L++
Sbjct  474  SDGEQTLHAPPEEVARAVALALRGDCTARGRRKGAQLLKALQE  516



>ref|XP_004136217.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 ref|XP_004173965.1| PREDICTED: U-box domain-containing protein 26-like [Cucumis sativus]
 gb|KGN60328.1| hypothetical protein Csa_3G895740 [Cucumis sativus]
Length=324

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 92/169 (54%), Gaps = 8/169 (5%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  289
            E+  G++   N       A KI    L ALCLA+  RH AV AGAV A+I+ L + +   
Sbjct  156  ELMRGLIESFNIKTGSKPATKI----LLALCLAEGNRHVAVEAGAVGAVIESLPEMEDAA  211

Query  290  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI----Csa  457
            AERALA++EL+C +  G A   +HAL+VP +V ++ +++ R  E A   L  I     S+
Sbjct  212  AERALASLELMCTVAEGAAEVRSHALSVPAMVTMMGRMAARGKESAISVLGVIFDSGVSS  271

Query  458  seqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  604
              ++   A    V   ++L +Q D + R +RK   LLK L++   ++F+
Sbjct  272  EAKSGVTAPPEEVARAVVLALQGDSSVRGRRKGARLLKTLQEQQADEFS  320



>ref|XP_001764309.1| predicted protein [Physcomitrella patens]
 gb|EDQ70863.1| predicted protein [Physcomitrella patens]
Length=440

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 108/201 (54%), Gaps = 11/201 (5%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILN---CPLSYSRALK  172
            L++ S+D ++N+A +I ++      P ++  +++     +G+V +L    CP    RA++
Sbjct  217  LTSGSLDAKLNAADVIHTLCE--EDPHVKTAVASLPGAMKGLVNLLKDDLCP----RAVQ  270

Query  173  IGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAF  352
             G++ L  +CL +  R  A+   A+  +++ L + +K   E A A +E+L     G  A 
Sbjct  271  AGLRCLLCVCLPRSNRVMAIECRAISVVVELLPNTEKRTKELAFAVMEILANCAEGREAI  330

Query  353  AAHALTVPLLVKIILKISHRATEYAAGALLSICsase--qaqreaaaaGVMTQLLLLVQS  526
            + HAL +P++VK +L +S R TE A   L  + S +        A  AG    LL+L+  
Sbjct  331  SNHALAIPMIVKSMLGVSQRVTECAVSTLWVVLSYASNRSVTNTALQAGAFANLLMLLPG  390

Query  527  DCTERAKRKAQMLLKLLRDCW  589
            +C++RAK KA+  L+LL + W
Sbjct  391  ECSQRAKHKARDSLRLLNENW  411



>ref|XP_002962287.1| hypothetical protein SELMODRAFT_403954 [Selaginella moellendorffii]
 gb|EFJ37547.1| hypothetical protein SELMODRAFT_403954 [Selaginella moellendorffii]
Length=630

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 99/215 (46%), Gaps = 47/215 (22%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  292
            I    V +L  P + ++ +++ +K++  +CL+K  R  AV AGAVEAL+D L D    D 
Sbjct  410  ILGACVALLKDPSAEAKLVRLALKSMLGICLSKPNRIPAVKAGAVEALLDTLVDLHGVDG  469

Query  293  -------------ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAG  433
                         ERALAT+ELLC    G AA  +    +  LV ++L +S RATEYAAG
Sbjct  470  GEFCSKSGIVVNVERALATLELLCTSSEGRAAICSQPNFISELVGLVLGVSERATEYAAG  529

Query  434  ALLSI---------------------------------CsaseqaqreaaaaGVMTQLLL  514
             L ++                                        Q  A   G   Q+LL
Sbjct  530  VLCAVLCDNLGSEDGTTAAAASFAAGAARITSSATFNGLGEHSSVQEMAVKGGAPAQMLL  589

Query  515  LVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDD  619
            ++QSDC++RA+RKA  LLK L   + E+   I  D
Sbjct  590  VMQSDCSDRARRKAAKLLKALHK-YGENHNTIHSD  623



>gb|KDP34197.1| hypothetical protein JCGZ_07768 [Jatropha curcas]
Length=350

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 88/173 (51%), Gaps = 14/173 (8%)
 Frame = +2

Query  143  CPLSYSRAL------KIGVKA----LFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  292
            CPL   R +      K G KA    L ALCLA+  RH AV AG V  +++   + +   A
Sbjct  177  CPLELMRGVVVNLKNKAGAKAATKILLALCLAEGNRHVAVKAGTVGTVVEVTMELEGPVA  236

Query  293  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase--q  466
            ERALA +EL+C +  G A   AHAL +P++V  + ++  R  EYA  AL  +       +
Sbjct  237  ERALAALELMCTVEEGAAELRAHALAMPVMVAKMGEMEGRGKEYAISALSVVYGGGVLDE  296

Query  467  aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYN  625
               +A    V   ++L +Q DCT RA+RK   LLK L++    D T    D N
Sbjct  297  QVHQAPPEEVARAVILALQGDCTARARRKGAQLLKALQEFGRADST--QQDVN  347



>ref|XP_010668167.1| PREDICTED: U-box domain-containing protein 26 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 82/156 (53%), Gaps = 4/156 (3%)
 Frame = +2

Query  149  LSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCR  328
            ++ + + K   K L ALCLA+  R  AV  GA   ++D L D D    ERALA +EL+C 
Sbjct  209  MTRTSSAKSATKILLALCLAEGNRRVAVECGAPTRVVDALPDLDGAVVERALAALELMCT  268

Query  329  IPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaG----V  496
            +P G A   AHAL VP+LV  + ++  R  EYA   L ++    E+  +   AA      
Sbjct  269  VPEGAAEVRAHALAVPMLVATMGRMEGRGREYAISVLTAVYGGGEEDHQVWEAAPPEEVA  328

Query  497  MTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  604
               +L + Q +C+ R KRK   LLK+L++    D T
Sbjct  329  RAVVLAMQQGNCSARGKRKGAQLLKVLQENGRVDLT  364



>ref|XP_002987189.1| hypothetical protein SELMODRAFT_46743, partial [Selaginella moellendorffii]
 gb|EFJ11765.1| hypothetical protein SELMODRAFT_46743, partial [Selaginella moellendorffii]
Length=144

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 85/140 (61%), Gaps = 8/140 (6%)
 Frame = +2

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            KAL ALCL+K  R  AV AG V +L++ L +     +ER LAT+ELL     G AA   H
Sbjct  1    KALLALCLSKDNRVAAVKAGVVASLLELLTEAKGVTSERMLATLELLSTTLEGRAAILRH  60

Query  362  ALTVPLLVKIILKISHRATEYAAGALLS-ICsaseqaqreaaaaGVM-------TQLLLL  517
            AL +PLL+ +IL++S R TEYAAG L S IC+ +         A  M       T LLLL
Sbjct  61   ALAIPLLLSMILRVSDRGTEYAAGVLCSVICTETSTPLDSNEEALEMAFQARASTSLLLL  120

Query  518  VQSDCTERAKRKAQMLLKLL  577
            +QS CT+RA+RKA  LLK+L
Sbjct  121  LQSHCTQRARRKAVKLLKVL  140



>ref|XP_011090755.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Sesamum indicum]
Length=328

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 77/140 (55%), Gaps = 0/140 (0%)
 Frame = +2

Query  164  ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGC  343
            A K   K L ALCL +  R  AV AGAV A+++ L D +     R LA +ELLC    G 
Sbjct  178  ARKPASKVLLALCLVEGNRRVAVEAGAVTAVVEALTDAESAVLWRLLAALELLCTTAEGA  237

Query  344  AAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQ  523
            A   AHAL VP++V+++ ++  R  E+A   L  I    E+    A A  V   ++L +Q
Sbjct  238  AEVRAHALAVPMMVQVMGRMEGRGKEHAISVLAVIYGGLEEGVGVAPAEEVARSVMLALQ  297

Query  524  SDCTERAKRKAQMLLKLLRD  583
             DC+ R +RK   LLK+L++
Sbjct  298  GDCSARGRRKGAQLLKILQE  317



>ref|XP_003636401.1| U-box domain-containing protein [Medicago truncatula]
 gb|KEH36028.1| hypothetical protein MTR_3g110088 [Medicago truncatula]
Length=289

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 70/140 (50%), Gaps = 13/140 (9%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K   K LFALCL++  R  AV AGAV              AERALA +EL+C +P G
Sbjct  152  RESKPATKILFALCLSEANRRVAVEAGAV-------------GAERALAALELMCTVPEG  198

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
                 AHAL VP++V ++ K   R  EYA G L  I        + A    V   + L +
Sbjct  199  AEEVRAHALAVPVMVTVMGKTGARGKEYAIGVLAVIYGGDMGDMQTAPPEEVARAVELAL  258

Query  521  QSDCTERAKRKAQMLLKLLR  580
            Q DC+ R KRK   LLK L+
Sbjct  259  QGDCSARGKRKGAQLLKTLQ  278



>ref|XP_002281453.1| PREDICTED: U-box domain-containing protein 25 [Vitis vinifera]
Length=344

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 84/158 (53%), Gaps = 8/158 (5%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRA-LKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  289
            +  G+VG L       RA  +   K L ALCLA+  RH AV AGAV  +++ + + +   
Sbjct  184  VMRGVVGCLK-----DRAGARPATKVLLALCLAEGNRHVAVEAGAVAEVVEAMSEMEGAV  238

Query  290  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  469
            AERALA +EL+C +  G A   AHAL+VP+++ ++  ++ R  E A   L  I   +   
Sbjct  239  AERALAALELMCTVAEGAAELRAHALSVPMMISMMESMAGRGKECAISILAVIYIGAGDQ  298

Query  470  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  583
               +    V   + L +Q DC+ R KRK   LL+ L++
Sbjct  299  APPSEE--VARAVALALQGDCSARGKRKGAQLLRALQE  334



>ref|XP_006450657.1| hypothetical protein CICLE_v10008902mg [Citrus clementina]
 gb|ESR63897.1| hypothetical protein CICLE_v10008902mg [Citrus clementina]
Length=328

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 89/172 (52%), Gaps = 6/172 (3%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  289
            E+  G+VG L        A KI    L ALCLA+  R  AV AGAV A+I+ + + D   
Sbjct  159  ELMRGVVGNLKNKAGAKPATKI----LLALCLAESNRRVAVEAGAVGAVIEVVAELDAAA  214

Query  290  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa  469
             ERALA +EL+C +  G     AHAL VP++V ++ +++ R  EYA   L  I    +Q 
Sbjct  215  GERALAALELMCTVAEGAEETRAHALAVPVMVTMMGQMAGRGKEYAISVLAVIYGGGDQP  274

Query  470  qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYN  625
               A    V   + L +Q +CT R +RK   LLK L++    D T   D+ N
Sbjct  275  VLAAPPEEVARAVELALQGNCTPRGRRKGTQLLKSLKEYGQPDTT--QDEMN  324



>emb|CDP16178.1| unnamed protein product [Coffea canephora]
Length=364

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 78/138 (57%), Gaps = 0/138 (0%)
 Frame = +2

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            K   K L ALCL +  RH AV AGAV  ++D + D +   AER+LA +ELLC +  G A 
Sbjct  216  KSASKVLLALCLVEGNRHAAVEAGAVGVVVDAMADLEGAVAERSLAALELLCTVAEGAAE  275

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSD  529
              +HAL VP++V+++ ++  R  EYA   L  I          A    V   ++L +Q D
Sbjct  276  LRSHALAVPMMVEVMGRMEGRGKEYAISVLAVIFGGCTDGAVVAPPEEVARAVMLALQGD  335

Query  530  CTERAKRKAQMLLKLLRD  583
            C+ R +RKA  LLK+L++
Sbjct  336  CSARGRRKAAQLLKILQE  353



>ref|XP_002862799.1| hypothetical protein ARALYDRAFT_920258 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39057.1| hypothetical protein ARALYDRAFT_920258 [Arabidopsis lyrata subsp. 
lyrata]
Length=225

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +2

Query  29   MNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLA  208
            +N AALIE VL+G++  +L+  IS +D IFEG++ +L   +S  RAL+IG+KA+FALCL 
Sbjct  144  VNGAALIEMVLTGSKLMDLKLIISGSDSIFEGVLDLLKILISSRRALQIGIKAIFALCLV  203

Query  209  KQYRHKAVTAGAVEALID  262
            KQ +H A++ GA   LID
Sbjct  204  KQKKHLAISTGAPGILID  221



>ref|XP_006340423.1| PREDICTED: U-box domain-containing protein 26-like, partial [Solanum 
tuberosum]
Length=299

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 88/168 (52%), Gaps = 6/168 (4%)
 Frame = +2

Query  107  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC  286
            D +  G+VG L       R  K   K L ALCL++  RH AV  GAV  ++D L D D  
Sbjct  123  DTVLRGVVGCLK----DRRVAKSASKVLLALCLSENNRHVAVEVGAVGVVVDSLSDLDVA  178

Query  287  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsas-  460
             AER+LA +ELLC +  G      HAL VP++V+++ ++   R  EYA   L  I   + 
Sbjct  179  AAERSLAALELLCTMAEGAEEVRDHALAVPMMVEVMGRMDGSRGKEYAISVLAVIYGGAC  238

Query  461  eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  604
            + A   A    V   ++L +Q DC+ R +RK   LLK+L++    D T
Sbjct  239  DGAPLAAPPEEVARAVMLALQGDCSARGRRKGAQLLKILQNHGRPDPT  286



>gb|KHN31155.1| U-box domain-containing protein 26 [Glycine soja]
Length=217

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 107/199 (54%), Gaps = 12/199 (6%)
 Frame = +2

Query  20   DVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGIL--NCPLSYSRALKIGVKALF  193
             V+ +   +I+S+ S  ++ E+   + ++ ++   IV ++  NC +S     K+ +KA+ 
Sbjct  21   SVKTSLCHIIDSIAS-PQTEEVCHMLGHSHKLVHEIVVLVRQNCEVS-----KVAIKAML  74

Query  194  ALCLAKQYRHKAVTAGAVEALIDRL---QDFDKCDAERALATVELLCRIPSGCAAFAAHA  364
            ALC  +  R   V  GA++ +I  +   +   K  A  A+A ++ L  + S   A   H 
Sbjct  75   ALCSLQSNRENLVREGAIDGVITYISGCETRQKNAAPLAMAIIKKLLVLESAKEALVNHP  134

Query  365  LTVPLLVKIILKI-SHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
              V  LVK++ ++ +   +E A G L  IC    +A+ EA  AGV+TQLL L+QS C  +
Sbjct  135  NGVETLVKMVFRVCNQECSESAVGILAIICCDFGRAREEAIEAGVLTQLLFLLQSQCGTK  194

Query  542  AKRKAQMLLKLLRDCWPED  598
             K KA+MLLKLLR  W E+
Sbjct  195  TKTKARMLLKLLRSKWIEE  213



>gb|KDP34438.1| hypothetical protein JCGZ_12798 [Jatropha curcas]
Length=395

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 110/191 (58%), Gaps = 9/191 (5%)
 Frame = +2

Query  44   LIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRH  223
            LIE + S   + EL A I    +I +G++ ++      S   + G+KA++ALC  +  R 
Sbjct  204  LIEGISSSLETKELCAIIGENRQILQGLILLVQ---QTSGVPEAGIKAIYALCSLESNRE  260

Query  224  KAVTAGAVEALIDRLQDFDKCD-----AERALATVELLCRIPSGCAAFAAHALTVPLLVK  388
              V AG +  L+  + + ++ +     A +A+AT+E+L R+ +   A   +   V  LVK
Sbjct  261  NLVQAGVINGLLMYISNTERRENVRNLAPKAMATIEILLRVETAKDAVINNPNGVSSLVK  320

Query  389  IILKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQML  565
            ++ ++S H  +E A  +L+ ICS S QA+ EA   GV+TQLLLL+QS C+ R K  A+ML
Sbjct  321  MVFRVSDHEGSESAVRSLMVICSDSLQAREEAICRGVLTQLLLLLQSQCSVRTKTNARML  380

