BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN040K19

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342129.1|  PREDICTED: BTB/POZ domain-containing protein...    287   8e-88   Solanum tuberosum [potatoes]
ref|XP_006342130.1|  PREDICTED: BTB/POZ domain-containing protein...    286   8e-88   Solanum tuberosum [potatoes]
ref|XP_004238427.1|  PREDICTED: BTB/POZ domain-containing protein...    282   3e-86   Solanum lycopersicum
ref|XP_010320455.1|  PREDICTED: BTB/POZ domain-containing protein...    283   4e-86   Solanum lycopersicum
ref|XP_009631576.1|  PREDICTED: BTB/POZ domain-containing protein...    281   8e-86   Nicotiana tomentosiformis
ref|XP_009631574.1|  PREDICTED: BTB/POZ domain-containing protein...    281   1e-85   
ref|XP_009631572.1|  PREDICTED: BTB/POZ domain-containing protein...    281   1e-85   Nicotiana tomentosiformis
ref|XP_002879271.1|  BTB/POZ domain-containing protein                  276   1e-83   
ref|XP_002510674.1|  protein binding protein, putative                  275   2e-83   Ricinus communis
ref|XP_004291228.1|  PREDICTED: BTB/POZ domain-containing protein...    273   1e-82   Fragaria vesca subsp. vesca
ref|XP_010469824.1|  PREDICTED: BTB/POZ domain-containing protein...    273   1e-82   Camelina sativa [gold-of-pleasure]
dbj|BAD95193.1|  hypothetical protein                                   261   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469826.1|  PREDICTED: BTB/POZ domain-containing protein...    273   1e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010414240.1|  PREDICTED: BTB/POZ domain-containing protein...    273   1e-82   
ref|XP_010469825.1|  PREDICTED: BTB/POZ domain-containing protein...    273   2e-82   Camelina sativa [gold-of-pleasure]
gb|KFK23322.1|  hypothetical protein AALP_AAs74635U001200               273   2e-82   Arabis alpina [alpine rockcress]
ref|XP_008452951.1|  PREDICTED: BTB/POZ domain-containing protein...    272   2e-82   Cucumis melo [Oriental melon]
ref|XP_010510327.1|  PREDICTED: BTB/POZ domain-containing protein...    271   8e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010061166.1|  PREDICTED: BTB/POZ domain-containing protein...    270   1e-81   Eucalyptus grandis [rose gum]
gb|KJB57964.1|  hypothetical protein B456_009G187700                    270   1e-81   Gossypium raimondii
ref|XP_008221133.1|  PREDICTED: BTB/POZ domain-containing protein...    270   2e-81   Prunus mume [ume]
emb|CDP07293.1|  unnamed protein product                                270   2e-81   Coffea canephora [robusta coffee]
ref|XP_007221940.1|  hypothetical protein PRUPE_ppa001540mg             270   2e-81   Prunus persica
ref|XP_010061165.1|  PREDICTED: BTB/POZ domain-containing protein...    270   4e-81   Eucalyptus grandis [rose gum]
ref|XP_011074097.1|  PREDICTED: BTB/POZ domain-containing protein...    269   4e-81   Sesamum indicum [beniseed]
gb|EYU36560.1|  hypothetical protein MIMGU_mgv1a001528mg                267   2e-80   Erythranthe guttata [common monkey flower]
ref|XP_004145539.1|  PREDICTED: BTB/POZ domain-containing protein...    267   2e-80   Cucumis sativus [cucumbers]
gb|KHG01113.1|  hypothetical protein F383_22949                         267   2e-80   Gossypium arboreum [tree cotton]
ref|XP_008377080.1|  PREDICTED: BTB/POZ domain-containing protein...    267   2e-80   Malus domestica [apple tree]
ref|XP_008377081.1|  PREDICTED: BTB/POZ domain-containing protein...    266   2e-80   
emb|CBI40712.3|  unnamed protein product                                266   3e-80   Vitis vinifera
ref|XP_002270675.1|  PREDICTED: BTB/POZ domain-containing protein...    266   4e-80   Vitis vinifera
ref|XP_006410166.1|  hypothetical protein EUTSA_v10016264mg             265   1e-79   Eutrema salsugineum [saltwater cress]
ref|XP_006293695.1|  hypothetical protein CARUB_v10022653mg             265   1e-79   Capsella rubella
ref|XP_006664953.1|  PREDICTED: BTB/POZ domain-containing protein...    264   3e-79   Oryza brachyantha
ref|XP_011034879.1|  PREDICTED: BTB/POZ domain-containing protein...    263   6e-79   Populus euphratica
ref|XP_002300643.1|  BTB/POZ domain-containing family protein           263   6e-79   Populus trichocarpa [western balsam poplar]
ref|XP_011034881.1|  PREDICTED: BTB/POZ domain-containing protein...    263   6e-79   Populus euphratica
emb|CDY29657.1|  BnaA04g17700D                                          263   8e-79   Brassica napus [oilseed rape]
ref|XP_010935266.1|  PREDICTED: BTB/POZ domain-containing protein...    263   8e-79   
emb|CDX97805.1|  BnaC04g41340D                                          262   9e-79   
ref|XP_007018025.1|  BTB/POZ domain-containing protein isoform 1        262   2e-78   
ref|XP_007018027.1|  BTB/POZ domain-containing protein isoform 3        261   2e-78   
ref|XP_002307790.1|  BTB/POZ domain-containing family protein           262   2e-78   
ref|NP_180618.2|  BTB/POZ domain-containing protein                     261   3e-78   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93995.1|  hypothetical protein                                   261   3e-78   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189642.1|  BTB/POZ domain-containing protein                  261   6e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556054.1|  PREDICTED: BTB/POZ domain-containing protein...    258   4e-77   Tarenaya hassleriana [spider flower]
gb|AES98295.2|  BTB/POZ domain plant protein                            258   6e-77   Medicago truncatula
ref|XP_008781287.1|  PREDICTED: BTB/POZ domain-containing protein...    258   6e-77   
ref|XP_008781284.1|  PREDICTED: BTB/POZ domain-containing protein...    258   7e-77   
ref|XP_010692549.1|  PREDICTED: BTB/POZ domain-containing protein...    257   9e-77   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010094552.1|  BTB/POZ domain-containing protein                  257   1e-76   Morus notabilis
ref|XP_011041233.1|  PREDICTED: BTB/POZ domain-containing protein...    256   2e-76   Populus euphratica
ref|XP_003615337.1|  Kelch-like protein                                 257   2e-76   
ref|XP_009418296.1|  PREDICTED: BTB/POZ domain-containing protein...    256   2e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE63337.1|  hypothetical protein OsJ_18148                          255   2e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011013905.1|  PREDICTED: BTB/POZ domain-containing protein...    256   3e-76   Populus euphratica
gb|AAV43802.1|  unknown protein                                         255   7e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561246.1|  PREDICTED: BTB/POZ domain-containing protein...    254   1e-75   Brachypodium distachyon [annual false brome]
ref|XP_003545003.1|  PREDICTED: BTB/POZ domain-containing protein...    253   2e-75   Glycine max [soybeans]
ref|XP_006596517.1|  PREDICTED: BTB/POZ domain-containing protein...    253   2e-75   
gb|EEC79014.1|  hypothetical protein OsI_19541                          253   3e-75   Oryza sativa Indica Group [Indian rice]
emb|CDM85346.1|  unnamed protein product                                251   1e-74   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006473785.1|  PREDICTED: BTB/POZ domain-containing protein...    250   3e-74   Citrus sinensis [apfelsine]
ref|XP_006473784.1|  PREDICTED: BTB/POZ domain-containing protein...    250   4e-74   Citrus sinensis [apfelsine]
ref|XP_006435355.1|  hypothetical protein CICLE_v10003249mg             250   5e-74   
ref|XP_009141084.1|  PREDICTED: BTB/POZ domain-containing protein...    249   5e-74   Brassica rapa
ref|XP_009141083.1|  PREDICTED: BTB/POZ domain-containing protein...    249   7e-74   Brassica rapa
ref|XP_007160598.1|  hypothetical protein PHAVU_001G001100g             249   1e-73   Phaseolus vulgaris [French bean]
ref|XP_010266159.1|  PREDICTED: BTB/POZ domain-containing protein...    248   2e-73   Nelumbo nucifera [Indian lotus]
ref|NP_001174372.1|  Os05g0345500                                       229   1e-72   
ref|XP_004512607.1|  PREDICTED: BTB/POZ domain-containing protein...    244   6e-72   Cicer arietinum [garbanzo]
ref|XP_004512608.1|  PREDICTED: BTB/POZ domain-containing protein...    244   6e-72   Cicer arietinum [garbanzo]
ref|XP_004964253.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    244   1e-71   
ref|XP_008377082.1|  PREDICTED: BTB/POZ domain-containing protein...    243   1e-71   
ref|XP_009759339.1|  PREDICTED: BTB/POZ domain-containing protein...    242   3e-71   Nicotiana sylvestris
ref|XP_002437659.1|  hypothetical protein SORBIDRAFT_10g000240          241   1e-70   Sorghum bicolor [broomcorn]
ref|XP_006828729.1|  hypothetical protein AMTR_s00001p00041750          241   1e-70   
gb|EPS65824.1|  hypothetical protein M569_08953                         225   4e-65   Genlisea aurea
ref|XP_002962812.1|  hypothetical protein SELMODRAFT_438140             224   2e-64   
ref|XP_002965955.1|  hypothetical protein SELMODRAFT_84039              222   5e-64   
ref|XP_001751401.1|  predicted protein                                  219   1e-62   
gb|AAB63076.1|  unknown protein                                         192   8e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KIY99757.1|  hypothetical protein MNEG_8204                          190   2e-52   Monoraphidium neglectum
ref|XP_005845262.1|  hypothetical protein CHLNCDRAFT_58586              184   1e-50   Chlorella variabilis
ref|XP_005650913.1|  hypothetical protein COCSUDRAFT_46062              156   3e-41   Coccomyxa subellipsoidea C-169
ref|XP_011399599.1|  BTB/POZ domain-containing protein                  141   1e-35   Auxenochlorella protothecoides
ref|XP_001697437.1|  predicted protein                                  118   4e-30   Chlamydomonas reinhardtii
ref|XP_002950189.1|  hypothetical protein VOLCADRAFT_48365              116   2e-29   Volvox carteri f. nagariensis
ref|XP_004339299.1|  BTB/POZ domain containing protein                  109   8e-24   Acanthamoeba castellanii str. Neff
ref|XP_006596518.1|  PREDICTED: BTB/POZ domain-containing protein...  99.4    3e-20   
gb|KDD72973.1|  hypothetical protein H632_c2675p1                     87.0    3e-18   Helicosporidium sp. ATCC 50920
ref|XP_005708947.1|  ubiquitin-protein ligase                         87.4    4e-16   Galdieria sulphuraria
ref|XP_004333299.1|  BTB/POZ domain containing protein                82.4    2e-14   Acanthamoeba castellanii str. Neff
ref|XP_011189870.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  80.9    8e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189869.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  80.9    8e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189868.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  80.9    8e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011189866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  80.9    8e-14   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_005708288.1|  ubiquitin-protein ligase isoform 1               79.7    1e-13   Galdieria sulphuraria
ref|XP_005708289.1|  ubiquitin-protein ligase isoform 2               79.7    1e-13   Galdieria sulphuraria
ref|XP_011414031.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  80.1    1e-13   Crassostrea gigas
ref|XP_011414030.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  80.1    1e-13   Crassostrea gigas
gb|EKC30956.1|  E3 ubiquitin-protein ligase HECTD1                    80.1    1e-13   Crassostrea gigas
ref|XP_004521542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  80.1    2e-13   Ceratitis capitata [medfly]
ref|XP_004521546.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.7    2e-13   Ceratitis capitata [medfly]
ref|XP_004521545.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.7    2e-13   Ceratitis capitata [medfly]
ref|XP_004521547.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.3    2e-13   
ref|XP_011199881.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.3    2e-13   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199880.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.3    2e-13   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011199876.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.3    2e-13   
ref|XP_011199879.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  79.3    2e-13   Bactrocera dorsalis [papaya fruit fly]
ref|XP_005178040.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  78.6    5e-13   
ref|XP_011290265.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  78.6    5e-13   Musca domestica
ref|XP_011290264.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  78.6    5e-13   Musca domestica
ref|XP_005178039.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  78.2    5e-13   Musca domestica
ref|XP_011290263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  78.2    5e-13   Musca domestica
ref|XP_639138.1|  BTB/POZ domain-containing protein                   77.0    1e-12   Dictyostelium discoideum AX4
gb|AAB47544.1|  MigA                                                  76.6    1e-12   Dictyostelium discoideum
ref|XP_005842130.1|  hypothetical protein GUITHDRAFT_41514            71.2    2e-12   Guillardia theta CCMP2712
ref|XP_003288046.1|  hypothetical protein DICPUDRAFT_16127            75.1    3e-12   Dictyostelium purpureum
ref|XP_011406508.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  75.9    3e-12   
ref|XP_002424807.1|  hect E3 ubiquitin ligase, putative               75.9    3e-12   Pediculus humanus corporis [human body lice]
ref|XP_004909451.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.3    1e-11   
ref|XP_004864091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  74.3    1e-11   Heterocephalus glaber [naked mole rat]
ref|XP_007429074.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    1e-11   
ref|XP_004909450.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    1e-11   
ref|XP_004864090.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    1e-11   Heterocephalus glaber [naked mole rat]
ref|XP_004909448.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    1e-11   
ref|XP_004864088.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.9    1e-11   Heterocephalus glaber [naked mole rat]
ref|XP_007063755.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  73.9    1e-11   
ref|XP_007429075.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
gb|EMP32200.1|  E3 ubiquitin-protein ligase HECTD1                    73.6    2e-11   Chelonia mydas [green seaturtle]
ref|XP_010631867.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Fukomys damarensis [Damara mole rat]
ref|XP_007429073.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005196337.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_005196336.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   
ref|XP_010631866.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Fukomys damarensis [Damara mole rat]
ref|XP_008162333.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Chrysemys picta bellii
ref|XP_010333269.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Saimiri boliviensis boliviensis
ref|XP_010333268.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.6    2e-11   Saimiri boliviensis boliviensis
ref|XP_009909049.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    2e-11   Picoides pubescens
ref|XP_010961316.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Camelus bactrianus [camel]
ref|XP_005881051.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Myotis brandtii
ref|XP_004755203.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Mustela putorius furo [black ferret]
ref|XP_006056669.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_005695270.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_010961314.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Camelus bactrianus [camel]
ref|XP_004755201.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Mustela putorius furo [black ferret]
ref|XP_004801249.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    2e-11   
ref|XP_005196334.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_006116433.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_009004155.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Callithrix jacchus [common marmoset]
ref|XP_005377022.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_005285367.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_004055105.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    73.2    2e-11   
ref|XP_006116431.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006085913.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_005881050.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_011374706.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Pteropus vampyrus
ref|XP_010586873.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Loxodonta africana [African bush elephant]
ref|XP_009004153.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Callithrix jacchus [common marmoset]
ref|XP_006085912.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_005881054.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Myotis brandtii
ref|XP_004467983.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Dasypus novemcinctus
ref|XP_005285366.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Chrysemys picta bellii
ref|XP_011222356.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Ailuropoda melanoleuca
ref|XP_010845303.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Bison bison bison
ref|XP_010372961.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Rhinopithecus roxellana
ref|XP_007984591.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Chlorocebus sabaeus
ref|XP_006056670.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_007098141.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Panthera tigris altaica
ref|XP_005222132.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Bos taurus [bovine]
ref|XP_006056668.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_005695269.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_005377020.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_011222354.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Ailuropoda melanoleuca
ref|XP_010845301.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Bison bison bison
ref|XP_010372959.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Rhinopithecus roxellana
ref|XP_006056667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_007098140.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Panthera tigris altaica
ref|XP_005267560.2|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_005695268.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_005377019.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_005222130.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Bos taurus [bovine]
ref|XP_008565372.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Galeopterus variegatus [Malayan flying lemur]
gb|ELK17058.1|  E3 ubiquitin-protein ligase HECTD1                    73.2    2e-11   Pteropus alecto
ref|XP_010631865.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Fukomys damarensis [Damara mole rat]
ref|XP_010631864.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Fukomys damarensis [Damara mole rat]
ref|XP_005196335.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_007113428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_008972942.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Pan paniscus [bonobo]
ref|XP_007472588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Monodelphis domestica
ref|XP_010333267.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Saimiri boliviensis boliviensis
ref|XP_003924275.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Saimiri boliviensis boliviensis
ref|XP_007660828.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   
ref|XP_007660814.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_007472586.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    2e-11   Monodelphis domestica
ref|XP_008267702.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008267700.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  73.2    3e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004755202.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Mustela putorius furo [black ferret]
ref|XP_850301.2|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-pr...  72.8    3e-11   Canis lupus familiaris [dogs]
gb|ELW63202.1|  E3 ubiquitin-protein ligase HECTD1                    72.8    3e-11   Tupaia chinensis
ref|XP_010586874.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Loxodonta africana [African bush elephant]
ref|XP_006766087.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_004755198.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Mustela putorius furo [black ferret]
ref|XP_004376588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_006116430.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008565371.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Galeopterus variegatus [Malayan flying lemur]
ref|XP_011281667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_010214811.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Tinamus guttatus
ref|XP_008101615.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Anolis carolinensis [Carolina anole]
ref|XP_008101614.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Anolis carolinensis [Carolina anole]
ref|XP_003792055.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_008101612.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Anolis carolinensis [Carolina anole]
ref|XP_011222355.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Ailuropoda melanoleuca
ref|XP_010845302.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Bison bison bison
ref|XP_010372960.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Rhinopithecus roxellana
ref|XP_009004154.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Callithrix jacchus [common marmoset]
ref|XP_005377021.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_004467984.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Dasypus novemcinctus
ref|XP_006116428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_004637178.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_010961313.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Camelus bactrianus [camel]
ref|XP_004755200.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Mustela putorius furo [black ferret]
ref|XP_004755199.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Mustela putorius furo [black ferret]
ref|XP_007516893.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   Erinaceus europaeus [common hedgehog]
ref|XP_004584798.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   Ochotona princeps [southern American pika]
ref|XP_006116432.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_008972943.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Pan paniscus [bonobo]
ref|XP_007984590.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Chlorocebus sabaeus
ref|XP_011374705.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Pteropus vampyrus
ref|XP_006152455.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_011374703.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Pteropus vampyrus
ref|XP_008708622.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  72.8    3e-11   Ursus maritimus [white bear]
ref|XP_006906925.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  72.8    3e-11   
ref|XP_006085911.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_005377018.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Chinchilla lanigera
ref|XP_004467981.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Dasypus novemcinctus
ref|XP_004421198.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_001924707.4|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  72.8    3e-11   
ref|XP_003408766.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Loxodonta africana [African bush elephant]
ref|XP_002753836.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Callithrix jacchus [common marmoset]
gb|AAP13073.1|  E3 ligase for inhibin receptor                        72.8    3e-11   Homo sapiens [man]
ref|XP_008267701.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_005222131.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Bos taurus [bovine]
ref|XP_010586872.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010984469.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  72.8    3e-11   Camelus dromedarius [camel]
ref|XP_011222353.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Ailuropoda melanoleuca
ref|XP_010845300.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Bison bison bison
ref|XP_010372958.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Rhinopithecus roxellana
ref|XP_008972941.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Pan paniscus [bonobo]
ref|XP_009004152.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Callithrix jacchus [common marmoset]
ref|XP_007984588.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Chlorocebus sabaeus
ref|XP_007098139.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Panthera tigris altaica
ref|XP_005222129.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Bos taurus [bovine]
ref|XP_004467982.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Dasypus novemcinctus
gb|ELR60436.1|  E3 ubiquitin-protein ligase HECTD1                    72.8    3e-11   Bos mutus
ref|XP_010372956.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Rhinopithecus roxellana
ref|XP_008071204.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   Carlito syrichta
ref|XP_002918561.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Ailuropoda melanoleuca
ref|XP_002696742.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Bos taurus [bovine]
ref|XP_006056666.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Bubalus bubalis [domestic water buffalo]
ref|XP_007098138.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Panthera tigris altaica
ref|XP_006835428.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   Chrysochloris asiatica
ref|XP_006890036.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006191324.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_005890166.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   Bos mutus
ref|XP_005881052.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Myotis brandtii
ref|XP_004017927.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_003821255.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Pan paniscus [bonobo]
ref|XP_003260766.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
sp|Q9ULT8.3|HECD1_HUMAN  RecName: Full=E3 ubiquitin-protein ligas...  72.8    3e-11   Homo sapiens [man]
ref|NP_001248188.1|  E3 ubiquitin-protein ligase HECTD1               72.8    3e-11   Macaca mulatta [rhesus macaque]
gb|EPQ16917.1|  E3 ubiquitin-protein ligase HECTD1                    72.8    3e-11   Myotis brandtii
ref|XP_010572566.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Haliaeetus leucocephalus
ref|XP_010709953.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Meleagris gallopavo [common turkey]
ref|XP_010390298.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   Corvus cornix cornix
ref|XP_005020671.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010572562.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009288639.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009288638.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_005020668.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_008267699.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_002718172.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010709956.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010390313.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009317632.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_005020674.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009317630.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009288640.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010709952.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010390290.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009317628.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_007936773.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_004612165.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_009288642.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_010572563.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_007660818.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_007472587.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_007472585.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_007180745.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  72.8    3e-11   