Query  566  LKLLRDCWPED  598
            LKLLR  W E+
Sbjct  381  LKLLRSKWNEE  391



>ref|XP_004251181.1| PREDICTED: U-box domain-containing protein 26 [Solanum lycopersicum]
Length=334

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 89/168 (53%), Gaps = 6/168 (4%)
 Frame = +2

Query  107  DEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKC  286
            D +  G+VG L       R  K   K L ALCL++  RH AV  GAV A++D L D D  
Sbjct  160  DTVLRGVVGCLK----DRRIAKSASKVLLALCLSENNRHVAVEVGAVGAVVDILSDLDVA  215

Query  287  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsas-  460
             AER+LA +ELLC +  G      HAL VP++V+++ ++   R  EYA   L  I   + 
Sbjct  216  AAERSLAALELLCTVAEGAEEVRVHALAVPMMVEVMGRMDGSRGKEYAISVLAVIYGGAC  275

Query  461  eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  604
            + A   A    V   ++L +Q DC+ R +RK   LLK+L++    D T
Sbjct  276  DGAPLAAPPEEVARAVMLALQGDCSARGRRKGAQLLKILQNYGRPDPT  323



>ref|XP_001783217.1| predicted protein [Physcomitrella patens]
 gb|EDQ51985.1| predicted protein, partial [Physcomitrella patens]
Length=388

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/194 (29%), Positives = 103/194 (53%), Gaps = 5/194 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L++ S++ + N+A +I ++      P L+  + +     E  V +L   L Y R ++ G+
Sbjct  197  LASGSLEAKANAADVIHTLCE--EDPHLKIAVGDLPGAIEAFVDLLKENL-YPRVVQAGL  253

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            + L ++CL ++ R  A+   A+  L++ L + +K + + A   +E++     G  A + H
Sbjct  254  RCLLSVCLPRRNRVIAIECRALSVLVELLPNTEKRNKDLAFEVLEIMANCAEGREAISNH  313

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa--aaGVMTQLLLLVQSDCT  535
            A  +P++VK +L +S R TE A   L  + S +           AG  T LL+L+ S+C+
Sbjct  314  ATAIPMIVKSMLGVSQRVTECAVSTLWVVLSYASNRNVINTALQAGAFTNLLVLLPSECS  373

Query  536  ERAKRKAQMLLKLL  577
            +R K+KA+  LKLL
Sbjct  374  QRTKQKARDSLKLL  387



>ref|XP_009801169.1| PREDICTED: uncharacterized protein LOC104246952 [Nicotiana sylvestris]
Length=352

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 96/165 (58%), Gaps = 6/165 (4%)
 Frame = +2

Query  95   ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  274
            ++  + + +G+VG L    +  +  K   K L ALCL++  RH AV AGAV  +++ L D
Sbjct  166  VTCPETVMKGVVGCL----TDRKISKSASKVLLALCLSENNRHVAVEAGAVGVVVEVLSD  221

Query  275  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSIC  451
             +   AER+LA +ELLC +  G     +HAL VP++V+++ ++  +R  EYA G L  I 
Sbjct  222  LEVAAAERSLAALELLCTVAEGAEEVRSHALAVPMMVEVMGRLEGNRGKEYAIGVLTVIY  281

Query  452  sas-eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  583
              + + A   A A  V   ++L +QSDC+ R +RK   LLK+L++
Sbjct  282  GGACDGAPVTAPAEEVARAVMLALQSDCSARGRRKGAQLLKILQN  326



>ref|NP_196716.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87715.1| putative protein [Arabidopsis thaliana]
 gb|AAO22790.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42420.1| unknown protein [Arabidopsis thaliana]
 gb|AED91694.1| uncharacterized protein AT5G11550 [Arabidopsis thaliana]
Length=314

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 10/160 (6%)
 Frame = +2

Query  131  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  304
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  145  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  204

Query  305  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq----  472
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA  ++LS+            
Sbjct  205  AALELMCTTAEGAAEVRAHAMTVPAMVAVMARLAGRGREYAI-SILSVVYGKGGEGGDSG  263

Query  473  ---reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  583
                 A A  V   + L ++ +CT R KRK   LLK L +
Sbjct  264  EEIAVAPAEEVARAVALALEGECTARGKRKGAQLLKTLEE  303



>ref|XP_009403145.1| PREDICTED: U-box domain-containing protein 21-like [Musa acuminata 
subsp. malaccensis]
Length=439

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 102/199 (51%), Gaps = 6/199 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L +  +D R+N+A ++  +LS +  P     ++  D + E +  ++  P+S  RA K  +
Sbjct  224  LRSGDLDARVNAALVLRELLS-SLPPRRINGVAGTDGLVEALSKLIQNPIS-PRATKASL  281

Query  182  KALFALCLAKQYRHKA-VTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAA  358
             A F L  +      A V  G + +L++ L D DK   E+ALA ++ +     G      
Sbjct  282  VAAFYLVDSSDRAAGALVDTGIIPSLLEILVDSDKGMCEKALAVLDGVLGCSRGREMAYG  341

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqa---qreaaaaGVMTQLLLLVQSD  529
            HALTVP+LVK +L++S  ATE+A  AL  +C   ++      EA   G   + LLLVQ  
Sbjct  342  HALTVPVLVKKMLRVSDMATEFAVSALWKLCRNEKRGGGCSMEAVRVGAFQKSLLLVQVG  401

Query  530  CTERAKRKAQMLLKLLRDC  586
            C+   K KA  LLKLL  C
Sbjct  402  CSGATKEKANDLLKLLNGC  420



>ref|XP_010249635.1| PREDICTED: U-box domain-containing protein 26 [Nelumbo nucifera]
Length=341

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 93/164 (57%), Gaps = 5/164 (3%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  292
            +  G+V  L  P     A K+    L ALCLA+  RH AV AGAV  +++ + + +   A
Sbjct  179  VMSGVVRFLKDPAGAKPATKV----LLALCLAECNRHVAVEAGAVAEVVETVAELEGSAA  234

Query  293  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq  472
            ERALA +ELLC +P G +   AHAL VP+LV+++ K++ R  E+   ++L++       +
Sbjct  235  ERALAALELLCTVPEGASELRAHALAVPMLVEMVTKMAGRGKEHGI-SVLAVIFGGGGEE  293

Query  473  reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  604
              A    V   ++L +Q +C+ RA+RK   +LK+L++    D T
Sbjct  294  GVAPPEEVGRAVVLALQGECSARARRKGAQILKVLQENGRLDLT  337



>ref|XP_010456493.1| PREDICTED: uncharacterized protein LOC104737947, partial [Camelina 
sativa]
Length=269

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 7/158 (4%)
 Frame = +2

Query  131  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  304
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  101  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  160

Query  305  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  484
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA   L  +         E  
Sbjct  161  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAISILSVVYGKGGDDSGEEI  220

Query  485  aaGVMTQL-----LLLVQSDCTERAKRKAQMLLKLLRD  583
            A     ++     L L   +CT R +RK   LLK L +
Sbjct  221  AVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  258



>ref|XP_003522485.1| PREDICTED: U-box domain-containing protein 26-like [Glycine max]
Length=393

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 107/198 (54%), Gaps = 12/198 (6%)
 Frame = +2

Query  23   VRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGIL--NCPLSYSRALKIGVKALFA  196
            V+ +   +I+S+ S  ++ E+   + ++ ++   IV ++  NC +S     K+ +KA+ A
Sbjct  198  VKTSLCHIIDSIAS-PQTEEVCHMLGHSHKLVHEIVVLVRQNCEVS-----KVAIKAMLA  251

Query  197  LCLAKQYRHKAVTAGAVEALIDRL---QDFDKCDAERALATVELLCRIPSGCAAFAAHAL  367
            LC  +  R   V  GA++ +I  +   +   K  A  A+A ++ L  + S   A   H  
Sbjct  252  LCSLQSNRENLVREGAIDGVITYISGCETRQKNAAPLAMAIIKKLLVLESAKEALVNHPN  311

Query  368  TVPLLVKIILKI-SHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERA  544
             V  LVK++ ++ +   +E A G L  IC    +A+ EA  AGV+TQLL L+QS C  + 
Sbjct  312  GVETLVKMVFRVCNQECSESAVGILAIICCDFGRAREEAIEAGVLTQLLFLLQSQCGTKT  371

Query  545  KRKAQMLLKLLRDCWPED  598
            K KA+MLLKLLR  W E+
Sbjct  372  KTKARMLLKLLRSKWIEE  389



>ref|XP_006847226.1| hypothetical protein AMTR_s00017p00257160 [Amborella trichopoda]
 gb|ERN08807.1| hypothetical protein AMTR_s00017p00257160 [Amborella trichopoda]
Length=400

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 109/194 (56%), Gaps = 2/194 (1%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L   ++ ++++   L+ ++ S     EL  +I     I +G++ ++     +  AL  G+
Sbjct  187  LKGGTMKIKISICQLMVAISSSHDLKELCYEIGQNQVILQGLISVMQHS-HHVGALNAGI  245

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            +AL +L L+       + AG +++L++ +   DK +   ALA +E L RI SG      +
Sbjct  246  RALSSLALSLTTVEITIEAGIIDSLVECVMQADKSNVSLALAAIEHLSRIESGKKVLREN  305

Query  362  ALTVPLLVKIILKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTE  538
             L + +LVK++ ++S H  +E A G LL IC  S  AQ  A   G++TQLLLL+QS C  
Sbjct  306  PLAIRVLVKLVFRVSDHEGSENAIGCLLVICEESLSAQEVAINEGILTQLLLLLQSQCNS  365

Query  539  RAKRKAQMLLKLLR  580
            RAK KA++LLKLLR
Sbjct  366  RAKTKARVLLKLLR  379



>ref|XP_010028074.1| PREDICTED: U-box domain-containing protein 30 [Eucalyptus grandis]
 gb|KCW54733.1| hypothetical protein EUGRSUZ_I00687 [Eucalyptus grandis]
Length=447

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 104/192 (54%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  S++ ++N   LIE+++      + R++I ++  +  G++ ++     Y+     G+
Sbjct  239  LNEGSMETKINCTRLIETLM---EEKDFRSEIVSSHSLLVGLMRLVK-EKRYANGTLPGL  294

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            + L  +CL KQ R   V+ GAV  L+D L + D    E AL  +E L  +P G  A    
Sbjct  295  RLLRTICLHKQVRSLFVSVGAVPQLVDLLPNLDSECLELALFILETLSSLPEGQLALKDC  354

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
              T+P +V++++++S   T+YA   L ++CS + Q     A  AG+  +LLL++QS C  
Sbjct  355  QSTIPSMVRLLMRVSEMCTQYALSILWAVCSLAPQECSSVAVDAGLAAKLLLVIQSGCDP  414

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  415  VLKQRSSELLKL  426



>ref|XP_006289615.1| hypothetical protein CARUB_v10003173mg [Capsella rubella]
 gb|EOA22513.1| hypothetical protein CARUB_v10003173mg [Capsella rubella]
Length=313

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 84/160 (53%), Gaps = 10/160 (6%)
 Frame = +2

Query  131  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  304
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  144  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  203

Query  305  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq----  472
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA  ++LS+            
Sbjct  204  AALELMCTTTEGAAEVRAHAMTVPAMVAVMARLAGRGREYAI-SILSVVYGKGGGGGGGG  262

Query  473  ---reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  583
                 A A  V   + L ++ +CT R +RK   LLK L +
Sbjct  263  EEIAVAPAEEVARAVALALEGECTARGRRKGAQLLKTLEE  302



>ref|XP_006410763.1| hypothetical protein EUTSA_v10016730mg [Eutrema salsugineum]
 gb|ESQ52216.1| hypothetical protein EUTSA_v10016730mg [Eutrema salsugineum]
Length=412

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 88/165 (53%), Gaps = 7/165 (4%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  280
            +F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D     D
Sbjct  233  VFTEVVQILDDQISH-KATKAAMHILVNICPWGRNRHKAVEAGAISVIIELLMDDSFSSD  291

Query  281  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  454
            +   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+    
Sbjct  292  RRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKFC  351

Query  455  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  589
            A+     E    GV+T+L L++Q  C  + K KA+ LLKL    W
Sbjct  352  ATPALLNEMLQLGVVTKLCLVLQVSCGSKTKEKAKELLKLHARVW  396



>ref|XP_006399662.1| hypothetical protein EUTSA_v10014169mg [Eutrema salsugineum]
 gb|ESQ41115.1| hypothetical protein EUTSA_v10014169mg [Eutrema salsugineum]
Length=311

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 74/141 (52%), Gaps = 3/141 (2%)
 Frame = +2

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            K   K L ALCLA+  RH AV AGA  A+++     +    ERALA +EL+C    G A 
Sbjct  160  KYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERALAALELMCTTAEGAAE  219

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSI---CsaseqaqreaaaaGVMTQLLLLV  520
              AHA+TVP +V ++ +++ R  EYA   L  +      S +    A A  V   + L +
Sbjct  220  VRAHAMTVPAMVAVMARLAGRGREYAISILTVVYGRGGVSGEEIAVAPAEEVARAVSLAL  279

Query  521  QSDCTERAKRKAQMLLKLLRD  583
            + +CT R +RK   LLK L +
Sbjct  280  EGECTARGRRKGAHLLKTLEE  300



>ref|XP_003517356.1| PREDICTED: U-box domain-containing protein 30-like [Glycine max]
Length=449

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 104/192 (54%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  S++ ++N   LIES++      + R+++ ++  +  G++ ++     +S  +  G+
Sbjct  241  LNEGSIETKINCTRLIESLI---EEKDFRSEVISSHSLLVGLMRLVK-DKRHSNGVCPGL  296

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L  +CL K+ R+  V+ GAV  L++ L   +    E AL  ++ L  +P G  A    
Sbjct  297  SLLRTICLHKEVRNLLVSIGAVSQLVELLSGMEPDCTELALCVLDALASVPEGRVALKDC  356

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
            + T+P++VK++++IS   T+YA   L S+C  S       A  AG+  +LLL++QS C  
Sbjct  357  SNTIPIMVKLLMRISENCTQYALSILWSVCKLSPDECSSIAVDAGLAAKLLLVIQSGCNP  416

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  417  ILKQQSAELLKL  428



>ref|XP_010491888.1| PREDICTED: uncharacterized protein LOC104769387 [Camelina sativa]
Length=313

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 80/160 (50%), Gaps = 10/160 (6%)
 Frame = +2

Query  131  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  304
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  144  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  203

Query  305  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  484
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA  ++LS+            
Sbjct  204  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAI-SILSVVYGKGGGDDSGE  262

Query  485  aaGVMTQ-------LLLLVQSDCTERAKRKAQMLLKLLRD  583
               V           L L   +CT R +RK   LLK L +
Sbjct  263  EIAVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  302



>ref|XP_010453204.1| PREDICTED: uncharacterized protein LOC104735168 [Camelina sativa]
Length=309

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 7/158 (4%)
 Frame = +2

Query  131  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  304
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  141  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  200

Query  305  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  484
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA   L  +         E  
Sbjct  201  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAISILSVVYGKGGDDSGEEI  260

Query  485  aaGVMTQL-----LLLVQSDCTERAKRKAQMLLKLLRD  583
            A     ++     L L   +CT R +RK   LLK L +
Sbjct  261  AVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  298



>ref|XP_007137800.1| hypothetical protein PHAVU_009G156600g [Phaseolus vulgaris]
 gb|ESW09794.1| hypothetical protein PHAVU_009G156600g [Phaseolus vulgaris]
Length=392

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 83/151 (55%), Gaps = 4/151 (3%)
 Frame = +2

Query  158  SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRL---QDFDKCDAERALATVELLCR  328
            S   K+ +KA+ +LC  +  R   V AGA++ +I  +   +   K  A  A+A ++ L  
Sbjct  238  SEVSKVAIKAMLSLCSLQSNRDNLVRAGAIDGVIIYISGCETRQKNLAPFAMAIIKNLLV  297