ref|XP_007451326.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_004282185.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_009209621.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_007660823.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_003464797.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  72.8    3e-11   
ref|XP_004941800.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009288633.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
gb|EMC83831.1|  E3 ubiquitin-protein ligase HECTD1                    72.8    3e-11   
ref|XP_007660811.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_001512305.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_001364091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009209622.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009317629.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_007113427.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_007113426.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_006022320.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_006263085.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_004400006.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_006729616.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
gb|KFV93612.1|  E3 ubiquitin-protein ligase HECTD1                    72.8    3e-11   
ref|XP_009288631.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_008565370.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_009288641.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_003756170.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.8    3e-11   
ref|XP_008101613.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
ref|XP_001969437.1|  GG23957                                          72.8    3e-11   
ref|XP_008101608.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.8    3e-11   
gb|KFV19064.1|  E3 ubiquitin-protein ligase HECTD1                    72.4    3e-11   
ref|XP_008101611.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    3e-11   
ref|XP_008101607.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    3e-11   
ref|XP_010214809.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
gb|KGL94873.1|  E3 ubiquitin-protein ligase HECTD1                    72.4    4e-11   
gb|KFP02468.1|  E3 ubiquitin-protein ligase HECTD1                    72.4    4e-11   
ref|XP_010140687.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_004324112.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_006263084.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_006022319.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
gb|KFO93631.1|  E3 ubiquitin-protein ligase HECTD1                    72.4    4e-11   
ref|XP_001749884.1|  hypothetical protein                             72.4    4e-11   
ref|XP_009877228.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009668205.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009288636.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_006022318.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009288634.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009317623.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009288632.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009317631.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010169085.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_010015718.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_005020669.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009317626.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005520368.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_002200542.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_010709950.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009317622.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_006263086.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010709954.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009574994.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009288635.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_008101609.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
gb|KFP99363.1|  E3 ubiquitin-protein ligase HECTD1                    72.4    4e-11   
ref|XP_010151091.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009462362.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009317621.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009317620.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010709955.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_002089068.1|  GE26196                                          72.4    4e-11   
ref|XP_010572561.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010307144.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009951548.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009942450.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009100181.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_005149352.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_010390277.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009317624.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005020667.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005020665.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005020664.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
gb|EOB00564.1|  E3 ubiquitin-protein ligase HECTD1                    72.4    4e-11   
ref|XP_010286320.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009806354.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_010709951.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010125887.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009992149.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009698490.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009644998.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_009561891.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_008923247.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_008637792.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_005417553.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_005479915.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_005020673.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_421227.3|  PREDICTED: E3 ubiquitin-protein ligase HECTD1 i...  72.4    4e-11   
gb|KFP65021.1|  E3 ubiquitin-protein ligase HECTD1                    72.4    4e-11   
ref|XP_010572558.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009317625.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010709948.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010390263.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005020666.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005951436.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005020672.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005561083.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005561082.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009986276.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_010390306.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009209620.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005020670.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009507570.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_010572565.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
gb|KFP49559.1|  E3 ubiquitin-protein ligase HECTD1                    72.4    4e-11   
ref|XP_010572559.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010709949.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010390270.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_004941799.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010572556.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005322716.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_010572564.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_010572557.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_004941798.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_004941801.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_005502361.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_004941797.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_004341500.1|  BTB/POZ domain containing protein                70.5    4e-11   
ref|XP_009885241.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_008942534.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
ref|XP_008494127.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
gb|EHH27804.1|  hypothetical protein EGK_18090                        72.4    4e-11   
ref|XP_004698576.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    4e-11   
dbj|BAA86445.2|  KIAA1131 protein                                     72.4    4e-11   
ref|XP_005456015.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_008312937.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.4    4e-11   
ref|XP_009075355.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    5e-11   
ref|XP_005047457.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.4    5e-11   
ref|XP_005603479.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    5e-11   
ref|XP_005603476.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    5e-11   
ref|XP_005603478.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    5e-11   
ref|XP_005603477.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    5e-11   
ref|XP_008521118.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    5e-11   
gb|KFV06434.1|  E3 ubiquitin-protein ligase HECTD1                    72.0    5e-11   
ref|XP_008521116.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    5e-11   
ref|NP_001131085.1|  HECT domain containing E3 ubiquitin protein ...  72.0    5e-11   
ref|XP_008159020.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.0    5e-11   
ref|XP_010071203.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.0    5e-11   
ref|XP_005456013.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    5e-11   
ref|XP_008312929.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    6e-11   
ref|XP_005456014.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    6e-11   
ref|XP_008312922.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  72.0    6e-11   
ref|XP_002078905.1|  GD22285                                          72.0    6e-11   
emb|CDK13346.1|  HECD-1, isoform h                                    72.0    6e-11   
emb|CDK13340.1|  HECD-1, isoform b                                    72.0    6e-11   
emb|CDK13341.1|  HECD-1, isoform c                                    72.0    6e-11   
ref|XP_005240951.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    72.0    6e-11   
emb|CDK13342.1|  HECD-1, isoform d                                    72.0    6e-11   
emb|CDK13343.1|  HECD-1, isoform e                                    72.0    6e-11   
emb|CDK13339.1|  HECD-1, isoform a                                    72.0    6e-11   
emb|CDK13344.1|  HECD-1, isoform f                                    72.0    6e-11   
emb|CDK13345.1|  HECD-1, isoform g                                    72.0    6e-11   
ref|XP_009968713.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    71.6    6e-11   
ref|XP_003451257.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    6e-11   
ref|XP_008521117.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    6e-11   
ref|XP_005728612.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  71.6    6e-11   
ref|XP_001489913.2|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    6e-11   
ref|XP_008521115.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    6e-11   
ref|XP_008521114.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    6e-11   
ref|XP_010198466.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    71.6    7e-11   
ref|NP_501120.1|  Protein HECD-1                                      71.6    7e-11   
ref|XP_004554704.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...  71.6    7e-11   
ref|XP_002036468.1|  GM11846                                          71.6    7e-11   
ref|XP_002004091.1|  GI19489                                          71.6    8e-11   
ref|XP_008837027.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    8e-11   
gb|KDR14371.1|  E3 ubiquitin-protein ligase HECTD1                    71.6    8e-11   
ref|XP_008837026.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.6    8e-11   
ref|XP_008837025.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.2    1e-10   
ref|XP_008837024.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.2    1e-10   
ref|XP_008275346.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.2    1e-10   
ref|XP_008275345.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  71.2    1e-10   
ref|XP_007257970.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.9    1e-10   
ref|XP_006975329.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.9    1e-10   
ref|XP_010177459.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    70.9    1e-10   
ref|XP_011242353.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.9    1e-10   
ref|XP_006240150.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.9    1e-10   
ref|XP_007637045.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.9    1e-10   
ref|XP_004989701.1|  hypothetical protein PTSG_12883                  70.9    1e-10   
ref|XP_004682014.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    70.9    1e-10   
ref|XP_007257971.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.9    1e-10   
ref|XP_007891590.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_007257972.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_006975330.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_007257968.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_007257967.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_007257966.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_006975328.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_011242351.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_006975327.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_003499219.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_007891591.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_006240151.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD...  70.5    1e-10   
ref|XP_005343806.1|  PREDICTED: E3 ubiquitin-protein ligase HECTD1    70.5    1e-10   