Query  329  IPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSICsaseqaqreaaaaGVMTQ  505
            + S   A   H   V  LVK++ K+ +   +E A G L  +C    +A+ EA  AGV+TQ
Sbjct  298  LESAKEALVNHPYGVATLVKLVFKVCNQECSESAVGILAIVCRDFGRAREEAIGAGVLTQ  357

Query  506  LLLLVQSDCTERAKRKAQMLLKLLRDCWPED  598
            LL L+QS C  + K KA+MLLKLLR  W E+
Sbjct  358  LLFLLQSQCDPKTKTKARMLLKLLRSKWIEE  388



>ref|XP_009603741.1| PREDICTED: uncharacterized protein LOC104098657 [Nicotiana tomentosiformis]
Length=335

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 93/172 (54%), Gaps = 6/172 (3%)
 Frame = +2

Query  95   ISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD  274
            ++  + + +G+VG L       +  K   K L ALCL++  RH AV AGAV  +++ L D
Sbjct  157  VTCPETVMKGVVGCLK----DRKISKSASKVLLALCLSENNRHVAVEAGAVGVVVEVLSD  212

Query  275  FDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKI-SHRATEYAAGALLSIC  451
             +   AER+LA +ELLC +  G      HAL VP++V+++ ++   R  EYA G L  I 
Sbjct  213  LEVAAAERSLAALELLCMVAEGAEEVRTHALAVPMMVEVMGRLEGSRGKEYAIGVLAVIY  272

Query  452  sas-eqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  604
              + + A   A    V   ++L +Q DC+ R +RK   LLK+L++    D T
Sbjct  273  GGACDGAPVNAPPEEVARAVMLALQGDCSARGRRKGAQLLKILQNYGQPDPT  324



>ref|XP_010419728.1| PREDICTED: uncharacterized protein LOC104705421 [Camelina sativa]
Length=312

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 7/158 (4%)
 Frame = +2

Query  131  GILNCPLSYSRAL--KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERAL  304
            G+++C  S ++ +  K   K L ALCLA+  RH AV AGA  A+++     +    ERAL
Sbjct  144  GLVSCLRSNNKIVTAKYVTKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERAL  203

Query  305  ATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaa  484
            A +EL+C    G A   AHA+TVP +V ++ +++ R  EYA   L  +         E  
Sbjct  204  AALELMCTTKEGAAEVRAHAMTVPAMVAVMARLAGRGREYAISILSVVYGKGGDDSGEEI  263

Query  485  aaGVMTQL-----LLLVQSDCTERAKRKAQMLLKLLRD  583
            A     ++     L L   +CT R +RK   LLK L +
Sbjct  264  AVAPAEEVARAVALALEGGECTARGRRKGTQLLKTLEE  301



>ref|XP_009141534.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Brassica rapa]
 emb|CDY40422.1| BnaA04g20950D [Brassica napus]
Length=412

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 90/167 (54%), Gaps = 7/167 (4%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  280
            +F  +V IL+  +S ++A K  +  L  +C   + RHKAV AGA+  +I+ L D     D
Sbjct  233  VFTEVVQILDDRIS-NKATKAALHILVNICPWGRNRHKAVEAGAISMMIELLMDESFSSD  291

Query  281  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  454
            +   E A+  ++LLC+   G A F  H   + ++ K IL+IS  A++ A   LLS+    
Sbjct  292  RRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRISQTASDRAVRVLLSVGRFC  351

Query  455  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
            A+     E    GV+++L L++Q +C  + K KA+ LLKL    W +
Sbjct  352  ATPSLLHEMLQLGVVSKLCLVLQVNCGSKTKEKAKELLKLHARVWKD  398



>ref|XP_002873519.1| hypothetical protein ARALYDRAFT_487992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49778.1| hypothetical protein ARALYDRAFT_487992 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 74/145 (51%), Gaps = 8/145 (6%)
 Frame = +2

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            K   K L ALCLA+  RH AV AGA  A+I+     +    ERALA +EL+C    G A 
Sbjct  159  KYVTKILLALCLAEGNRHVAVEAGAARAVIETAAGLEISAVERALAALELMCTTAEGAAE  218

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaq-------reaaaaGVMTQL  508
               HA+TVP +V ++ +++ R  EYA  ++LSI                 A A  V   +
Sbjct  219  VRGHAMTVPAMVAVMARLAGRGREYAI-SILSIVYGKAGGGGDSGEEIAVAPAEEVARAV  277

Query  509  LLLVQSDCTERAKRKAQMLLKLLRD  583
             L ++ +CT R +RK   LLK L +
Sbjct  278  ALALEGECTARGRRKGAQLLKTLEE  302



>ref|XP_011022933.1| PREDICTED: U-box domain-containing protein 26-like [Populus euphratica]
Length=397

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 111/189 (59%), Gaps = 7/189 (4%)
 Frame = +2

Query  44   LIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRH  223
            +IE++ S   + EL A++ N  ++ +G++ +++     S A   G+KA+ ALC  +  R 
Sbjct  208  IIEAISSSLETRELCAKLGNNRKLLKGLILLVHQTYGASEA---GIKAISALCCLESNRE  264

Query  224  KAVTAGAVEALIDRL---QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKII  394
              V  G +  L+  +   Q  ++  A +A+AT+ELL  + S   A       +  L+K++
Sbjct  265  NMVQEGGINGLLTYIYEAQRHERNLAPKAMATIELLLGLESAKEALINDPNGIKALIKMV  324

Query  395  LKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLK  571
             ++S H+ +E A  +L+ IC+ S QA+ EA  AGV+TQLLLL+QS C+ R K KA+MLLK
Sbjct  325  FRVSDHQGSESAIRSLMIICTDSLQAREEAIGAGVLTQLLLLLQSQCSGRTKTKARMLLK  384

Query  572  LLRDCWPED  598
            LL   W E+
Sbjct  385  LLGSKWDEE  393



>ref|XP_009133058.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Brassica rapa]
Length=409

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 88/167 (53%), Gaps = 7/167 (4%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  280
            +F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D     D
Sbjct  230  VFTEVVQILDDRISH-KATKAAMHVLVTICPWGRNRHKAVEAGAISVIIELLMDESFSSD  288

Query  281  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  454
            +   E A+  +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+    
Sbjct  289  RRGPEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFC  348

Query  455  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
            A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  349  ATPALLHEMLQLGVVEKLFLVLQISCGSKTKEKAKELLKLHARVWKD  395



>ref|XP_002965206.1| hypothetical protein SELMODRAFT_439085 [Selaginella moellendorffii]
 gb|EFJ34044.1| hypothetical protein SELMODRAFT_439085 [Selaginella moellendorffii]
Length=567

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 69/125 (55%), Gaps = 13/125 (10%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA  292
            I    V +L  P + ++ +++ +K++  +CL+K  R  AV AGAVEAL+D L D    D 
Sbjct  319  ILGACVALLKDPSAEAKLVRLALKSMLGICLSKPNRIPAVKAGAVEALLDTLVDLHGVDG  378

Query  293  -------------ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAG  433
                         ERALAT+ELLC    G AA  +    +  LV ++L +S RATEYAAG
Sbjct  379  GEFCSKSGIVVNVERALATLELLCTSSEGRAAICSQPNFISELVGLVLGVSERATEYAAG  438

Query  434  ALLSI  448
             L ++
Sbjct  439  VLCAV  443



>ref|XP_008680442.1| PREDICTED: U-box domain-containing protein 26-like [Zea mays]
Length=360

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = +2

Query  380  LVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQ  559
            +  ++  +S RA E+AAGAL+++   SE  Q EA  AG M QLL++VQ  C+ERAKRKAQ
Sbjct  275  VTALVRAMSGRAAEHAAGALVAVVGGSEALQVEAVRAGAMGQLLMMVQGGCSERAKRKAQ  334

Query  560  MLLKLLRDCWP-EDFTGISDDYNCSY  634
             LLKLLR  WP  D T  SDD+   Y
Sbjct  335  HLLKLLRSAWPTTDCTANSDDFLQHY  360



>ref|XP_009367895.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
26 [Pyrus x bretschneideri]
Length=305

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 81/145 (56%), Gaps = 5/145 (3%)
 Frame = +2

Query  164  ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGC  343
            A K   K L ALCLA+  RH AV +GA  A+++   + +   AER+LA +EL+C +  G 
Sbjct  160  AAKPATKILLALCLAEGNRHVAVESGAAAAVVETALELEAASAERSLAALELMCTVAEGA  219

Query  344  AAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC-----saseqaqreaaaaGVMTQL  508
            AA  AHA+ VP++V I+ + S R  EYA G L  I        + +A   A    V   +
Sbjct  220  AAVRAHAMAVPVMVMIMGRTSARGKEYAIGVLAVIYGGGDDEEAAEAVAAAPREEVARAV  279

Query  509  LLLVQSDCTERAKRKAQMLLKLLRD  583
             L +Q DC+ R +RK   LLK+L++
Sbjct  280  ELALQGDCSGRGRRKGAQLLKVLQE  304



>emb|CDX84587.1| BnaA03g16430D [Brassica napus]
Length=409

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 88/167 (53%), Gaps = 7/167 (4%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  280
            +F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D     D
Sbjct  230  VFTEVVQILDDRISH-KATKAAMHVLVTICPWGRNRHKAVEAGAISVIIELLMDESFSSD  288

Query  281  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  454
            +   E A+  +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+    
Sbjct  289  RRGPEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFC  348

Query  455  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
            A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  349  ATPALLHEMLQLGVVEKLFLVLQISCGSKTKEKAKELLKLHARVWKD  395



>emb|CDY32070.1| BnaC04g44960D [Brassica napus]
Length=412

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 89/167 (53%), Gaps = 7/167 (4%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  280
            +F  +V IL   +S+ +A K  +  L  +C   + RHKAV AGA+  +I+ L D     D
Sbjct  233  VFTEVVQILEDRISH-KATKAALHILVNICPWGRNRHKAVEAGAIYVMIELLMDESFSSD  291

Query  281  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  454
            +   E A+  ++LLC+   G A F  H   + ++ K IL+IS  A++ A   LLS+    
Sbjct  292  RRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRISQTASDRAVRVLLSVGRFC  351

Query  455  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
            A+     E    GV+++L L++Q +C  + K KA+ LLKL    W +
Sbjct  352  ATPALLHEMLQLGVVSKLCLVLQVNCGSKTKEKAKELLKLHARVWKD  398



>ref|XP_006403803.1| hypothetical protein EUTSA_v10010389mg [Eutrema salsugineum]
 dbj|BAJ34414.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45256.1| hypothetical protein EUTSA_v10010389mg [Eutrema salsugineum]
Length=435

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  255  ELFNEVVQILHDQISH-KATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSS  313

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  457
            ++ ++E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  314  ERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSIGRF  373

Query  458  seq--aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
                   +E    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPCLLQEMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>emb|CDX85708.1| BnaA02g01050D [Brassica napus]
Length=308

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 4/142 (3%)
 Frame = +2

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            K   K L ALCLA+  R  AV AGA  A+++     +    ERALA +EL+C    G A 
Sbjct  156  KYVTKILLALCLAEGNRRVAVEAGAARAVVETAAGLENSAVERALAALELMCTTAEGAAE  215

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaG----VMTQLLLL  517
              AHA+TVP +V ++ +++ R  EYA   L  +         E         V   + L 
Sbjct  216  VRAHAMTVPAMVAVMARLAGRGREYAISILAVVYGRGGAFSGEEITVAPAEEVARAVALA  275

Query  518  VQSDCTERAKRKAQMLLKLLRD  583
            ++ +CT R +RK   LLK L +
Sbjct  276  LEGECTARGRRKGAHLLKTLEE  297



>ref|XP_009125812.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Brassica rapa]
Length=308

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 4/142 (3%)
 Frame = +2

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            K   K L ALCLA+  R  AV AGA  A+++     +    ERALA +EL+C    G A 
Sbjct  156  KYVTKILLALCLAEGNRRVAVEAGAARAVVETAAGLENSAVERALAALELMCTTAEGAAE  215

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaG----VMTQLLLL  517
              AHA+TVP +V ++ +++ R  EYA   L  +         E         V   + L 
Sbjct  216  VRAHAMTVPAMVAVMARLAGRGREYAISILAVVYGRGGAFSGEEITVAPAEEVARAVALA  275

Query  518  VQSDCTERAKRKAQMLLKLLRD  583
            ++ +CT R +RK   LLK L +
Sbjct  276  LEGECTARGRRKGAHLLKTLEE  297



>emb|CDY68531.1| BnaCnng59400D [Brassica napus]
Length=304

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 79/155 (51%), Gaps = 4/155 (3%)
 Frame = +2

Query  131  GILNCPLSYS-RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALA  307
            G+++C  S S    K   K L ALCLA+  RH AV AGA  A+++     +    ERALA
Sbjct  139  GLVSCLRSNSIVTAKYATKILLALCLAEGNRHVAVEAGAARAVVETAAGLEISAVERALA  198

Query  308  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsas---eqaqre  478
             +EL+C    G A    HA+TVP +V ++ +++ R  E A   L  +        +    
Sbjct  199  ALELMCTTAEGAAEVRGHAMTVPAMVAVMARLAGRGRENAISILAVVYGRGGVDGEEIAV  258

Query  479  aaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRD  583
            A A  V   + L ++ +CT R +RKA  LLK L +
Sbjct  259  APAEEVARAVALALEGECTARGRRKAAHLLKTLEE  293



>ref|XP_006841078.1| hypothetical protein AMTR_s00086p00031680 [Amborella trichopoda]
 gb|ERN02753.1| hypothetical protein AMTR_s00086p00031680 [Amborella trichopoda]
Length=351

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 91/180 (51%), Gaps = 7/180 (4%)
 Frame = +2

Query  80   ELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALI  259
            E RA I  A  I E +V +L   L   R  K    ALF LC  ++ + +AV AGAV+ LI
Sbjct  179  ENRAPIGCAGAI-EPLVNLLA--LGSFRGKKDAAAALFTLCSVRENKLRAVKAGAVKPLI  235

Query  260  DRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGAL  439
            + + DF     E+A   +++L  I    AA       +P+LV+II   SHR  E+A G L
Sbjct  236  EYMADFSSGMLEKAALVLDVLVGIREAKAAVVEEG-GIPVLVEIIEVGSHRQKEFAVGIL  294

Query  440  LSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDD  619
            L +C  S   +   A  G +  L+ L Q+  T RA++KA+ L+  LR   P      SDD
Sbjct  295  LQLCEESSVYRTLVAREGAIPPLVALSQNGTT-RARQKAETLIPFLR--QPRSGFHRSDD  351



>gb|KDO79762.1| hypothetical protein CISIN_1g044095mg [Citrus sinensis]
Length=308

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 78/144 (54%), Gaps = 2/144 (1%)
 Frame = +2

Query  194  ALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTV  373
            ALCLA+  R  AV AGAV A+I+ + + D    ERALA +EL+C +  G     AHAL V
Sbjct  163  ALCLAESNRRVAVEAGAVGAVIEVVAELDAAAGERALAALELMCTVAEGAEETRAHALAV  222

Query  374  PLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRK  553
            P++V ++ +++ R  EYA   L  I    +Q    A    V   + L +Q +CT R +RK
Sbjct  223  PVMVTMMGQMAGRGKEYAISVLAVIYGGGDQLVVAAPPEEVARAVELALQGNCTPRGRRK  282

Query  554  AQMLLKLLRDCWPEDFTGISDDYN  625
               LLK L++    D T   D+ N
Sbjct  283  GTQLLKSLKEYGQPDTT--QDEMN  304



>ref|XP_006380377.1| hypothetical protein POPTR_0007s04220g [Populus trichocarpa]
 gb|ERP58174.1| hypothetical protein POPTR_0007s04220g [Populus trichocarpa]
Length=397

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 110/189 (58%), Gaps = 7/189 (4%)
 Frame = +2