>ref|XP_006342129.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Solanum tuberosum]
Length=824

 Score =   287 bits (734),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G D
Sbjct  668  HQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNASWWMVDIGPD  727

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAF+R WNFQGS DG NWTNLRVH++DQTICKPGQFASWPITG N
Sbjct  728  HQLMCNYYTLRQDGSRAFIRRWNFQGSLDGKNWTNLRVHENDQTICKPGQFASWPITGSN  787

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  788  ALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_006342130.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006342131.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Solanum tuberosum]
Length=804

 Score =   286 bits (733),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G D
Sbjct  648  HQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNASWWMVDIGPD  707

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAF+R WNFQGS DG NWTNLRVH++DQTICKPGQFASWPITG N
Sbjct  708  HQLMCNYYTLRQDGSRAFIRRWNFQGSLDGKNWTNLRVHENDQTICKPGQFASWPITGSN  767

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  768  ALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_004238427.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010320456.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
Length=804

 Score =   282 bits (722),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G D
Sbjct  648  HQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNTSWWMVDIGPD  707

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAF+R WN QGS DG +WTNLRVH++DQTICKPGQFASWP+TG N
Sbjct  708  HQLMCNYYTLRQDGSRAFIRRWNLQGSLDGKSWTNLRVHENDQTICKPGQFASWPVTGSN  767

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  768  ALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_010320455.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Solanum lycopersicum]
Length=824

 Score =   283 bits (723),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G D
Sbjct  668  HQWVNPVLSKRVIITASSPISRCTDPKVLVSRNFQGTSVAGPQMEGGRNTSWWMVDIGPD  727

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAF+R WN QGS DG +WTNLRVH++DQTICKPGQFASWP+TG N
Sbjct  728  HQLMCNYYTLRQDGSRAFIRRWNLQGSLDGKSWTNLRVHENDQTICKPGQFASWPVTGSN  787

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR++MTGP TD+ NPWNCCIC LELYGYFR
Sbjct  788  ALLPFRFFRVLMTGPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_009631576.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Nicotiana tomentosiformis]
Length=804

 Score =   281 bits (719),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSKRV++TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G D
Sbjct  648  HQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLAGPQMEGGRNTSWWMVDVGQD  707

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH++DQ+ICKP QFASWPIT PN
Sbjct  708  HQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHENDQSICKPCQFASWPITDPN  767

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYFR
Sbjct  768  ALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  804



>ref|XP_009631574.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009631575.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
Length=824

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSKRV++TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G D
Sbjct  668  HQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLAGPQMEGGRNTSWWMVDVGQD  727

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH++DQ+ICKP QFASWPIT PN
Sbjct  728  HQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHENDQSICKPCQFASWPITDPN  787

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYFR
Sbjct  788  ALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  824



>ref|XP_009631572.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Nicotiana tomentosiformis]
Length=826

 Score =   281 bits (719),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSKRV++TASSP SR TDPKVLVSRNFQGTS AGPQ+E G  +SWWM+D+G D
Sbjct  670  HQWVNPVLSKRVSITASSPISRCTDPKVLVSRNFQGTSLAGPQMEGGRNTSWWMVDVGQD  729

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAFMR WNFQGS DG +WTNLRVH++DQ+ICKP QFASWPIT PN
Sbjct  730  HQLMCNYYTLRQDGSRAFMRRWNFQGSLDGKSWTNLRVHENDQSICKPCQFASWPITDPN  789

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR++M+ P TD+ NPWNCCIC LELYGYFR
Sbjct  790  ALLPFRFFRVLMSAPTTDDTNPWNCCICFLELYGYFR  826



>ref|XP_002879271.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55530.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score =   276 bits (705),  Expect = 1e-83, Method: Composition-based stats.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWWM+DLG 
Sbjct  652  SHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGHISSWWMVDLGE  711

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  712  DHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAA  771

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP  D   PWN CIC LELYGY+R
Sbjct  772  NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYYR  809



>ref|XP_002510674.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52861.1| protein binding protein, putative [Ricinus communis]
Length=806

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L+KR+ +TASSP  R TDPK LVSR +QGTSFAGP++EDGN  +WWM+D+G D
Sbjct  650  HQWVNPVLAKRITITASSPTLRHTDPKALVSRTYQGTSFAGPRMEDGNKCAWWMVDIGKD  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRA++R WN QGS DG +WTNLRVHKDDQT+CKPGQFASWPITGPN
Sbjct  710  HQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKSWTNLRVHKDDQTVCKPGQFASWPITGPN  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP TD  +PWN CIC LELYGYFR
Sbjct  770  SLLPFRFFRVILTGPTTDVSDPWNLCICFLELYGYFR  806



>ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459073.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW NP+L+KR+ +TASSP SRFTDPKVLVSR +QGTSFAGP +EDG  ++WWM+D+G D
Sbjct  647  HQWFNPVLAKRITITASSPPSRFTDPKVLVSRTYQGTSFAGPHIEDGRNNTWWMVDIGAD  706

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQL+CNYYT+R DGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFASWP+TGPN
Sbjct  707  HQLICNYYTLRHDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVTGPN  766

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  767  ALLPFRFFRVVLTGPTMDASNPWNFCICFLELYGYFH  803



>ref|XP_010469824.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Camelina sativa]
Length=823

 Score =   273 bits (699),  Expect = 1e-82, Method: Composition-based stats.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG 
Sbjct  666  SHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWMVDLGE  725

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  726  DHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVHEDDQTMCKAGQFASWPITAA  785

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  786  NALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  823



>dbj|BAD95193.1| hypothetical protein [Arabidopsis thaliana]
Length=331

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW++DLG 
Sbjct  174  SHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWWVVDLGE  233

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  234  EHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAA  293

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  294  NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  331



>ref|XP_010469826.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469827.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469828.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469829.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
Length=809

 Score =   273 bits (698),  Expect = 1e-82, Method: Composition-based stats.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG 
Sbjct  652  SHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWMVDLGE  711

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  712  DHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVHEDDQTMCKAGQFASWPITAA  771

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  772  NALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  809



>ref|XP_010414240.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Camelina 
sativa]
Length=824

 Score =   273 bits (699),  Expect = 1e-82, Method: Composition-based stats.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG 
Sbjct  667  SHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWMVDLGE  726

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  727  DHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGRTWTDLRVHEDDQTMCKAGQFASWPITAA  786

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+++TGP TD   PWN CIC LELYGY+R
Sbjct  787  NALLPFRFFRLLLTGPTTDTSTPWNFCICYLELYGYYR  824



>ref|XP_010469825.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Camelina sativa]
Length=818

 Score =   273 bits (697),  Expect = 2e-82, Method: Composition-based stats.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG 
Sbjct  661  SHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWMVDLGE  720

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  721  DHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKIWTDLRVHEDDQTMCKAGQFASWPITAA  780

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP TD   PWN CIC LELYGY+R
Sbjct  781  NALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYYR  818



>gb|KFK23322.1| hypothetical protein AALP_AAs74635U001200 [Arabis alpina]
Length=807

 Score =   273 bits (697),  Expect = 2e-82, Method: Composition-based stats.
 Identities = 114/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWWM+DLG 
Sbjct  650  SHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGHISSWWMVDLGE  709

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH++DQT+CK GQFASWPIT  
Sbjct  710  DHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHENDQTMCKAGQFASWPITAA  769

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP  D   PWN CIC LELYGY R
Sbjct  770  NALLPFRFFRLVLTGPTVDTSTPWNFCICYLELYGYLR  807



>ref|XP_008452951.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452952.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
Length=806

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNPILSK++ +T SSP SR+TDPKVLVSR +QGTSFAG +VEDG   SWWM+D+G D
Sbjct  650  HQWVNPILSKKITITTSSPPSRYTDPKVLVSRTYQGTSFAGLRVEDGKTCSWWMVDIGED  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CKPGQFASWP+TGPN
Sbjct  710  HQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVHENDQTVCKPGQFASWPVTGPN  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
             LLPFRFFR+++T P TD  NPWN CIC LELYGYF
Sbjct  770  ALLPFRFFRVLLTAPTTDASNPWNLCICFLELYGYF  805



>ref|XP_010510327.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
 ref|XP_010510328.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
Length=809

 Score =   271 bits (692),  Expect = 8e-82, Method: Composition-based stats.
 Identities = 115/158 (73%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG 
Sbjct  652  SHQWVNPVLAKKIIITSSSPTSRFTDPKALASKAYVGTSFAGPRMEGGHISSWWMVDLGE  711

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  712  DHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAA  771

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP TD   PWN  IC LELYGYFR
Sbjct  772  NALLPFRFFRLVLTGPTTDTSTPWNFYICYLELYGYFR  809



>ref|XP_010061166.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Eucalyptus grandis]
 gb|KCW68087.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
 gb|KCW68088.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
Length=802

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+++KR+ +TASSP SR+TDPKVLVSR FQGTSFAGP++EDG+  SWWM+D+G D
Sbjct  646  HQWVNPVIAKRIFITASSPISRYTDPKVLVSRTFQGTSFAGPRIEDGHNCSWWMVDIGED  705

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRA+MRSW  QGS DG +WT+LR H +DQTICKPGQFASWPITGPN
Sbjct  706  HQLMCNYYTLRQDGSRAYMRSWKLQGSVDGSSWTDLRAHDNDQTICKPGQFASWPITGPN  765

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFR+FR V+TGP T   NPWN  IC LELYGYFR
Sbjct  766  ALLPFRYFRFVLTGPTTGASNPWNFSICFLELYGYFR  802



>gb|KJB57964.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
 gb|KJB57965.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
Length=802

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            H WVNP+LSKR+ +TASSP SR TDPKVLVSR +QGT FAGP++E+GNI +WWM+D+G D
Sbjct  646  HPWVNPVLSKRITITASSPASRHTDPKVLVSRTYQGTCFAGPRMENGNICAWWMVDIGKD  705

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRA++R+W FQG  DG  W +LRVH++DQT+CKPGQFASWP+TGPN
Sbjct  706  HQLMCNYYTLRQDGSRAYIRNWKFQGCMDGKTWIDLRVHENDQTMCKPGQFASWPVTGPN  765

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP TD  NPWN CIC LELYGYFR
Sbjct  766  ALLPFRFFRVLLTGPTTDASNPWNLCICFLELYGYFR  802



>ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221134.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221135.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221136.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
Length=805

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L+KR+ +TASSP SRFTDPK LVSR +QGTSFAGPQ+ DG+  +WWM+D+  D
Sbjct  649  HQWVNPVLAKRITITASSPPSRFTDPKALVSRTYQGTSFAGPQIIDGHNCTWWMVDISAD  708

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQL+CNYYT+RQDGSRA+MR W FQGS DG  WTNLRVH++DQTICKPGQFASWP+TGPN
Sbjct  709  HQLICNYYTLRQDGSRAYMRYWKFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVTGPN  768

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLP+RFFR+V+TGP TD  NPWN CIC+LELYGY  
Sbjct  769  ALLPYRFFRVVLTGPTTDASNPWNFCICLLELYGYLH  805



>emb|CDP07293.1| unnamed protein product [Coffea canephora]
Length=802

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSK+V VTASSP SRFTDPKVL SR +QGTSFAG ++ DG  +SWWM+D+G  
Sbjct  646  HQWVNPVLSKKVTVTASSPTSRFTDPKVLASRTYQGTSFAGSRMGDGRNTSWWMVDIGPG  705

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS+AFMR WNFQGS+DG NWTNLR+H+ D+T+CKPGQFASWPI  PN
Sbjct  706  HQLMCNYYTLRQDGSKAFMRCWNFQGSSDGRNWTNLRIHEKDETLCKPGQFASWPINDPN  765