Query  44   LIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRH  223
            +IE++ S   + EL A++    ++ +G++ +++     S A   G+KA+ ALC  +  R 
Sbjct  208  IIEAISSSLETRELCAKLGKNRKLLKGLILLVHQTYGASEA---GIKAISALCCLESNRE  264

Query  224  KAVTAGAVEALIDRLQDFDKCD---AERALATVELLCRIPSGCAAFAAHALTVPLLVKII  394
              V  G +  L+  + D  + +   A +A+AT+ELL  + S   A       +  L+K++
Sbjct  265  NMVQEGGINGLLTYIYDAQRHERNLAPKAMATIELLLGLESAKEALINDPNGIKALIKMV  324

Query  395  LKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLK  571
             ++S H+ +E A  +L+ IC+ S QA+ EA  AGV+TQLLLL+QS C+ R K KA+MLLK
Sbjct  325  FRVSDHQGSESAIRSLMIICTDSLQAREEAIGAGVLTQLLLLLQSQCSGRTKTKARMLLK  384

Query  572  LLRDCWPED  598
            LL   W E+
Sbjct  385  LLGSKWDEE  393



>ref|XP_009136678.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Brassica rapa]
Length=423

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 89/168 (53%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S+ +A    ++ L  +C   + RHKAV AGAV  +I+ L D     
Sbjct  243  ELFNEVVQILSDQISH-KATTSAMQILVIICPWGRNRHKAVAAGAVSMIIELLMDETFSS  301

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  457
            ++ ++E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  302  ERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSIGRF  361

Query  458  seq--aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
                   +E    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  362  CATPCLLQEMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  409



>gb|KFK34491.1| hypothetical protein AALP_AA5G152500 [Arabis alpina]
Length=439

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 91/168 (54%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  ++ IL+  +S  +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  255  ELFVEVIQILHDQIS-QKATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDDTFSS  313

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++ ++E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  314  ERRNSEMAMVVLDMLCQCAEGRAEFLHHGAAIAVVSKKILRVSQITSERAVRVLLSIGRF  373

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+    +E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>ref|XP_010526330.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Tarenaya hassleriana]
Length=434

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 92/169 (54%), Gaps = 9/169 (5%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  289
            +IF  +V IL+  +S ++A K  ++ L  +C   + RHKAV AGA+  +I+ L D +   
Sbjct  254  DIFAEVVQILHDQIS-NKATKSALRILVNICPWGRNRHKAVEAGAISVIIELLMD-ETFS  311

Query  290  AER-----ALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs  454
            +ER     A+  ++LLC+   G A F  H   + ++ K IL++S  A+E A   LLS+  
Sbjct  312  SERRIPEMAMVVLDLLCQCAEGRAEFLNHGAGIAVVSKKILRVSQTASERAVRVLLSVGR  371

Query  455  --aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
              A+    +E    GV+ +L L++Q  C  + K KA+ LL+L    W E
Sbjct  372  FCATPFLLQEMLQLGVVAKLCLVLQVSCGNKTKEKARELLRLHARVWRE  420



>ref|XP_009419493.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 107/208 (51%), Gaps = 7/208 (3%)
 Frame = +2

Query  32   NSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAK  211
            ++A LI + L G   P     I    E+F+ IV ++   +S  +A K  + AL  LCL  
Sbjct  208  SNAMLILNSLLGVIPPA--RSIGLGGELFQEIVNVVRDRIS-QQATKAALHALLRLCLYG  264

Query  212  QYRHKAVTAGAVEALID-RLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVK  388
            + R KAV AGAV AL++  L+   K   E ALA ++ LC    G A    H   +P + K
Sbjct  265  KSRVKAVEAGAVHALVELLLESPQKRVCELALAGLDWLCGCADGRAELVRHRAAIPAVSK  324

Query  389  IILKISHRATEYAAGALLSICsaseqaq--reaaaaGVMTQLLLLVQSDCTERAKRKAQM  562
             IL++S  A+E A   L S+   S  A   +E    GV+++L L++Q  C  + + KA+ 
Sbjct  325  KILRVSQLASEKAVRILHSVARHSATAAVLQEMMNVGVVSKLCLVLQVGCGGKMEEKARE  384

Query  563  LLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            +LKL    W +D   +S  Y+ +Y + +
Sbjct  385  ILKLHSRVW-KDSPCLSPLYSSTYPMSY  411



>ref|XP_009125026.1| PREDICTED: U-box domain-containing protein 4 [Brassica rapa]
Length=344

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (54%), Gaps = 1/140 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            RA K    AL++LC AK+ + +AV AG ++ L++ + DF     +++   + LL  +P  
Sbjct  199  RAKKDASTALYSLCSAKENKIRAVEAGIMKPLVELMADFGSNMVDKSAFVMSLLMSVPES  258

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
             AA       VP+LV+I+   + R  E A   LL IC  S   +   A  G +  L+ L 
Sbjct  259  KAAVVEEG-GVPVLVEIVEDGTQRQKEMAVSILLQICEESVVYRTMVAREGAIPPLVALS  317

Query  521  QSDCTERAKRKAQMLLKLLR  580
            Q+  T RAK KA+ L++LLR
Sbjct  318  QAGGTSRAKHKAEALIELLR  337



>ref|XP_004511816.1| PREDICTED: U-box domain-containing protein 30-like [Cicer arietinum]
Length=449

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 102/192 (53%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  S++ ++N   LIES++      + R++I ++  +  G++ ++     +S  +  G+
Sbjct  241  LNEGSIETKINCTRLIESLI---EEKDFRSEIISSHSLLVGLMRLVK-DKRHSNGICPGL  296

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L  +C  K+ +   V+ GAV  L++ L   +    E AL  ++ L  IP G  A    
Sbjct  297  SLLRTVCFYKEVKSLLVSIGAVSQLVELLSGMEHECLELALCVLDSLSSIPEGRVALKDC  356

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
              T+P++VK++++IS   T+YA   L S+C  + +     A  AG+  +LLL++QS C  
Sbjct  357  VRTIPIMVKLLMRISENCTQYALSILWSVCKLAPEECSSIAVDAGLAAKLLLVIQSGCNP  416

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  417  ILKQQSAELLKL  428



>ref|XP_008393879.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase PUB23 
[Malus domestica]
Length=330

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 81/145 (56%), Gaps = 5/145 (3%)
 Frame = +2

Query  164  ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGC  343
            A K   K L ALCLA+  RH AV +GA  A+++   + +   AER+LA +EL+C +  G 
Sbjct  185  AAKPATKILLALCLAEGNRHVAVESGAAAAVVETALELEAASAERSLAALELMCTVAEGA  244

Query  344  AAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLL----  511
            AA  AHA+ VP++V I+ + S R  EYA G L  I    +  Q   A A    + +    
Sbjct  245  AAVRAHAMAVPVMVMIMGRTSARGXEYAIGVLAVIYGGGDDEQAAEAVAAAPPEEVARAV  304

Query  512  -LLVQSDCTERAKRKAQMLLKLLRD  583
             L +Q DC+ R +RK   LLK+L++
Sbjct  305  ELALQGDCSGRGRRKGAQLLKVLQE  329



>ref|XP_006295808.1| hypothetical protein CARUB_v10024934mg [Capsella rubella]
 gb|EOA28706.1| hypothetical protein CARUB_v10024934mg [Capsella rubella]
Length=408

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 88/168 (52%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     
Sbjct  228  EVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSS  286

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  287  DRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKY  346

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+     E    GV+++L L++Q  C  + K KA+ LLKL    W +
Sbjct  347  CATPALLNEMLQLGVVSKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  394



>gb|KHN13011.1| U-box domain-containing protein 30 [Glycine soja]
Length=449

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 104/192 (54%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  S++ ++N   LIES++      + R+++  +  +  G++ ++     ++  +  G+
Sbjct  241  LNEGSIETKINCTRLIESLI---EEKDFRSEVILSHSLLVGLMRLVK-DKRHNNGVCPGL  296

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L  +CL K+ R+  V+ GAV  L++ L   +    E AL  ++ L  +P G  A    
Sbjct  297  SLLRTICLHKEVRNLLVSIGAVSQLVELLSGMEPDCLELALCVLDALASVPEGRVALKDC  356

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
            + T+P++VK++++IS   T+YA   L S+C  S +     A  AG+  +LLL++QS C  
Sbjct  357  SNTIPIMVKLLMRISENCTQYALSILWSVCKLSPEECSSIAVDAGLAAKLLLVIQSGCNP  416

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  417  ILKQQSAELLKL  428



>emb|CDX91209.1| BnaC02g03880D [Brassica napus]
Length=310

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 4/142 (3%)
 Frame = +2

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            K   K L ALCLA+  R  AV AGA  A+++     +    ERALA +EL+C    G A 
Sbjct  158  KYVTKILLALCLAECNRRVAVEAGAARAVVETAAGLENSAVERALAALELMCTTAEGAAE  217

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaG----VMTQLLLL  517
              AHA+TVP +V ++ +++ R  EYA   L  +         E         V   + L 
Sbjct  218  VRAHAMTVPAMVAVMARLAGRGREYAISILAVVYGRGGAFSGEEITVAPAEEVARAVALA  277

Query  518  VQSDCTERAKRKAQMLLKLLRD  583
            ++ +CT R +RK   LLK L +
Sbjct  278  LEGECTARGRRKGAHLLKTLEE  299



>ref|XP_003539260.2| PREDICTED: U-box domain-containing protein 30-like [Glycine max]
Length=514

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 104/192 (54%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  S++ ++N   LIES++      + R+++  +  +  G++ ++     ++  +  G+
Sbjct  306  LNEGSIETKINCTRLIESLI---EEKDFRSEVILSHSLLVGLMRLVK-DKRHNNGVCPGL  361

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L  +CL K+ R+  V+ GAV  L++ L   +    E AL  ++ L  +P G  A    
Sbjct  362  SLLRTICLHKEVRNLLVSIGAVSQLVELLSGMEPDCLELALCVLDALASVPEGRVALKDC  421

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
            + T+P++VK++++IS   T+YA   L S+C  S +     A  AG+  +LLL++QS C  
Sbjct  422  SNTIPIMVKLLMRISENCTQYALSILWSVCKLSPEECSSIAVDAGLAAKLLLVIQSGCNP  481

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  482  ILKQQSAELLKL  493



>emb|CDY28679.1| BnaCnng05650D [Brassica napus]
Length=263

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 75/140 (54%), Gaps = 1/140 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            RA K    AL++LC AK+ + +AV +G ++ L++ + DF     +++   + LL  +P  
Sbjct  118  RAKKDASTALYSLCSAKENKIRAVESGIMKPLVELMADFGSNMVDKSAFVMSLLMSVPES  177

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
             AA       VP+LV+I+   + R  E A   LL IC  S   +   A  G +  L+ L 
Sbjct  178  KAAVVEEG-GVPVLVEIVEDGTQRQKEMAVSILLQICEESVVYRTMVAREGAIPPLVALS  236

Query  521  QSDCTERAKRKAQMLLKLLR  580
            Q+  T RAK KA+ L++LLR
Sbjct  237  QAGGTSRAKHKAEALIELLR  256



>emb|CDY59599.1| BnaCnng35300D [Brassica napus]
Length=409

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  229  ELFNEVVQILHDQISH-KATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSS  287

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++   E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  288  ERRTLEMAMVVLDMLCQCAEGRAEFLNHCAAIAVVSKKILRVSQITSERAVRVLLSIGRF  347

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+    ++    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  348  CATPSLLQDMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  395



>emb|CDX78096.1| BnaA09g32910D [Brassica napus]
Length=389

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  209  ELFNEVVQILHDQISH-KATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSS  267

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++   E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  268  ERRTLEMAMVVLDMLCQCAEGRAEFLNHCAAIAVVSKKILRVSQITSERAVRVLLSIGRF  327

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+    ++    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  328  CATPSLLQDMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  375



>ref|XP_010509533.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Camelina sativa]
Length=416

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 87/168 (52%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     
Sbjct  236  EVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSS  294

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  295  DRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKF  354

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  355  CATPALLNEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  402



>ref|XP_010505120.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Camelina sativa]
Length=416

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 87/168 (52%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     
Sbjct  236  EVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSS  294

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  295  DRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKF  354

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  355  CATPALLNEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  402



>gb|KJB48752.1| hypothetical protein B456_008G084500 [Gossypium raimondii]
Length=471

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 102/192 (53%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  SV+ ++N   LIE ++      E RA+  ++  +  G++ ++     ++  +  G+
Sbjct  263  LNEGSVETKINCTRLIEKLM---EEKEFRAESISSHRLLVGLMRLVK-DKRHTNGILPGL  318

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L ++CL KQ     V+ GAV  L++ L   +    E AL  +++L  +P G AA    
Sbjct  319  SLLRSICLHKQVMGLIVSIGAVSQLVELLPALEPDCLELALFILDILSSLPEGKAALKDC  378

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
              T+P +V+++++IS   T+YA   L S+C  + +     A  AG+  +LLL++QS C  
Sbjct  379  GNTIPNMVRLLMRISESCTQYALSILWSVCKLAPEECSSVAVEAGLAAKLLLVIQSGCNP  438

Query  539  RAKRKAQMLLKL  574
              K+K+  LLKL
Sbjct  439  VLKQKSSELLKL  450



>ref|XP_010541260.1| PREDICTED: formin-binding protein 4 [Tarenaya hassleriana]
Length=313

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 88/160 (55%), Gaps = 2/160 (1%)
 Frame = +2

Query  131  GILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALA  307
            G++ C  +  R A K   K+L ALCLA+  R  AV AGA  A+++ +   +   AERALA
Sbjct  150  GLVRCLRTTDRSAAKHASKSLLALCLAESNRRVAVEAGAAGAVVETVAGLEDASAERALA  209

Query  308  TVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaa  487
             +EL+C +P G A    HA+TVP++V ++ +++ R  EYA   L  +     +    AA 
Sbjct  210  ALELVCTVPEGAAEVRTHAMTVPVMVAVMARLAGRGREYAMSILAVVYGGGGEEIPAAAP  269

Query  488  aGVMTQLL-LLVQSDCTERAKRKAQMLLKLLRDCWPEDFT  604
            A  + + + L +Q +CT R +RK   LLK L +    D +
Sbjct  270  AEEVARAVALALQGECTARGRRKGAQLLKTLEEYGRSDLS  309



>ref|XP_010516800.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Camelina sativa]
Length=416

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 87/168 (52%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     
Sbjct  236  EVFTEVVEILDDRIS-RKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFSS  294

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            D+   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  295  DRRGPEMAMVVLDLLCQCAEGRAEFLKHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKF  354

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  355  CATPALLNEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  402



>ref|XP_006382863.1| hypothetical protein POPTR_0005s06470g [Populus trichocarpa]
 gb|ERP60660.1| hypothetical protein POPTR_0005s06470g [Populus trichocarpa]
Length=390

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 109/186 (59%), Gaps = 7/186 (4%)
 Frame = +2

Query  44   LIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRH  223
            +IE++ S   + EL A++    ++ +G++ +++     S A   G+KA+ ALC  +  R 
Sbjct  207  VIEAISSSLETRELCAKLGKNRKLLKGLILLVHQTYEASDA---GIKAISALCCLESNRQ  263

Query  224  KAVTAGAVEALIDRLQDFDKCD---AERALATVELLCRIPSGCAAFAAHALTVPLLVKII  394
              V  G +  L+  + D ++ +   A +AL+T+ELL  + S  AA   +   +  L+K++
Sbjct  264  NLVQEGVINRLLTYIFDAERHERNLAPKALSTIELLLELESAKAALINNPNGIKALIKMV  323

Query  395  LKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLK  571
             + S H  +E A  +L  IC+ S QA+ EA  AGV+TQLLLL+QS C+ R K KA+MLLK
Sbjct  324  FRFSEHEGSESAVRSLTIICTDSLQAREEAIGAGVLTQLLLLLQSQCSARTKTKARMLLK  383