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+ MT P TD+ NPWNCCIC LELYGYF 
Sbjct  766  ALLPFRFFRVTMTAPTTDDTNPWNCCICFLELYGYFH  802



>ref|XP_007221940.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
 gb|EMJ23139.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
Length=805

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L+KR+ +TASSP SRFTDPK LVSR +QGTSFAGPQ+ DG+  +WWM+D+  D
Sbjct  649  HQWVNPVLAKRITITASSPPSRFTDPKALVSRTYQGTSFAGPQIIDGHNCTWWMVDISAD  708

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQL+CNYYT+RQDGSR +MR W FQGS DG  WTNLRVH++DQTICKPGQFASWP+TGPN
Sbjct  709  HQLICNYYTLRQDGSRTYMRYWKFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVTGPN  768

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLP+RFFR+V+TGP TD  NPWN CIC+LELYGYF 
Sbjct  769  ALLPYRFFRVVLTGPTTDASNPWNFCICLLELYGYFH  805



>ref|XP_010061165.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Eucalyptus grandis]
Length=853

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+++KR+ +TASSP SR+TDPKVLVSR FQGTSFAGP++EDG+  SWWM+D+G D
Sbjct  697  HQWVNPVIAKRIFITASSPISRYTDPKVLVSRTFQGTSFAGPRIEDGHNCSWWMVDIGED  756

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRA+MRSW  QGS DG +WT+LR H +DQTICKPGQFASWPITGPN
Sbjct  757  HQLMCNYYTLRQDGSRAYMRSWKLQGSVDGSSWTDLRAHDNDQTICKPGQFASWPITGPN  816

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFR+FR V+TGP T   NPWN  IC LELYGYFR
Sbjct  817  ALLPFRYFRFVLTGPTTGASNPWNFSICFLELYGYFR  853



>ref|XP_011074097.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Sesamum 
indicum]
Length=804

 Score =   269 bits (687),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSK+V +T SSP SRFTDPKVLVSR++QGTSFAGP+ EDG  +SWWM+D+G+ 
Sbjct  648  HQWVNPVLSKKVTITPSSPLSRFTDPKVLVSRSYQGTSFAGPRKEDGRTTSWWMVDIGHG  707

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAF+R+W+FQGS DG NWTNLRVH++D T+CKPGQ+ASWP+ GPN
Sbjct  708  HQLMCNYYTLRQDGSRAFIRNWSFQGSMDGNNWTNLRVHENDVTMCKPGQYASWPVVGPN  767

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR V+T P TD  NPW+ CIC LELYGYFR
Sbjct  768  ALLPFRFFRAVLTAPTTDITNPWSFCICFLELYGYFR  804



>gb|EYU36560.1| hypothetical protein MIMGU_mgv1a001528mg [Erythranthe guttata]
Length=802

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSK+V +TASSPFSRFTDPKVLVSR++ GTSFAGP++E+G  ++WWM+D+G+ 
Sbjct  646  HQWVNPVLSKKVIITASSPFSRFTDPKVLVSRSYLGTSFAGPRMENGRNTAWWMVDIGHS  705

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCN+YT+RQDGSRAFMR+WNFQGS DG NWTNLRVH++D+T+ KPGQFASWP+ GP 
Sbjct  706  HQLMCNHYTLRQDGSRAFMRNWNFQGSMDGNNWTNLRVHENDETMSKPGQFASWPVVGPT  765

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+V+  P TD  NPW+ CIC LELYGYFR
Sbjct  766  ALLPFRFFRVVLVAPTTDATNPWSLCICFLELYGYFR  802



>ref|XP_004145539.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 ref|XP_004164111.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 gb|KGN55497.1| hypothetical protein Csa_4G658570 [Cucumis sativus]
Length=806

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNPILSK++ +T SSP SR+TDPKVLVSR +QGTSF G +VEDG   SWWM+D+G D
Sbjct  650  HQWVNPILSKKITITTSSPPSRYTDPKVLVSRTYQGTSFTGLRVEDGKTCSWWMVDIGED  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CKPGQFASW +TGPN
Sbjct  710  HQLMCNYYTLRQDGSRAFIRYWNLQGSFDGKTWTNLRVHENDQTVCKPGQFASWAVTGPN  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
             LLPFRFFR+++T P TD  NPWN CIC LELYGYF
Sbjct  770  ALLPFRFFRVLLTAPTTDASNPWNLCICFLELYGYF  805



>gb|KHG01113.1| hypothetical protein F383_22949 [Gossypium arboreum]
Length=802

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            H WVNP+LSKR+ +TASSP SR TDPKVLVSR +QGT FAGP++E+GNI +WWM+D+G D
Sbjct  646  HPWVNPVLSKRITITASSPASRHTDPKVLVSRTYQGTCFAGPRMENGNICAWWMVDIGKD  705

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRA++R+W FQG  DG  W +LRVH++DQT+CKPGQFASWP+TGPN
Sbjct  706  HQLMCNYYTLRQDGSRAYIRNWKFQGCMDGKTWIDLRVHENDQTMCKPGQFASWPVTGPN  765

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TG  TD  NPWN CIC LELYGYFR
Sbjct  766  ALLPFRFFRVLLTGLTTDASNPWNLCICFLELYGYFR  802



>ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Malus domestica]
Length=805

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L+KR+ +TASSP SRFTDPK LVSR ++GTSFAGPQ+EDG+ S+WW +D+G D
Sbjct  649  HQWVNPVLAKRITITASSPPSRFTDPKALVSRTYRGTSFAGPQIEDGHKSTWWTVDIGAD  708

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFASWP+ G N
Sbjct  709  HQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVIGQN  768

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  769  ALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYFH  805



>ref|XP_008377081.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Malus domestica]
Length=803

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L+KR+ +TASSP SRFTDPK LVSR ++GTSFAGPQ+EDG+ S+WW +D+G D
Sbjct  647  HQWVNPVLAKRITITASSPPSRFTDPKALVSRTYRGTSFAGPQIEDGHKSTWWTVDIGAD  706

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFASWP+ G N
Sbjct  707  HQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVIGQN  766

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  767  ALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYFH  803



>emb|CBI40712.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNPIL+KR+ +TASSP SR TDPKVLVSR +QGTSF GP+VEDG   SWWM+D+G D
Sbjct  633  HQWVNPILAKRITITASSPTSRHTDPKVLVSRTYQGTSFTGPRVEDGKNCSWWMVDIGED  692

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRA++R WN QGS DG  WTNLRVH++DQT+CKPGQ+ASWPI  PN
Sbjct  693  HQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKAWTNLRVHENDQTMCKPGQYASWPIMAPN  752

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP +D  NPWN CIC LELYGYF 
Sbjct  753  ALLPFRFFRVILTGPTSDASNPWNFCICFLELYGYFH  789



>ref|XP_002270675.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vitis 
vinifera]
Length=806

 Score =   266 bits (680),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNPIL+KR+ +TASSP SR TDPKVLVSR +QGTSF GP+VEDG   SWWM+D+G D
Sbjct  650  HQWVNPILAKRITITASSPTSRHTDPKVLVSRTYQGTSFTGPRVEDGKNCSWWMVDIGED  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRA++R WN QGS DG  WTNLRVH++DQT+CKPGQ+ASWPI  PN
Sbjct  710  HQLMCNYYTLRQDGSRAYIRFWNLQGSLDGKAWTNLRVHENDQTMCKPGQYASWPIMAPN  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP +D  NPWN CIC LELYGYF 
Sbjct  770  ALLPFRFFRVILTGPTSDASNPWNFCICFLELYGYFH  806



>ref|XP_006410166.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
 gb|ESQ51619.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
Length=806

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP+ EDG+ISSWWM+DLG 
Sbjct  649  SHQWVNPVLAKKINITSSSPTSRFTDPKALASKTYVGTSFAGPRKEDGHISSWWMVDLGE  708

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  709  DHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAA  768

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+ +TGP TD   PWN CIC LELYGYFR
Sbjct  769  NALLPFRFFRLFLTGPTTDTSTPWNFCICYLELYGYFR  806



>ref|XP_006293695.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
 gb|EOA26593.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
Length=809

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++E G+ISSWWM+DLG 
Sbjct  652  SHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEGGHISSWWMVDLGE  711

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRAF RSW FQGS DG  WT+LR+H+DDQT+CK GQFASWPIT  
Sbjct  712  DHQLMCNYYTFRQDGSRAFTRSWKFQGSMDGKTWTDLRIHEDDQTMCKVGQFASWPITAA  771

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP TD   PWN CIC LELYGYFR
Sbjct  772  NALLPFRFFRLVLTGPTTDTSTPWNFCICYLELYGYFR  809



>ref|XP_006664953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Oryza 
brachyantha]
Length=805

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+K + V ASSP SR+TDPK LVS+N+QGT FAGP++EDG + SWWM+D+G+D
Sbjct  649  HQWINPVLAKNIKVIASSPNSRYTDPKALVSKNYQGTCFAGPRLEDGKMCSWWMVDIGHD  708

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS  FMRSW  QGS DG NWT+LR+HKDDQTIC+PGQFASWPITGP+
Sbjct  709  HQLMCNYYTVRQDGSTTFMRSWVLQGSMDGQNWTSLRIHKDDQTICQPGQFASWPITGPS  768

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TG  T   N WN CIC LELYGYFR
Sbjct  769  ALLPFRFFRVMLTGHATGVSNTWNLCICFLELYGYFR  805



>ref|XP_011034879.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
 ref|XP_011034880.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
Length=808

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGT FAGP+VE G I +WWMID+G D
Sbjct  652  HQWINPLLAKRITITASSPPSRYTDPKALVSRTYQGTCFAGPRVEGGQIHAWWMIDIGQD  711

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK GQFASWPITGP 
Sbjct  712  HQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVHENDQTMCKAGQFASWPITGPQ  771

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  772  ALLPFRFFRVLLTGPTTDGSNPHNLCICFLELYGYFH  808



>ref|XP_002300643.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE79916.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=801

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGT FAGP+VE G I +WWMID+G D
Sbjct  645  HQWINPLLAKRITITASSPPSRYTDPKALVSRTYQGTCFAGPRVEGGQIHAWWMIDIGQD  704

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK GQFASWPITGP 
Sbjct  705  HQLMCNHYTLRQDGSRAFIRCWNLQGSLDGKTWTNLRVHENDQTMCKAGQFASWPITGPQ  764

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+V+TGP TD  NP N CIC LELYGYF 
Sbjct  765  ALLPFRFFRVVLTGPTTDGSNPHNLCICFLELYGYFH  801



>ref|XP_011034881.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Populus euphratica]
Length=801

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGT FAGP+VE G I +WWMID+G D
Sbjct  645  HQWINPLLAKRITITASSPPSRYTDPKALVSRTYQGTCFAGPRVEGGQIHAWWMIDIGQD  704

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK GQFASWPITGP 
Sbjct  705  HQLMCNYYTLRQDGSRAFIRYWNLQGSLDGKTWTNLRVHENDQTMCKAGQFASWPITGPQ  764

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  765  ALLPFRFFRVLLTGPTTDGSNPHNLCICFLELYGYFH  801



>emb|CDY29657.1| BnaA04g17700D [Brassica napus]
Length=844

 Score =   263 bits (673),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWWM+DLG 
Sbjct  687  SHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWWMVDLGE  746

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFASWPIT  
Sbjct  747  DHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFASWPITAA  806

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  807  NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  844



>ref|XP_010935266.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935267.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935268.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
Length=805

 Score =   263 bits (671),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSK++ VTASSP SR+TDPK LVSR +QGTSFAGP++EDG   +WWM+D+G D
Sbjct  649  HQWVNPVLSKKITVTASSPASRYTDPKTLVSRAYQGTSFAGPRIEDGMNCAWWMVDIGQD  708

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS  +MRSW FQGS DG NWTNLRVH++DQTIC+PGQFASWPI G  
Sbjct  709  HQLMCNYYTLRQDGSTTYMRSWAFQGSMDGENWTNLRVHENDQTICRPGQFASWPIIGST  768

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP T   N WN CIC +ELYGYFR
Sbjct  769  SLLPFRFFRVILTGPATGYSNVWNLCICFIELYGYFR  805



>emb|CDX97805.1| BnaC04g41340D [Brassica napus]
Length=796

 Score =   262 bits (670),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWWM+DLG 
Sbjct  639  SHQWVNPVLAKKIIITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWWMVDLGE  698

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFASWPIT  
Sbjct  699  DHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFASWPITAA  758

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  759  NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  796



>ref|XP_007018025.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15250.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=805

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            H WVNP+LSKR+A+TASSP SR+TDPKVLVSR +QGT FAGP++E G I +WWMID+G D
Sbjct  649  HPWVNPVLSKRIAITASSPTSRYTDPKVLVSRTYQGTCFAGPRMEGGRICAWWMIDIGQD  708

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQL+CNYYT+RQDGSRA++R W  QGS DG +W +LRVH++DQT+CKPGQFASWP+TG N
Sbjct  709  HQLICNYYTLRQDGSRAYIRCWKIQGSVDGRSWIDLRVHENDQTMCKPGQFASWPVTGTN  768

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP TD  +PWN CIC LELYGY+R
Sbjct  769  ALLPFRFFRVLLTGPTTDSSHPWNFCICFLELYGYYR  805



>ref|XP_007018027.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15252.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=789

 Score =   261 bits (668),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            H WVNP+LSKR+A+TASSP SR+TDPKVLVSR +QGT FAGP++E G I +WWMID+G D
Sbjct  633  HPWVNPVLSKRIAITASSPTSRYTDPKVLVSRTYQGTCFAGPRMEGGRICAWWMIDIGQD  692

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQL+CNYYT+RQDGSRA++R W  QGS DG +W +LRVH++DQT+CKPGQFASWP+TG N
Sbjct  693  HQLICNYYTLRQDGSRAYIRCWKIQGSVDGRSWIDLRVHENDQTMCKPGQFASWPVTGTN  752

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP TD  +PWN CIC LELYGY+R
Sbjct  753  ALLPFRFFRVLLTGPTTDSSHPWNFCICFLELYGYYR  789



>ref|XP_002307790.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE94786.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=806

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGTSFAGP +EDG+I +WWM+D+G D
Sbjct  650  HQWINPVLAKRITITASSPPSRYTDPKTLVSRTYQGTSFAGPCMEDGHIRAWWMVDIGQD  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK  QFASWPITGP+
Sbjct  710  HQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVHENDQTMCKADQFASWPITGPH  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+V+TGP TD  NP N CIC LELYGYF 
Sbjct  770  ALLPFRFFRVVLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|NP_180618.2| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_850151.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031447.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031448.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q8LEV3.1|Y2060_ARATH RecName: Full=BTB/POZ domain-containing protein At2g30600 [Arabidopsis 
thaliana]
 gb|AAM62449.1| unknown [Arabidopsis thaliana]
 dbj|BAD42918.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43840.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44307.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08413.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08414.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08415.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08416.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=809

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW++DLG 
Sbjct  652  SHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWWVVDLGE  711

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  712  EHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAA  771

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  772  NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  809



>dbj|BAD93995.1| hypothetical protein [Arabidopsis thaliana]
Length=812

 Score =   261 bits (667),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW++DLG 
Sbjct  655  SHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWWVVDLGE  714

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  715  EHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAA  774

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  775  NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  812



>ref|NP_001189642.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08417.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=855

 Score =   261 bits (667),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++ +T+SSP SRFTDPK L S+ + GTSFAGP++EDG+ISSWW++DLG 
Sbjct  698  SHQWVNPVLAKKINITSSSPTSRFTDPKALASKAYAGTSFAGPRMEDGHISSWWVVDLGE  757

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQT+CK GQFASWPIT  
Sbjct  758  EHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQTMCKAGQFASWPITAA  817

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  818  NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  855



>ref|XP_010556054.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556055.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556056.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
Length=804

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L+K++ +  SSP SRFTDPK L SR + GTSFAGP++EDG ISSWWM+DLG D
Sbjct  648  HQWVNPVLAKKITIIVSSPTSRFTDPKTLASRTYMGTSFAGPRMEDGQISSWWMVDLGKD  707