Query  572  LLRDCW  589
            LLR  W
Sbjct  384  LLRSRW  389



>emb|CDX95337.1| BnaC04g28210D [Brassica napus]
Length=409

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 88/168 (52%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGA----VEALIDRLQDF  277
            E+F  +V IL+  +S+ +A K  ++ L   C   + RHKAV AGA    +E L+D     
Sbjct  229  ELFTEVVQILHDQISH-KATKSAMQILMITCPWGRNRHKAVEAGAASMIIELLLDESFSS  287

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  457
            ++ + E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLS+   
Sbjct  288  ERRNVEMAMVVLDVLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSVGRF  347

Query  458  seq--aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
                   +E    GV+ +L L++Q+ C  + K KA+ LLKL    W E
Sbjct  348  CATPCLLQEMLQLGVVAKLCLVLQASCGNKTKEKAKELLKLHARVWRE  395



>ref|XP_009115945.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Brassica rapa]
Length=435

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  255  ELFNEVVQILHDQISH-KATKSAMQILVIICPWGRNRHKAVEAGAISMIIELLMDETFSS  313

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++   E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLSI   
Sbjct  314  ERRTLEMAMVVLDMLCQCAEGRAEFLNHCAAIAVVSKKILRVSQITSERAVRVLLSIGRF  373

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+    ++    GV+ ++ L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPSLLQDMLQLGVVAKMCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>ref|XP_009396054.1| PREDICTED: U-box domain-containing protein 4-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 81/147 (55%), Gaps = 2/147 (1%)
 Frame = +2

Query  158  SRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPS  337
            SR  K  +  L+ LC A++ + +AV+AGAV  L++ + +     AE+AL  +  L  +P 
Sbjct  295  SRGKKDALTTLYKLCSARRNKERAVSAGAVPPLVELVAERGGGTAEKALVVLGSLAAVPE  354

Query  338  GCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLL  517
            G AA    A  +P+LV  +     R  E+A  ALL +C+ SE+ +      GV+  L+ L
Sbjct  355  GRAAV-VEAGGIPVLVDAVEAGPTRGREFAVHALLQLCADSERNRGLVVGEGVIPPLVAL  413

Query  518  VQSDCTERAKRKAQMLLKLLRDCWPED  598
             Q+  + RAK KA+ LL+ LR+   +D
Sbjct  414  SQTGSS-RAKHKAETLLRFLREQRQDD  439



>ref|XP_003526867.1| PREDICTED: U-box domain-containing protein 25-like isoform X1 
[Glycine max]
 ref|XP_006581770.1| PREDICTED: U-box domain-containing protein 25-like isoform X2 
[Glycine max]
Length=394

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 104/198 (53%), Gaps = 11/198 (6%)
 Frame = +2

Query  23   VRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGIL--NCPLSYSRALKIGVKALFA  196
            V+ +   LI+S  S  ++ E+   + ++ ++   IV ++  NC +S      + +KA+ A
Sbjct  198  VKTSLCHLIDSTAS-PQTEEVCHMLGHSHKLVHEIVVLVRQNCEVSKV----VAIKAMLA  252

Query  197  LCLAKQYRHKAVTAGAVEALIDRL---QDFDKCDAERALATVELLCRIPSGCAAFAAHAL  367
            LC  +  R   V  GA++  I  +   +   K  A  A+A ++ L  + S   A   H  
Sbjct  253  LCSLQSNRENLVREGAIDGAITYISGCETRQKNAAPLAMAIIKKLLVLDSAKEALVNHPN  312

Query  368  TVPLLVKIILKI-SHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERA  544
             V  LVK++ ++ +   +E A G L  +C    +A+ EA  AGV+TQLL L+QS C  + 
Sbjct  313  GVETLVKMVFRVCNQECSESAVGILAIVCCDFGRAREEAIGAGVLTQLLFLLQSQCGTKT  372

Query  545  KRKAQMLLKLLRDCWPED  598
            K KA+MLLKLLR  W E+
Sbjct  373  KTKARMLLKLLRSKWIEE  390



>gb|KFK36486.1| hypothetical protein AALP_AA4G130900 [Arabis alpina]
Length=412

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 89/168 (53%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S+ +A+K  +  L  +C   + RHKAV A A+  +I+ L D     
Sbjct  232  EVFIEVVQILDDQISH-KAMKAAMHILVNICPWGRNRHKAVDAAAISVIIELLMDESFSS  290

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++   E AL  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  291  ERRGPEMALVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGKF  350

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+     E    GV+ ++ L++Q  C  + K KA+ LLKL    W +
Sbjct  351  CATPNLLNEMLQLGVVAKMCLVLQVSCGSKTKDKAKELLKLHARVWKD  398



>ref|XP_002262704.2| PREDICTED: U-box domain-containing protein 26-like [Vitis vinifera]
Length=399

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 108/183 (59%), Gaps = 7/183 (4%)
 Frame = +2

Query  44   LIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRH  223
            L+E++ S + + EL A +    ++ +GIV +++     S A   G+KA+ ALC  +  + 
Sbjct  211  LLEAISSSSETKELCATLGTTHQLLQGIVLLVHHDCEASEA---GIKAMLALCSVESNKE  267

Query  224  KAVTAGAVEALIDRL---QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKII  394
              +  GAV+ LI  +   Q  +K  A  A+A +E+L  + SG  A   +   V  LVK+ 
Sbjct  268  NLIREGAVDGLISYISNAQVKEKSAAPLAIAVLEVLLGVESGREAVLNNPNGVKALVKMT  327

Query  395  LKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLK  571
             K+S H+ +E A  +L+ +C+ S +A+ EA +AGV++QLL L+QS C+   K KA+MLLK
Sbjct  328  FKVSDHQGSENAVSSLMVLCTDSLRAREEAISAGVLSQLLFLLQSQCSGTIKTKARMLLK  387

Query  572  LLR  580
            LLR
Sbjct  388  LLR  390



>emb|CAN66286.1| hypothetical protein VITISV_011184 [Vitis vinifera]
Length=397

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 108/183 (59%), Gaps = 7/183 (4%)
 Frame = +2

Query  44   LIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRH  223
            L+E++ S + + EL A +    ++ +GIV +++     S A   G+KA+ ALC  +  + 
Sbjct  206  LLEAISSSSETKELCATLGTTHQLLQGIVLLVHHDCEASEA---GIKAMLALCSVESNKE  262

Query  224  KAVTAGAVEALIDRL---QDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKII  394
              +  GAV+ LI  +   Q  +K  A  A+A +E+L  + SG  A   +   V  LVK+ 
Sbjct  263  NLIREGAVDGLISYISNAQVKEKSAAPLAIAVLEVLLGVESGREAVLNNPNGVKALVKMT  322

Query  395  LKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLK  571
             K+S H+ +E A  +L+ +C+ S +A+ EA +AGV++QLL L+QS C+   K KA+MLLK
Sbjct  323  FKVSDHQGSENAVSSLMVLCTDSLRAREEAISAGVLSQLLFLLQSQCSGTIKTKARMLLK  382

Query  572  LLR  580
            LLR
Sbjct  383  LLR  385



>gb|AES94509.2| E3 ubiquitin ligase PUB14 [Medicago truncatula]
Length=451

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 102/192 (53%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  S++ ++N   LIE+++      + R++I ++  +  G++ ++     +S  +  G+
Sbjct  243  LNEGSIETKINCTRLIETLI---EEKDFRSEIISSHSLLVGLMRLVK-DKRHSNGICPGL  298

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L  +C  K+ +   V+ GAV  L++ L   D    E AL  ++ L  IP G  A    
Sbjct  299  SLLRTVCFYKEVKILLVSIGAVSQLVELLSGMDHDCLELALCVLDSLSSIPEGRVALKEC  358

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
              T+P++V+++++IS   T+YA   L S+C  + +     A  AG+  +LLL++QS C  
Sbjct  359  VNTIPIMVRLLMRISESCTQYALSILWSVCKLAPEECSSIAVDAGLAAKLLLVIQSGCNP  418

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  419  ILKQQSAELLKL  430



>ref|XP_011078792.1| PREDICTED: U-box domain-containing protein 26-like [Sesamum indicum]
Length=387

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 111/198 (56%), Gaps = 12/198 (6%)
 Frame = +2

Query  14   SVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALF  193
            S+ ++ +   ++E++ S  +  EL  ++  + ++ +G+V +L          + G++A+ 
Sbjct  198  SMSIKKSLCLMVEAISSSVQ--ELCEKLGMSVQLVQGLVHLLQ------HKSEAGIRAVS  249

Query  194  ALCLAKQYRHKAVTAGAVEALIDRLQDFD---KCDAERALATVELLCRIPSGCAAFAAHA  364
             L L ++ R      GAVE LID L   +   +  A  A++T+E L  +P+       H 
Sbjct  250  GLALMERNRENLAREGAVEGLIDYLSTAEIHKRSLAPMAMSTIENLLSVPTAKDVIINHP  309

Query  365  LTVPLLVKIILKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTER  541
              V  +VK++ ++S H+ +E A  +LL ICS S+ A+ +A   GV+TQLLLL+QS C  R
Sbjct  310  SGVKAIVKMVFRVSDHQGSESAVNSLLLICSDSKSAREKAIVDGVLTQLLLLLQSQCNGR  369

Query  542  AKRKAQMLLKLLRDCWPE  595
             K KA+MLLKLLR  W E
Sbjct  370  IKTKARMLLKLLRSMWNE  387



>gb|AEW09062.1| hypothetical protein CL3508Contig1_02, partial [Pinus radiata]
 gb|AFG50844.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50845.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50846.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50847.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50848.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50849.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50850.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50851.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50852.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50853.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50854.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50855.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50856.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
 gb|AFG50857.1| hypothetical protein CL3508Contig1_02, partial [Pinus taeda]
Length=117

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = +2

Query  293  ERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa--seq  466
            E  L  +E LCR   G AA A HAL VP++VK + + S  ATEYA GAL S+C    SE 
Sbjct  11   EPCLCLLESLCRCAEGRAAVAGHALAVPVIVKKMSRSSSLATEYALGALWSVCGHCRSEN  70

Query  467  aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL----RDC  586
              R AA +GV ++L  L+Q DCT +AK KA  L++L+    RDC
Sbjct  71   VHRYAAESGVCSKLFWLLQVDCTPKAKLKASDLIRLIHSTCRDC  114



>ref|XP_003611551.1| U-box domain-containing protein [Medicago truncatula]
Length=471

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 102/192 (53%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  S++ ++N   LIE+++      + R++I ++  +  G++ ++     +S  +  G+
Sbjct  243  LNEGSIETKINCTRLIETLI---EEKDFRSEIISSHSLLVGLMRLVK-DKRHSNGICPGL  298

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L  +C  K+ +   V+ GAV  L++ L   D    E AL  ++ L  IP G  A    
Sbjct  299  SLLRTVCFYKEVKILLVSIGAVSQLVELLSGMDHDCLELALCVLDSLSSIPEGRVALKEC  358

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
              T+P++V+++++IS   T+YA   L S+C  + +     A  AG+  +LLL++QS C  
Sbjct  359  VNTIPIMVRLLMRISESCTQYALSILWSVCKLAPEECSSIAVDAGLAAKLLLVIQSGCNP  418

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  419  ILKQQSAELLKL  430



>gb|EPS58757.1| hypothetical protein M569_16054 [Genlisea aurea]
Length=317

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 77/138 (56%), Gaps = 4/138 (3%)
 Frame = +2

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
            K L AL LA++ R  AV AGAV A+++ L D +   AER+LA +ELLC    G A   AH
Sbjct  166  KVLLALSLAEENRRVAVEAGAVTAVVEALADAETAAAERSLAALELLCTTAEGAAEVRAH  225

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaG----VMTQLLLLVQSD  529
            AL+VP++V+++ K+  R  E+A   L  I   S        A      V   ++L +Q +
Sbjct  226  ALSVPMMVQVMGKMEARGKEHALSVLGVIYGGSRSESESDVAVAPAEEVARAVMLALQGE  285

Query  530  CTERAKRKAQMLLKLLRD  583
            C+ R +RK   LLK L++
Sbjct  286  CSARGRRKGAQLLKTLQE  303



>ref|XP_010503987.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Camelina sativa]
Length=263

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  ++ IL+  +S+ +A +  ++ L  +C   + RHKAV AG +  +I+ L D     
Sbjct  83   ELFAEVLQILHDQISH-KATRSAMQILVIICPWGRNRHKAVEAGVISMIIELLMDETFSS  141

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++ + E A+  +++LC+   G + F  H   + L+ K IL++S   +E A   LLS+   
Sbjct  142  ERRNLEMAMVVLDMLCQCAEGRSEFLNHGAAIALVSKKILRVSQITSERAVRVLLSVGRF  201

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+    +E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  202  CATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWRE  249



>emb|CDX84168.1| BnaC04g09300D [Brassica napus]
Length=406

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 86/167 (51%), Gaps = 7/167 (4%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  280
            +F  +V IL+  +S+ +A K  +  L  +C   + RHKAV AG +  +I+ L D     D
Sbjct  227  VFTEVVQILDDRISH-KATKSALHILVNVCPWGRNRHKAVEAGVISMIIELLMDESFSSD  285

Query  281  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  454
            +   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   L S+    
Sbjct  286  RRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLFSVGRFC  345

Query  455  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
            A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  346  ATPALLNEMLQLGVVAKLCLVLQVSCGSKTKDKAKELLKLHARAWKE  392



>ref|XP_010541793.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Tarenaya hassleriana]
Length=433

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 86/166 (52%), Gaps = 7/166 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  289
            EIF  +  IL+  +S+ +A K  ++ L  +C   + RHKAV AGA+  +I+ L D     
Sbjct  253  EIFTEVFQILHDQISH-KATKSALQILVNICPWGRNRHKAVEAGAISVIIELLMDETFSS  311

Query  290  AERALATV----ELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
              R +  V    +LLC+   G A F  H   + ++ K IL++S  A+E A   LLS+   
Sbjct  312  VRRIIEMVMVVLDLLCQCAEGRAEFLNHGAAIAVVSKKILRVSQTASERAVRVLLSVGRF  371

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  589
             A+    +E    GV+ +L L++Q  C  + K KA+ LL+L    W
Sbjct  372  CATASLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLRLHARVW  417



>ref|XP_004498998.1| PREDICTED: U-box domain-containing protein 4-like [Cicer arietinum]
Length=349

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 76/140 (54%), Gaps = 2/140 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            RA K    AL++LC  K+ + +AV AG ++ L++ + DF+    +++   V +L  +P  
Sbjct  198  RAKKDASTALYSLCSVKENKMRAVKAGIMKVLVELMADFESNMVDKSAYVVSVLASVPEA  257

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
              A       VP+LV+I+   S R  E AA  LL IC  S   +   A  G +  L+ L 
Sbjct  258  KVALVEEG-GVPVLVEIVEVGSQRQKEIAAVILLQICEDSVAYRTMVAREGAIPPLVALT  316

Query  521  QSDCTERAKRKAQMLLKLLR  580
            QS  T RAK+KA+ L++LLR
Sbjct  317  QSG-TNRAKQKAEKLIELLR  335



>ref|XP_011031181.1| PREDICTED: U-box domain-containing protein 25-like isoform X2 
[Populus euphratica]
 ref|XP_011031182.1| PREDICTED: U-box domain-containing protein 25-like isoform X2 
[Populus euphratica]
Length=330

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 108/186 (58%), Gaps = 7/186 (4%)
 Frame = +2

Query  44   LIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRH  223
            +IE++ S   + EL A++    ++ +G++ +++     S A   G+KA+ ALC  +  R 
Sbjct  147  VIEAISSSLETRELCAKLGKNRKLLKGLILLVHQTHEASDA---GIKAISALCCLESNRQ  203

Query  224  KAVTAGAVEALIDRLQDFDKCD---AERALATVELLCRIPSGCAAFAAHALTVPLLVKII  394
              V  G +  L+  + D ++ +     +AL+T+ELL  + S  AA   +   +  L+K++
Sbjct  204  NLVQEGVINRLLTYIFDAERHERNLTPKALSTIELLLELESAKAALINNPNGIKALIKMV  263

Query  395  LKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLK  571
             + S H  +E A  +L  IC+ S QA+ EA  AGV+TQLLLL+QS C+ R K KA+MLLK
Sbjct  264  FRFSEHEGSESAVQSLTIICTDSLQARDEAIGAGVLTQLLLLLQSQCSARTKTKARMLLK  323

Query  572  LLRDCW  589
            LLR  W
Sbjct  324  LLRSRW  329



>gb|AEW09063.1| hypothetical protein CL3508Contig1_02, partial [Pinus lambertiana]
Length=117

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 69/117 (59%), Gaps = 10/117 (9%)
 Frame = +2

Query  254  LIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAG  433
            L++R    D    E  L  +E LCR   G AA A HAL VP++VK + + S  ATEYA G
Sbjct  2    LMEREAGVD----EPCLCLLESLCRCAEGRAAVAGHALAVPVIVKKMSRSSPLATEYALG  57

Query  434  ALLSICsa--seqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL----RDC  586
            AL S+C    SE   R AA +GV ++L  L+Q DCT +AK KA  L++L+    RDC
Sbjct  58   ALWSVCGHCRSENVHRYAAESGVCSKLFWLLQVDCTPKAKLKASDLIRLIHSTCRDC  114



>emb|CDX79645.1| BnaC03g19810D [Brassica napus]
Length=408

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 87/167 (52%), Gaps = 7/167 (4%)
 Frame = +2

Query  113  IFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----FD  280
            +F  +V IL+  +S+ +A K  +  L   C   + RHKAV AG +  +I+ L D     D
Sbjct  229  VFTEVVQILDDRISH-KATKAAMHILVTTCPWGRNRHKAVEAGVISVIIELLLDESFSSD  287

Query  281  KCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs--  454
            +   E A+  +++LC+   G A F  H   + ++ K IL++S  A++ A   LLS+    
Sbjct  288  RRGPEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFC  347

Query  455  aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
            A+    +E    GV+ ++ L++Q  C  + K KA+ LLKL    W +
Sbjct  348  ATPALLQEMLQLGVVEKMFLVLQVSCGSKTKEKAKELLKLHARVWKD  394



>ref|XP_009139452.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Brassica rapa]
Length=424

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 89/168 (53%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            ++F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGAV  +I+ L D     
Sbjct  244  DLFNEVVQILHDQISH-KATKSAMQILMIICPWGRNRHKAVEAGAVSMIIELLLDESFSS  302

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  457
            ++ + E  +  +++LC+   G A F  H   + ++ K IL++S   +E AA  LLS+   
Sbjct  303  ERRNVEMTMVVLDMLCQCAEGRADFLNHGAAIAVVSKKILRVSQITSERAARVLLSVGRF  362

Query  458  seq--aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
                   +E    GV+ +L L++Q  C  + K KA+ LL+L    W E
Sbjct  363  CATPCLLQEMLQLGVVAKLCLVLQVSCGNKTKGKAKELLQLHARVWRE  410



>ref|XP_002452587.1| hypothetical protein SORBIDRAFT_04g028560 [Sorghum bicolor]
 gb|EES05563.1| hypothetical protein SORBIDRAFT_04g028560 [Sorghum bicolor]
Length=462

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 90/183 (49%), Gaps = 3/183 (2%)
 Frame = +2

Query  38   AALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQY  217
            AA++   ++ +  PE    +S  D I + ++ +L  P+S        V A + +  +   
Sbjct  257  AAVVLREIASSSDPECLDAMSETDGIHDALIKLLQRPVSAQATKAAMVTAYYLVTNSGLA  316

Query  218  RHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIIL  397
              + V  G VE L++ L D DK   E+ALA ++ L     G     AHAL VP+LVK + 
Sbjct  317  ASRLVDLGMVELLVELLVDADKGTTEKALAVLDSLLLTEEGRGKACAHALAVPVLVKKMQ  376

Query  398  KISHRATEYAAGALLSICsaseqa---qreaaaaGVMTQLLLLVQSDCTERAKRKAQMLL  568
             +S  ATE+A  AL  +C +       + EA   G   +LLLL+Q  C    K +A  LL
Sbjct  377  HVSDMATEFAVSALWRLCKSFSGEGPCKAEALQLGAFQKLLLLLQVGCMGVTKERASELL  436

Query  569  KLL  577
            +LL
Sbjct  437  RLL  439



>ref|XP_011031180.1| PREDICTED: U-box domain-containing protein 25-like isoform X1 
[Populus euphratica]
Length=390

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 108/186 (58%), Gaps = 7/186 (4%)
 Frame = +2

Query  44   LIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRH  223
            +IE++ S   + EL A++    ++ +G++ +++     S A   G+KA+ ALC  +  R 
Sbjct  207  VIEAISSSLETRELCAKLGKNRKLLKGLILLVHQTHEASDA---GIKAISALCCLESNRQ  263

Query  224  KAVTAGAVEALIDRLQDFDKCD---AERALATVELLCRIPSGCAAFAAHALTVPLLVKII  394
              V  G +  L+  + D ++ +     +AL+T+ELL  + S  AA   +   +  L+K++
Sbjct  264  NLVQEGVINRLLTYIFDAERHERNLTPKALSTIELLLELESAKAALINNPNGIKALIKMV  323

Query  395  LKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLK  571
             + S H  +E A  +L  IC+ S QA+ EA  AGV+TQLLLL+QS C+ R K KA+MLLK
Sbjct  324  FRFSEHEGSESAVQSLTIICTDSLQARDEAIGAGVLTQLLLLLQSQCSARTKTKARMLLK  383

Query  572  LLRDCW  589
            LLR  W
Sbjct  384  LLRSRW  389



>ref|XP_002526642.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF35754.1| Spotted leaf protein, putative [Ricinus communis]
Length=404

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 90/149 (60%), Gaps = 4/149 (3%)
 Frame = +2

Query  176  GVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAE---RALATVELLCRIPSGCA  346
            G+KA+ ALC ++  R   V  G ++ L+  + + ++C      RA+AT+ELL  + +   
Sbjct  255  GIKAISALCSSESNRDNMVQGGVLKGLLTYISNAERCHRNLISRAMATIELLLELDTAKE  314

Query  347  AFAAHALTVPLLVKIILKIS-HRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQ  523
            A   +   +  LVK++ ++S H  +E A  +L+ +C  S QA+ EA +AGV+TQ+LLL+Q
Sbjct  315  AVINNPDGIGALVKMVFRVSDHEGSESAVRSLMILCGDSLQAREEAISAGVLTQVLLLLQ  374

Query  524  SDCTERAKRKAQMLLKLLRDCWPEDFTGI  610
            S C+ R K +A+MLLKLLR  W E    I
Sbjct  375  SQCSGRTKTRARMLLKLLRSKWNEQPKNI  403



>gb|AFW73318.1| immediate-early fungal elicitor protein CMPG1 [Zea mays]
Length=477

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 96/210 (46%), Gaps = 13/210 (6%)
 Frame = +2

Query  32   NSAALI--ESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCL  205
            +SAA++  E   S    PE    +S  + + + ++ +L  P+S        V A + +  
Sbjct  268  SSAAVVLREIASSSDSDPECLDALSETNGVHDALIKLLQKPVSAQATKAALVTAYYLVRG  327

Query  206  AKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLV  385
            +     + V  G VE L++ L D DK   E+ALA ++ L     G     AHAL VP+LV
Sbjct  328  SDLAARRLVDLGMVELLVEMLVDADKGTTEKALAVLDSLLLTEEGRGKACAHALAVPVLV  387

Query  386  KIILKISHRATEYAAGALLSICsaseqa---qreaaaaGVMTQLLLLVQSDCTERAKRKA  556
            K +  +S  ATE+A  AL  +C +       + EA   G   +LLLL+Q  C    K +A
Sbjct  388  KKMQHVSEMATEFAVSALWRLCKSFSGEGPCKAEALQLGAFQKLLLLLQVGCMGVTKERA  447

Query  557  QMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
              LL+LL         G  D   C   V F
Sbjct  448  SELLRLL--------NGSRDGVECIETVDF  469



>ref|NP_181137.2| E3 ubiquitin-protein ligase PUB23 [Arabidopsis thaliana]
 sp|Q84TG3.1|PUB23_ARATH RecName: Full=E3 ubiquitin-protein ligase PUB23; AltName: Full=Plant 
U-box protein 23; AltName: Full=U-box domain-containing 
protein 23 [Arabidopsis thaliana]
 gb|AAO64764.1| At2g35930 [Arabidopsis thaliana]
 dbj|BAE99354.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09178.1| E3 ubiquitin-protein ligase PUB23 [Arabidopsis thaliana]
Length=411

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 87/168 (52%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     
Sbjct  231  EVFTEVVQILDDRIS-QKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTS  289

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  290  ERRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRF  349

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  350  CATPALLHEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  397



>ref|XP_006293176.1| hypothetical protein CARUB_v10019493mg [Capsella rubella]
 gb|EOA26074.1| hypothetical protein CARUB_v10019493mg [Capsella rubella]
Length=435

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  ++ IL+  +S+ +A +  ++ L  +C   + RHKAV AG +  +I+ L D     
Sbjct  255  ELFAEVLQILHDQISH-KATRSAMQILVIICPWGRNRHKAVEAGFISMIIELLMDETFSS  313

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++ + E A+  +++LC+   G + F  H   + L+ K IL++S   +E A   LLS+   
Sbjct  314  ERRNTEMAMVVLDMLCQCAEGRSEFLNHGAAIALVSKKILRVSQITSERAVRVLLSVGKF  373

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+    +E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>gb|AAD21464.1| unknown protein [Arabidopsis thaliana]
Length=406

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 86/166 (52%), Gaps = 7/166 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L D     
Sbjct  226  EVFTEVVQILDDRIS-QKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTS  284

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  285  ERRGPEMAMVVLDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRF  344

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  589
             A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W
Sbjct  345  CATPALLHEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVW  390



>gb|AFG69255.1| hypothetical protein 0_14991_01, partial [Pinus taeda]
 gb|AFG69256.1| hypothetical protein 0_14991_01, partial [Pinus taeda]
 gb|AFG69257.1| hypothetical protein 0_14991_01, partial [Pinus taeda]
 gb|AFG69258.1| hypothetical protein 0_14991_01, partial [Pinus taeda]
Length=60

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 2/52 (4%)
 Frame = +2

Query  491  GVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTGISDDYNCSYVVPF  646
            G++TQLLLLVQSDCTERAKRKAQMLLKLLR+ W ++ +  S  +  + VVPF
Sbjct  11   GILTQLLLLVQSDCTERAKRKAQMLLKLLRNAWSDESS--SPVFCRTDVVPF  60



>ref|XP_002524056.1| Spotted leaf protein, putative [Ricinus communis]
 ref|XP_002524059.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38266.1| Spotted leaf protein, putative [Ricinus communis]
 gb|EEF38269.1| Spotted leaf protein, putative [Ricinus communis]
Length=413

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 67/199 (34%), Positives = 102/199 (51%), Gaps = 7/199 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            + N + + R  +  L++S L      +L   +S   E+F  IV +L+  +S+ +A K  +
Sbjct  203  MQNGNYESRAYAVLLLKSALEVADPMQL---VSLRPELFVEIVQVLSDQISH-QASKAAL  258

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDAERALATVELLCRIPSGCAAFAA  358
            + L  LC   + R KA  A AV  LID L D  +K   E ALA ++LLC+   G A    
Sbjct  259  QLLINLCPWGRSRLKATEAKAVSTLIDLLLDSSEKRTCEMALAVLDLLCQCAEGRAELLK  318

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqr--eaaaaGVMTQLLLLVQSDC  532
            H   + ++ K IL++S  A+E A   LLSI   S  +    E    GV+ +L L++Q DC
Sbjct  319  HGAGLAVVSKKILRVSQVASEKAVRILLSISKFSATSTVLHEMLQIGVVAKLCLVLQVDC  378

Query  533  TERAKRKAQMLLKLLRDCW  589
              + K KA+ +LKL    W
Sbjct  379  GSKGKDKAREVLKLHARAW  397



>ref|XP_009343842.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
Length=287

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 72/130 (55%), Gaps = 2/130 (2%)
 Frame = +2

Query  185  ALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHA  364
            ALF LC+    + KAV AG V  L+  L +      +  LA + +L   P G AA  A A
Sbjct  155  ALFNLCIYHGNKGKAVRAGVVSTLMKILTEPGDGMVDEGLAILAILSSHPEGKAAIGA-A  213

Query  365  LTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQSDCTERA  544
              VP+LV++I   S R  E AA  L+++CS  +Q   EA   GVM+ LL L Q + T+R 
Sbjct  214  EAVPVLVEVIGTGSFRNRENAAAVLVNLCSEDQQHIVEAQELGVMSSLLELAQ-NGTDRG  272

Query  545  KRKAQMLLKL  574
            KRKA  LL+L
Sbjct  273  KRKAAQLLEL  282



>ref|XP_002877862.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54121.1| U-box domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=435

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S+ +A +  ++ L   C   + RHKAV AGA+  +I+ L D     
Sbjct  255  ELFAEVVQILHDQISH-KATRSAMQILVITCPWGRNRHKAVEAGAISMIIELLMDDTFSS  313

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++ ++E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LL +   
Sbjct  314  ERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLLVGRF  373

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+    +E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>ref|XP_007047580.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX91737.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
Length=311

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 101/192 (53%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  SV+ ++N   L++ ++      E R++  ++  +  G++ ++     +S  +  G+
Sbjct  103  LNEGSVETKINCTRLMDKLM---EEKEFRSESISSHRLLVGVMRLVK-DKRHSNGILPGL  158

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L ++CL KQ R   V+ GAV  L++ L   +    E AL  ++ L  +P G  A    
Sbjct  159  SFLRSICLLKQVRSLIVSIGAVSQLVELLPSLEPDCLELALFILDTLSSLPEGKVALKDC  218

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
            A T+P  V++++++S   T+YA   L S+C  + +     A  AG+  +LLL++QS C  
Sbjct  219  ANTIPNTVRLLMRVSESCTQYALSILWSVCKLAPEECSSVAVEAGLAAKLLLVIQSGCNP  278

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  279  VLKQRSAELLKL  290



>ref|XP_010515711.1| PREDICTED: E3 ubiquitin-protein ligase PUB22-like [Camelina sativa]
Length=435

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  ++ IL+  +S+ +A +  ++ L  +C   + RHKAV AG +  +I+ L D     
Sbjct  255  ELFAEVLQILHDQISH-KATRSAMQILVIICPWGRNRHKAVEAGVISMIIELLMDETFSS  313

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++ + E A+  +++LC+   G + F  H   + L+ K IL++S   +E A   LLS+   
Sbjct  314  ERRNLEMAMVVLDMLCQCAEGRSEFLNHGAAIALVSKKILRVSQITSERAVRVLLSVGRF  373

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+    +E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>ref|XP_010426860.1| PREDICTED: E3 ubiquitin-protein ligase PUB22 [Camelina sativa]
Length=435

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 90/168 (54%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  ++ IL+  +S+ +A +  ++ L  +C   + RHKAV AG +  +I+ L D     
Sbjct  255  ELFAEVLQILHDQISH-KATRSAMQILVIICPWGRNRHKAVEAGVISMIIELLMDETFSS  313

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++ + E A+  +++LC+   G + F  H   + L+ K IL++S   +E A   LLS+   
Sbjct  314  ERRNLEMAMVVLDMLCQCAEGRSEFLNHGAAIALVSKKILRVSQITSERAVRVLLSVGRF  373

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+    +E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>ref|XP_010688093.1| PREDICTED: U-box domain-containing protein 4-like [Beta vulgaris 
subsp. vulgaris]
Length=351

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (54%), Gaps = 2/140 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K    AL++LC  K+ + +AV +G ++ LI+ + DF     +++   + LL  +P  
Sbjct  202  RGKKDASTALYSLCSIKENKMRAVESGIMKPLIELMADFGSHMVDKSAYVLSLLVALPEA  261

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
             A        +P+LV+I+   SHR  E AA  LL +C  S   +   A  G +  L+ L 
Sbjct  262  RAGLVEEG-GIPVLVEIVEVGSHRQKEIAAAILLQLCEDSVVYRTMVAREGAIPPLVALS  320

Query  521  QSDCTERAKRKAQMLLKLLR  580
            QS  T RAKRKA+ L++LLR
Sbjct  321  QS-GTSRAKRKAETLIELLR  339



>ref|NP_190813.1| E3 ubiquitin-protein ligase PUB22 [Arabidopsis thaliana]
 sp|Q9SVC6.1|PUB22_ARATH RecName: Full=E3 ubiquitin-protein ligase PUB22; AltName: Full=Plant 
U-box protein 22; AltName: Full=U-box domain-containing 
protein 22 [Arabidopsis thaliana]
 emb|CAB43434.1| putative protein [Arabidopsis thaliana]
 gb|AAU90053.1| At3g52450 [Arabidopsis thaliana]
 gb|AAV59269.1| At3g52450 [Arabidopsis thaliana]
 dbj|BAF00881.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE78947.1| E3 ubiquitin-protein ligase PUB22 [Arabidopsis thaliana]
Length=435

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 89/168 (53%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  ++ IL+  +S+ +A +  ++ L   C   + RHKAV  G +  +I+ L D     
Sbjct  255  ELFGEVIQILHDQISH-KATRSAMQILVITCPWGRNRHKAVEGGTISMIIELLMDDTFSS  313

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++ ++E A+  +++LC+   G A F  H   + ++ K IL++S   +E A   LLS+   
Sbjct  314  ERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITSERAVRVLLSVGRF  373

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+    +E    GV+ +L L++Q  C  + K KA+ LLKL    W E
Sbjct  374  CATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWRE  421



>emb|CDY23218.1| BnaA04g05410D [Brassica napus]
Length=396

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 88/168 (52%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            ++F  +V IL+  +S+ +A K  ++ L  +C   + RHKAV AGAV  +I+ L D     
Sbjct  216  DLFNEVVQILHDQISH-KATKSAMQILMIICPWGRNRHKAVEAGAVSMIIELLLDESFSS  274

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsa  457
            ++ + E  +  +++LC+   G A F  H   + ++ K IL++S   +E A   LLS+   
Sbjct  275  ERRNVEMTMVVLDMLCQCAEGRADFLNHGAAIAVVSKKILRVSQITSERAVRVLLSVGRF  334

Query  458  seq--aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
                   +E    GV+ +L L++Q  C  + K KA+ LL+L    W E
Sbjct  335  CATPCLLQEMLQLGVVAKLCLVLQVSCGNKTKGKAKELLQLHARVWRE  382



>ref|XP_010273225.1| PREDICTED: U-box domain-containing protein 30 [Nelumbo nucifera]
Length=452

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/192 (26%), Positives = 100/192 (52%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  S++ ++N   LIE ++         +++ ++  +  G++ ++     +      G+
Sbjct  244  LNEGSIETKINCTRLIEMLMD---EKNFSSEVVSSPSLLVGLLRLIK-DKRHPNGTSAGL  299

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L  +C   Q R+  V+ GAV  L++ L + +    E AL  +++LC +P G +A    
Sbjct  300  GLLKTICSHNQVRNLVVSVGAVPQLVELLPNLNPDCLESALFILDILCTLPEGRSALKVC  359

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
            + T+P +V++++++S   T+YA   L  +C  + +     A  AG+  +LLL++QS C  
Sbjct  360  SNTIPNMVRLLMRVSESCTQYALSILWEVCKLAPEECAAIAVEAGLAAKLLLVIQSGCNP  419

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  420  ALKQRSSELLKL  431



>gb|KHG16185.1| U-box domain-containing 4 -like protein [Gossypium arboreum]
Length=351

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (54%), Gaps = 2/140 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K    AL++LC  K+ + KAV AG ++ L++ + DF     +++   + +L  +P  
Sbjct  200  RGKKDASTALYSLCTVKENKIKAVEAGIMKPLVELMADFGSNMVDKSAFVLSVLVSVPEA  259

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
              A       +P+LV+II   S R  E AA  LL IC  S   + + A  G +  L+ L 
Sbjct  260  KTALVDEG-GIPVLVEIIEVGSQRQKEIAAANLLQICEDSVVYRTKVAREGAIPPLVALS  318

Query  521  QSDCTERAKRKAQMLLKLLR  580
            QS  T RAK+KA+ L++LLR
Sbjct  319  QSG-TNRAKQKAEKLIELLR  337



>gb|KDP44223.1| hypothetical protein JCGZ_05690 [Jatropha curcas]
Length=663

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 75/139 (54%), Gaps = 2/139 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K    ALF LC+ +  + KAV AG V  L+  L +      + ALA + +L   P G
Sbjct  493  RGKKDAATALFNLCIYQGNKGKAVRAGVVPTLMRLLTEPGGGMVDEALAILAILASHPEG  552

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
             AA  A A  VP+LV++I   S R  E AA  L+ +CS  ++   EA   GVM  L+ L 
Sbjct  553  KAAIGA-AEAVPVLVEVIGNGSPRNRENAAAVLVHLCSGDQKHLAEAQELGVMGSLIDLA  611

Query  521  QSDCTERAKRKAQMLLKLL  577
            Q + T+R KRKAQ LL+ +
Sbjct  612  Q-NGTDRGKRKAQQLLERM  629



>ref|XP_008784119.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Phoenix dactylifera]
Length=419

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 96/191 (50%), Gaps = 7/191 (4%)
 Frame = +2

Query  26   RMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCL  205
            R ++  LI+S+LS      L+     + E+F  +V +L   +SY  A K  V+ L  L  
Sbjct  217  RTHAMLLIKSLLSVMAPARLKG---FSKELFGEVVKVLRDQISYP-ATKAAVQVLGGLSP  272

Query  206  AKQYRHKAVTAGAVEALIDRLQDFDKCDA-ERALATVELLCRIPSGCAAFAAHALTVPLL  382
              + R KAV AGAV  +I+ L D  +  A E  L  ++ LCR   G A    HA  + ++
Sbjct  273  WGRNRVKAVEAGAVRVVIELLLDKTERRACEMMLVVLDQLCRCAEGRAEMVGHAAGIAVV  332

Query  383  VKIILKISHRATEYAAGALLSIC--saseqaqreaaaaGVMTQLLLLVQSDCTERAKRKA  556
             K +L++S  A+E   G L S    S +    +E    G + +L +L+Q DC E+AK K 
Sbjct  333  TKKLLRVSRVASERVVGILYSAARFSPTRAVLQEMKQVGAVAKLCMLLQVDCGEKAKEKV  392

Query  557  QMLLKLLRDCW  589
            + +L+L    W
Sbjct  393  KEMLRLHSKVW  403



>gb|ADI46216.1| CMPG1a [Solanum tuberosum]
Length=422

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/199 (29%), Positives = 97/199 (49%), Gaps = 7/199 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPL--SYSRALKI  175
            L N S+  R N+  ++  ++      ++   + N +   EG+V ++  P+  + ++A  +
Sbjct  204  LKNGSLSSRRNAVLVLREIMKLEEKEKVEILL-NIEGALEGLVKLVKEPICPNTTKASLL  262

Query  176  GVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFA  355
             +  +     ++  R + V  G VE LI+ L D DK   E+AL  ++ +     G     
Sbjct  263  TIYHMVINSSSQSLRSRFVDVGLVELLIEILVDCDKSICEKALGVLDGILSYEEGVKRAY  322

Query  356  AHALTVPLLVKIILKISHRATEYAAGALLSICsaseq----aqreaaaaGVMTQLLLLVQ  523
             +AL+VP+LVK +L++S  ATE++   L  IC            EA   G   +LLL++Q
Sbjct  323  NYALSVPVLVKKLLRVSDLATEFSVSILWKICKNENNGDCGVLVEALQVGAFQKLLLMLQ  382

Query  524  SDCTERAKRKAQMLLKLLR  580
              C+E  K K   LLKLL 
Sbjct  383  VGCSEITKEKGSELLKLLN  401



>gb|ABK25393.1| unknown [Picea sitchensis]
Length=417

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 110/219 (50%), Gaps = 16/219 (7%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILN---CPLSYSRALK  172
            L   S + R  SA L+++V S  +    +  ++  D++ EG++ +L    C  + + +L+
Sbjct  203  LKKGSCNGRFYSAMLLKTVSSSGQKILQQLVVNADDDLIEGLLQLLTEEVCLQATTSSLE  262

Query  173  IGVKALFALC-LAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            I    L A+C  +++ R KA+ AGA+  LI+ L +  + + E+ L  +++LC    G A 
Sbjct  263  I----LMAICSPSRKNRIKAIEAGAIYILIELLPESQRMNCEKMLCLLDILCECAEGRAT  318

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqa--qreaaaaGVMTQLLLLVQ  523
               HA+ +  + K I ++S  ATE A   L S+C  S       E    G + +L +L+Q
Sbjct  319  TIDHAMGIASISKKIFRVSQVATEKAIRILWSLCKFSPTPRLLNEMVQIGAVYKLCVLLQ  378

Query  524  SDCTERAKRKAQMLLK------LLRDCWPEDFTGISDDY  622
             +CT + K+KA+ +L+       +  C P    GI   Y
Sbjct  379  LECTSKTKQKAREMLRAHGKYWTISPCVPSYSLGIYGQY  417



>gb|KJB63943.1| hypothetical protein B456_010G025700 [Gossypium raimondii]
Length=351

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 75/140 (54%), Gaps = 2/140 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K    AL++LC  K+ + KAV AG ++ L++ + DF     +++   + +L  +P  
Sbjct  200  RGKKDASTALYSLCTVKENKIKAVEAGIMKPLVELMADFGSNMVDKSAFVLSVLVSVPEA  259

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
              A       +P+LV+II   S R  E AA  LL IC  S   + + A  G +  L+ L 
Sbjct  260  KTALVDEG-GIPVLVEIIEVGSQRQKEIAAAILLQICEDSVVYRTKVAREGAIPPLVALS  318

Query  521  QSDCTERAKRKAQMLLKLLR  580
            QS  T RAK+KA+ L++LLR
Sbjct  319  QSG-TNRAKQKAEKLIELLR  337



>ref|XP_007047579.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX91736.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=451

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 101/192 (53%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  SV+ ++N   L++ ++      E R++  ++  +  G++ ++     +S  +  G+
Sbjct  243  LNEGSVETKINCTRLMDKLM---EEKEFRSESISSHRLLVGVMRLVK-DKRHSNGILPGL  298

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L ++CL KQ R   V+ GAV  L++ L   +    E AL  ++ L  +P G  A    
Sbjct  299  SFLRSICLLKQVRSLIVSIGAVSQLVELLPSLEPDCLELALFILDTLSSLPEGKVALKDC  358

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
            A T+P  V++++++S   T+YA   L S+C  + +     A  AG+  +LLL++QS C  
Sbjct  359  ANTIPNTVRLLMRVSESCTQYALSILWSVCKLAPEECSSVAVEAGLAAKLLLVIQSGCNP  418

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  419  VLKQRSAELLKL  430



>ref|XP_002267145.2| PREDICTED: U-box domain-containing protein 30 [Vitis vinifera]
 ref|XP_010647073.1| PREDICTED: U-box domain-containing protein 30 [Vitis vinifera]
Length=447

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 102/192 (53%), Gaps = 5/192 (3%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L+  S++ ++NS  LIE ++      + R++I ++  +  G++ ++      +  L  G+
Sbjct  239  LNEGSIETKINSTRLIEMLM---EEKDFRSEIVSSHSLLVGLMRLVKDKRHPNGNLP-GL  294

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAH  361
              L  +CL KQ R+  V+ GA+  L++ L   +    E AL  ++ L  +P G  A    
Sbjct  295  TLLRTICLHKQVRNLFVSIGAIPQLVELLPALNPDCLESALFILDTLSSLPEGRLALRDC  354

Query  362  ALTVPLLVKIILKISHRATEYAAGALLSICsaseqa-qreaaaaGVMTQLLLLVQSDCTE  538
              T+P +V++++++S   T+YA   L S+C  + +     A  AG+  +LLL++QS C  
Sbjct  355  LNTIPNMVRLLMRVSESCTQYALAILWSVCKLAPEECSSIAVEAGLAAKLLLVIQSGCNP  414

Query  539  RAKRKAQMLLKL  574
              K+++  LLKL
Sbjct  415  VLKQRSAELLKL  426



>ref|XP_007224929.1| hypothetical protein PRUPE_ppa021688mg [Prunus persica]
 gb|EMJ26128.1| hypothetical protein PRUPE_ppa021688mg [Prunus persica]
Length=286

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 78/148 (53%), Gaps = 6/148 (4%)
 Frame = +2

Query  170  KIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGCAA  349
            K   K L ALCLA+  RH AV  GA  A+++   + +   AERALA +EL+C +  G AA
Sbjct  132  KAATKILLALCLAEGNRHVAVDEGAAAAVVETALELEAASAERALAALELMCTVAEGAAA  191

Query  350  FAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLL------  511
              +HAL VP++V ++ + S R  EYA G L  I S +   +  A A              
Sbjct  192  VRSHALAVPIMVMMMGRTSARGKEYAIGVLAVIYSGAYGEEEAAEAVAAAPAEEVARAVE  251

Query  512  LLVQSDCTERAKRKAQMLLKLLRDCWPE  595
            L ++ DC+ R +RK   LLK L+D   E
Sbjct  252  LALKGDCSGRGRRKGAQLLKALQDPLQE  279



>ref|XP_003537115.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Glycine max]
Length=420

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 89/163 (55%), Gaps = 4/163 (2%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD-FDKC  286
            ++F  +V +L   +S  +A K  ++AL  +C   + R KAV AGAV  L++ L +  ++ 
Sbjct  241  DLFTELVQVLKDQVS-EKASKATLRALIQVCPWGRNRVKAVEAGAVPVLVELLLECKERK  299

Query  287  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq  466
              E  L  +E+LC+   G A   AHA  V ++ K IL++S  A + AA  LLS+C  S  
Sbjct  300  PIEMMLVLLEILCQSADGRAGLLAHAAGVAIVAKKILRVSTMANDRAAKILLSVCRFSAT  359

Query  467  --aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  589
                +E    GV+ ++ L++Q D   +AK KA+ +LKL    W
Sbjct  360  HGVVQEMLQLGVVAKMCLVLQVDSGNKAKEKAREILKLHARAW  402



>ref|XP_002320032.2| hypothetical protein POPTR_0014s01670g [Populus trichocarpa]
 gb|EEE98347.2| hypothetical protein POPTR_0014s01670g [Populus trichocarpa]
Length=353

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 2/140 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K    AL++LC AK+ + +AV AG ++ L++ + DF     +++   + LL  +P  
Sbjct  199  RGKKDAATALYSLCSAKENKIRAVQAGIMKPLVELMADFGSNMVDKSAFVLSLLITVPEA  258

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
              A    A  +P+LV+II   S R  E A   LL IC  +   +   A  G +  L+ L 
Sbjct  259  KTAVVEEA-GIPVLVEIIEVGSQRQKEIAVSILLQICEDNLVFRAMVAREGAIPALVALT  317

Query  521  QSDCTERAKRKAQMLLKLLR  580
            QS  T RAK+KA+ L+ LLR
Sbjct  318  QSG-TNRAKQKAETLIDLLR  336



>ref|XP_004292853.1| PREDICTED: E3 ubiquitin-protein ligase PUB23 [Fragaria vesca 
subsp. vesca]
Length=341

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 89/171 (52%), Gaps = 12/171 (7%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCD  289
            E+  G+V IL          K   K L ALCLA+  RH AV AGA  A+++   + +   
Sbjct  172  ELMRGLVRILK----NKAGAKPATKVLLALCLAEPNRHVAVEAGAASAVVETALELEDAA  227

Query  290  AERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsase--  463
            AERALA +EL+C +  G A   +HAL VP++V ++ + S R  EYA G L  I   +   
Sbjct  228  AERALAALELMCTVAEGAAEVRSHALAVPVMVMMMGRTSARGKEYAIGVLAVIYGGASED  287

Query  464  ---qaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPEDFTG  607
               +A   A A  V   + L ++ DC+ R +RK   LLK LR   PE+  G
Sbjct  288  EAAEAVSAAPAEEVARAVELALKGDCSGRGRRKGAQLLKALR---PEEEKG  335



>gb|KHN48421.1| E3 ubiquitin-protein ligase PUB23 [Glycine soja]
Length=416

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 89/163 (55%), Gaps = 4/163 (2%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD-FDKC  286
            ++F  +V +L   +S  +A K  ++AL  +C   + R KAV AGAV  L++ L +  ++ 
Sbjct  237  DLFTELVQVLKDQVS-EKASKATLRALIQVCPWGRNRVKAVEAGAVPVLVELLLECKERK  295

Query  287  DAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseq  466
              E  L  +E+LC+   G A   AHA  V ++ K IL++S  A + AA  LLS+C  S  
Sbjct  296  PIEMMLVLLEILCQSADGRAGLLAHAAGVAIVAKKILRVSTMANDRAAKILLSVCRFSAT  355

Query  467  --aqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  589
                +E    GV+ ++ L++Q D   +AK KA+ +LKL    W
Sbjct  356  HGVVQEMLQLGVVAKMCLVLQVDSGNKAKEKAREILKLHARAW  398



>ref|XP_010999871.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
Length=353

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 2/140 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K    AL++LC AK+ + +AV AG ++ L++ + DF     +++   + LL  +P  
Sbjct  199  RGKKDAATALYSLCSAKENKIRAVQAGIMKPLVELMADFGSNMVDKSAFVLSLLITVPEA  258

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
              A    A  +P+LV+II   S R  E A   LL IC  +   +   A  G +  L+ L 
Sbjct  259  KTAVVEEA-GIPVLVEIIEVGSQRQKEIAVSILLQICEDNLVFRAMVAREGAIPALVALT  317

Query  521  QSDCTERAKRKAQMLLKLLR  580
            QS  T RAK+KA+ L+ LLR
Sbjct  318  QSG-TNRAKQKAETLIDLLR  336



>ref|XP_010278617.1| PREDICTED: U-box domain-containing protein 25-like [Nelumbo nucifera]
Length=159

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 10/128 (8%)
 Frame = +2

Query  65   GTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGA  244
            G+R P   + + +       +VG L  P     A K+    L ALCL +  R+ AV AGA
Sbjct  32   GSRDPIYPSSVMSV------VVGFLKDPAGTKPATKV----LLALCLVQCKRNVAVEAGA  81

Query  245  VEALIDRLQDFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEY  424
            V  +++ + + +   A++ALA +ELLC I  G     AHA  VP+L++++ K++ R  E+
Sbjct  82   VAEVVETVAELEGSAADQALAALELLCTILEGATELRAHAFAVPMLLEMVTKMAGRGKEH  141

Query  425  AAGALLSI  448
                ++ I
Sbjct  142  GISVMVVI  149



>gb|KDP36106.1| hypothetical protein JCGZ_08750 [Jatropha curcas]
Length=417

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 104/199 (52%), Gaps = 7/199 (4%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSYSRALKIGV  181
            L N + + R  S  L++S+L      +L   I+   E+F  IV IL   +S+ +A K  +
Sbjct  207  LKNGNYESRAYSVLLLKSILEVADPIQL---INLRQELFVEIVQILRDQISH-QATKSSL  262

Query  182  KALFALCLAKQYRHKAVTAGAVEALIDRLQDF-DKCDAERALATVELLCRIPSGCAAFAA  358
            + L  LC   + R KAV A AV  LI+ L D  +K   E AL  ++L+C+   G A    
Sbjct  263  RLLVNLCPWGRNRVKAVAANAVSVLINLLLDSSEKRVCEMALMVLDLVCQCAEGRAELLG  322

Query  359  HALTVPLLVKIILKISHRATEYAAGALLSIC--saseqaqreaaaaGVMTQLLLLVQSDC  532
            H   + ++ K IL++S  A+E A   LLSI   SA+    +E    GV+ +L L++Q DC
Sbjct  323  HGAGLAVVSKKILRVSQVASEKAVRILLSISKFSATNNVLQEMLQIGVVAKLCLVLQVDC  382

Query  533  TERAKRKAQMLLKLLRDCW  589
              + K KA+ +LKL    W
Sbjct  383  GIKNKEKAREVLKLHARAW  401



>ref|XP_006494889.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Citrus sinensis]
Length=407

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 88/169 (52%), Gaps = 4/169 (2%)
 Frame = +2

Query  95   ISNADEIFEGIVGILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ  271
            IS   E F  IV +L     +S+ A K  +K L  LC   + R KAV  G V  L+D L 
Sbjct  222  ISVKQEFFTEIVNVLRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLL  281

Query  272  DF-DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI  448
            D  ++   E  L  ++LLCR   G A    H   + ++ K IL++SH A++ A   L S+
Sbjct  282  DVTERRVCELMLNVLDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSV  341

Query  449  Csaseqaq--reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  589
            C  S  A+  +E    GV+++L L++Q D + + K +A+ +LKL    W
Sbjct  342  CKFSATARVLQEMLQVGVVSKLCLVLQVDASVKTKERAREILKLNARAW  390



>ref|XP_007160909.1| hypothetical protein PHAVU_001G027300g [Phaseolus vulgaris]
 gb|ESW32903.1| hypothetical protein PHAVU_001G027300g [Phaseolus vulgaris]
Length=351

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            RA K    AL++LC  K+ + +AV AG ++ L++ + DF+    +++   V +L  +P  
Sbjct  198  RAKKDASTALYSLCTVKENKLRAVKAGIMKVLVELMADFESNMVDKSAYVVSVLVTVPEA  257

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
             AA       VP+LV+I+   + R  E A   LL +C  S   +   A  G +  L+ L 
Sbjct  258  RAALVEEG-GVPVLVEIVEVGTQRQKEIAVVILLQVCEDSVTYRSMVAREGAIPPLVALS  316

Query  521  QSDCTERAKRKAQMLLKLLRDCWPEDFTG  607
            QS  T RAK+KA+ L++LLR     +  G
Sbjct  317  QSG-TNRAKQKAEKLIELLRQPRSSNGGG  344



>ref|XP_003589079.1| U-box domain-containing protein [Medicago truncatula]
Length=336

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 74/140 (53%), Gaps = 2/140 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K    AL+ LC  K+ + +AV AG ++ L++ + DF+    +++   + +L  +P  
Sbjct  190  RGKKDASTALYTLCSVKENKMRAVKAGIMKVLVELMADFESNMVDKSAYVLSVLVSVPEA  249

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
              A       VP+LV+I+   S R  E AA  LL IC  S   +   A  G +  L+ L 
Sbjct  250  KVALVEEG-GVPVLVEIVEVGSQRQKEIAAVILLQICEDSVAVRSMVAREGAIPPLVALT  308

Query  521  QSDCTERAKRKAQMLLKLLR  580
            QS  T RAK+KA+ L++LLR
Sbjct  309  QSG-TNRAKQKAEKLIELLR  327



>ref|XP_009599897.1| PREDICTED: U-box domain-containing protein 13-like [Nicotiana 
tomentosiformis]
Length=663

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 73/139 (53%), Gaps = 2/139 (1%)
 Frame = +2

Query  161  RALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSG  340
            R  K    ALF LC+ +  + KA+ AG V  L+  L +      + ALA + +L   P G
Sbjct  492  RGKKDAATALFNLCIYQGNKGKAIRAGVVPTLMRLLTEPQGGMVDEALAILAILSSHPEG  551

Query  341  CAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLV  520
             AA  A A  VP+LV +I   S R  E AA  L+ +CS  +    EA   G+M  L+ LV
Sbjct  552  KAAIGA-AEAVPVLVDVISNGSPRNKENAAAVLVHLCSGDQHHLVEAQQLGLMGPLMDLV  610

Query  521  QSDCTERAKRKAQMLLKLL  577
            Q + TER KRKA  LL+ L
Sbjct  611  Q-NGTERGKRKATQLLERL  628



>ref|XP_006424086.1| hypothetical protein CICLE_v10028557mg [Citrus clementina]
 gb|ESR37326.1| hypothetical protein CICLE_v10028557mg [Citrus clementina]
Length=407

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 88/169 (52%), Gaps = 4/169 (2%)
 Frame = +2

Query  95   ISNADEIFEGIVGILNCPLSYSR-ALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQ  271
            IS   E F  IV +L     +S+ A K  +K L  LC   + R KAV  G V  L+D L 
Sbjct  222  ISVKQEFFTEIVNVLRDHHQFSQQASKAALKLLVELCPWGRNRIKAVEGGGVSVLVDLLL  281

Query  272  DF-DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSI  448
            D  ++   E  L  ++LLCR   G A    H   + ++ K IL++SH A++ A   L S+
Sbjct  282  DVTERRVCELMLNVLDLLCRCAEGRAELLKHGAGLAVVSKKILRVSHAASDRAVRILCSV  341

Query  449  Csaseqaq--reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCW  589
            C  S  A+  +E    GV+++L L++Q D + + K +A+ +LKL    W
Sbjct  342  CKFSATARVLQEMLQVGVVSKLCLVLQVDASVKTKERAREILKLNARAW  390



>ref|XP_004251095.1| PREDICTED: E3 ubiquitin-protein ligase PUB23-like [Solanum lycopersicum]
Length=404

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 105/204 (51%), Gaps = 14/204 (7%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIF-EGIVGILNCPLSYSRALKIG  178
            L+N  V  R N+ AL+ S LS        AQ+     ++ +GIV ILN  +S  +A K+ 
Sbjct  192  LNNGHVQSRTNAIALLRSTLSMADP----AQLIGIQPVYIKGIVCILNDKVS-QQATKLA  246

Query  179  VKALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDA-ERALATVELLCRIPSGCAAFA  355
            +K L  LC   + R KA+  GAV ALI+ L D ++    E  L  ++ LC    G +   
Sbjct  247  LKLLVELCPWGRNRIKAIENGAVFALIELLLDTNERRVCELILTALDHLCTCADGRSELL  306

Query  356  AHALTVPLLVKIILKISHRATE------YAAGALLSICsaseqaqreaaaaGVMTQLLLL  517
             H   + ++ K IL++SH A++      Y+    L+ C  S +  +E    G++++L L+
Sbjct  307  RHGGGIAIVSKKILRVSHLASDRGVRILYSISKFLATC-YSTKVLQEMLQVGIVSKLCLV  365

Query  518  VQSDCTERAKRKAQMLLKLLRDCW  589
            +Q D + + K KA+ +L+L    W
Sbjct  366  LQVDVSPKTKEKAKEILRLHSRVW  389



>ref|XP_002881419.1| hypothetical protein ARALYDRAFT_482563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57678.1| hypothetical protein ARALYDRAFT_482563 [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 87/168 (52%), Gaps = 7/168 (4%)
 Frame = +2

Query  110  EIFEGIVGILNCPLSYSRALKIGVKALFALCLAKQYRHKAVTAGAVEALIDRLQD----F  277
            E+F  +V IL+  +S  +A K  +  L  +C   + RHKAV AG +  +I+ L +     
Sbjct  227  EVFTEVVQILDDRIS-QKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMEESFTS  285

Query  278  DKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSICs-  454
            ++   E A+  ++LLC+   G A F  H   + ++ K IL++S  A++ A   LLS+   
Sbjct  286  ERRGPEMAMVVLDLLCQCAEGRADFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRF  345

Query  455  -aseqaqreaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLLRDCWPE  595
             A+     E    GV+ +L L++Q  C  + K KA+ LLKL    W +
Sbjct  346  CATPALLHEMLQLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKD  393



>gb|EEE65449.1| hypothetical protein OsJ_20813 [Oryza sativa Japonica Group]
Length=347

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 87/165 (53%), Gaps = 5/165 (3%)
 Frame = +2

Query  95   ISNADEIFEGIVGILNCPLSYSRALKIG-VKALFALCLAKQYRHKAVTAGAVEALIDRLQ  271
            I  A  + + +VG++  P+S S+A K   V A + +    +   +    G V A ++ L 
Sbjct  162  IPRAQGMCDALVGLVTSPVS-SQATKAALVTAYYLVSSGDRAAARFAELGVVPAAVELLV  220

Query  272  DFDKCDAERALATVELLCRIPSGCAAFAAHALTVPLLVKIILKISHRATEYAAGALLSIC  451
            D DK  +E+ALA ++      +G  +  AHALTVP+LVK + ++S  AT++A  AL  +C
Sbjct  221  DADKGTSEKALAVLDAALCADAGVESARAHALTVPVLVKKMFRVSDMATDFAVSALWRLC  280

Query  452  saseqaq---reaaaaGVMTQLLLLVQSDCTERAKRKAQMLLKLL  577
             A   A     EA   G   +LLLL+Q  C    K +A  LLK+L
Sbjct  281  RAGAGAAPCRAEALRVGAFQKLLLLLQVGCAGVTKERASELLKML  325



>ref|XP_008357382.1| PREDICTED: U-box domain-containing protein 13-like isoform X1 
[Malus domestica]
Length=307

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 100/199 (50%), Gaps = 20/199 (10%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY--SRALKI  175
            L+N  ++ R N+AA++ S+            I + +++  G  G +  PL    S   + 
Sbjct  100  LTNGGMEARENAAAILFSL-----------SIVDENKVMIGASGAI-PPLVTLLSEGTQG  147

Query  176  GVK----ALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGC  343
            G K    ALF LC+    + KAV AG V  L+  L +      +  LA + +L   P G 
Sbjct  148  GKKDAAIALFNLCIYHGNKGKAVRAGVVSTLMKLLTEPGGGMVDEGLAILAILSSHPEGK  207

Query  344  AAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQ  523
            AA  A A  VP+LV++I   S R  E AA  L+++CS  +Q   EA   GV + LL L Q
Sbjct  208  AAIGA-AEAVPVLVEVIGTGSLRNRENAAAVLVNLCSGDQQRIVEAQELGVTSSLLELAQ  266

Query  524  SDCTERAKRKAQMLLKLLR  580
             + T+R KRKA  LL+L+ 
Sbjct  267  -NGTDRGKRKAAQLLELMN  284



>ref|XP_008357389.1| PREDICTED: U-box domain-containing protein 13-like isoform X2 
[Malus domestica]
Length=305

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 100/199 (50%), Gaps = 20/199 (10%)
 Frame = +2

Query  2    LSNPSVDVRMNSAALIESVLSGTRSPELRAQISNADEIFEGIVGILNCPLSY--SRALKI  175
            L+N  ++ R N+AA++ S+            I + +++  G  G +  PL    S   + 
Sbjct  98   LTNGGMEARENAAAILFSL-----------SIVDENKVMIGASGAI-PPLVTLLSEGTQG  145

Query  176  GVK----ALFALCLAKQYRHKAVTAGAVEALIDRLQDFDKCDAERALATVELLCRIPSGC  343
            G K    ALF LC+    + KAV AG V  L+  L +      +  LA + +L   P G 
Sbjct  146  GKKDAAIALFNLCIYHGNKGKAVRAGVVSTLMKLLTEPGGGMVDEGLAILAILSSHPEGK  205

Query  344  AAFAAHALTVPLLVKIILKISHRATEYAAGALLSICsaseqaqreaaaaGVMTQLLLLVQ  523
            AA  A A  VP+LV++I   S R  E AA  L+++CS  +Q   EA   GV + LL L Q
Sbjct  206  AAIGA-AEAVPVLVEVIGTGSLRNRENAAAVLVNLCSGDQQRIVEAQELGVTSSLLELAQ  264

Query  524  SDCTERAKRKAQMLLKLLR  580
             + T+R KRKA  LL+L+ 
Sbjct  265  -NGTDRGKRKAAQLLELMN  282



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875