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSR + RSW  QGS DG +W ++RVH+DDQT+CK GQFASWPI G N
Sbjct  708  HQLMCNYYTLRQDGSRTYPRSWKLQGSMDGNSWADVRVHEDDQTMCKLGQFASWPIVGAN  767

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFR+FR+VMTGP  D  NPW+ CIC LELYGYFR
Sbjct  768  SLLPFRYFRVVMTGPTADASNPWSFCICFLELYGYFR  804



>gb|AES98295.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=799

 Score =   258 bits (658),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 136/158 (86%), Gaps = 2/158 (1%)
 Frame = +3

Query  6    HQWVNPILS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
            HQWVNP+L+  K++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G+  SWWMIDLG
Sbjct  641  HQWVNPLLAEAKKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGHNCSWWMIDLG  700

Query  180  YDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITG  359
             DHQLMCNYYT+RQDGS+AF R WN QGS DG +W +LRVH++D+T+CKPGQFASWP+ G
Sbjct  701  QDHQLMCNYYTMRQDGSKAFPRCWNIQGSADGKSWRDLRVHENDRTVCKPGQFASWPVVG  760

Query  360  PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
            PN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  761  PNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  798



>ref|XP_008781287.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Phoenix dactylifera]
Length=803

 Score =   258 bits (658),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L+K++ VTASSP SR+TDPK LVSR +QGTSFAGP++EDG   +WWM+D+G D
Sbjct  647  HQWVNPVLAKKITVTASSPASRYTDPKALVSRAYQGTSFAGPRIEDGKNCAWWMVDIGQD  706

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS  +MRSW  QGS DG NWTNLRVH++DQTIC+PGQFASW +TG  
Sbjct  707  HQLMCNYYTLRQDGSTTYMRSWACQGSMDGENWTNLRVHENDQTICRPGQFASWTVTGST  766

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP + + + WN CIC +ELYGYFR
Sbjct  767  ALLPFRFFRVILTGPASGDSDAWNLCICFIELYGYFR  803



>ref|XP_008781284.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781285.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781286.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
Length=805

 Score =   258 bits (658),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L+K++ VTASSP SR+TDPK LVSR +QGTSFAGP++EDG   +WWM+D+G D
Sbjct  649  HQWVNPVLAKKITVTASSPASRYTDPKALVSRAYQGTSFAGPRIEDGKNCAWWMVDIGQD  708

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS  +MRSW  QGS DG NWTNLRVH++DQTIC+PGQFASW +TG  
Sbjct  709  HQLMCNYYTLRQDGSTTYMRSWACQGSMDGENWTNLRVHENDQTICRPGQFASWTVTGST  768

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP + + + WN CIC +ELYGYFR
Sbjct  769  ALLPFRFFRVILTGPASGDSDAWNLCICFIELYGYFR  805



>ref|XP_010692549.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692550.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
Length=805

 Score =   257 bits (657),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            H+WVNP+LS R+ +T SSP SRFTDPKVL SR +QGTSF+GP+ EDG   SWWMID+G D
Sbjct  649  HRWVNPMLSNRITITTSSPISRFTDPKVLASRTYQGTSFSGPRFEDGRTCSWWMIDVGED  708

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSR F+R WN QGS DG +WTNLR HK+DQ ICKPGQFASWP+TGP 
Sbjct  709  HQLMCNYYTLRQDGSRTFIRHWNLQGSLDGKHWTNLREHKNDQKICKPGQFASWPVTGPQ  768

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LL FRFFR+++TGP TD    W  CIC LELYGYFR
Sbjct  769  ALLSFRFFRVILTGPTTDPTETWKFCICFLELYGYFR  805



>ref|XP_010094552.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=810

 Score =   257 bits (656),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L+K + +TASSP SRFTDPKVL SR +QGTSFAGP++EDG+ S+WWM+D+G +
Sbjct  654  HQWVNPVLAKTITITASSPPSRFTDPKVLASRTYQGTSFAGPRIEDGHSSTWWMVDIGSN  713

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGSRA++RSW+ QGS DG  WTNL VH++DQT+CK GQFASWPI GPN
Sbjct  714  HQLMCNYYTLRQDGSRAYIRSWSLQGSLDGKTWTNLSVHENDQTVCKLGQFASWPIVGPN  773

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             L PFRFFR ++TGP TD  NP N CIC LELYGYF 
Sbjct  774  ALRPFRFFRALLTGPTTDISNPCNLCICFLELYGYFH  810



>ref|XP_011041233.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011041234.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NPIL+KR+ +TASSP SR+TDPK LVSR +QGTSFAGP +E+G+I +WW +D+G D
Sbjct  650  HQWINPILAKRITITASSPPSRYTDPKTLVSRTYQGTSFAGPCMENGHIRAWWTVDIGQD  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK  QFASWP+TGP+
Sbjct  710  HQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVHENDQTMCKADQFASWPVTGPH  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  770  ALLPFRFFRVLLTGPTTDASNPHNLCICFLELYGYFH  806



>ref|XP_003615337.1| Kelch-like protein [Medicago truncatula]
Length=884

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 136/158 (86%), Gaps = 2/158 (1%)
 Frame = +3

Query  6    HQWVNPILS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
            HQWVNP+L+  K++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G+  SWWMIDLG
Sbjct  726  HQWVNPLLAEAKKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGHNCSWWMIDLG  785

Query  180  YDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITG  359
             DHQLMCNYYT+RQDGS+AF R WN QGS DG +W +LRVH++D+T+CKPGQFASWP+ G
Sbjct  786  QDHQLMCNYYTMRQDGSKAFPRCWNIQGSADGKSWRDLRVHENDRTVCKPGQFASWPVVG  845

Query  360  PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
            PN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  846  PNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  883



>ref|XP_009418296.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418297.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418298.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418299.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418300.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418301.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
Length=803

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            H WVNP+LSK++ +TASSP SR+TD K LVSR +Q TSFAGP++EDG+ S+WWM+D+G+D
Sbjct  647  HAWVNPVLSKKITLTASSPASRYTDSKALVSRTYQATSFAGPRIEDGHSSAWWMVDIGHD  706

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS  ++RSW FQGS DG NWTNLRVH DDQTIC+ GQFASWP+ GP 
Sbjct  707  HQLMCNYYTLRQDGSSTYIRSWAFQGSVDGKNWTNLRVHNDDQTICRSGQFASWPVIGPM  766

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
             LLPFR FR+++TGP + + N WN CIC +ELYGYF
Sbjct  767  ALLPFRIFRVILTGPASGDANVWNLCICFIELYGYF  802



>gb|EEE63337.1| hypothetical protein OsJ_18148 [Oryza sativa Japonica Group]
Length=734

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+K + VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G D
Sbjct  578  HQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPD  637

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG  
Sbjct  638  HQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQT  697

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++T P T   N WN CIC LELYGYFR
Sbjct  698  ALLPFRFFRVMLTAPATGVSNTWNLCICFLELYGYFR  734



>ref|XP_011013905.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011013907.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   256 bits (653),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+KR+ +TASSP SR+TDPK LVSR +QGTSFAGP +E+G+I +WW +D+G D
Sbjct  650  HQWINPVLAKRITITASSPPSRYTDPKTLVSRTYQGTSFAGPCMENGHIRAWWTVDIGQD  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCN+YT+RQDGSRAF+R WN QGS DG  WTNLRVH++DQT+CK  QFASWP+TGP+
Sbjct  710  HQLMCNHYTLRQDGSRAFIRFWNLQGSLDGKTWTNLRVHENDQTMCKADQFASWPVTGPH  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TGP TD  NP N CIC LELYGYF 
Sbjct  770  ALLPFRFFRVLLTGPTTDASNPHNLCICFLELYGYFH  806



>gb|AAV43802.1| unknown protein [Oryza sativa Japonica Group]
Length=806

 Score =   255 bits (651),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+K + VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G D
Sbjct  650  HQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPD  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG  
Sbjct  710  HQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQT  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++T P T   N WN CIC LELYGYFR
Sbjct  770  ALLPFRFFRVMLTAPATGVSNTWNLCICFLELYGYFR  806



>ref|XP_003561246.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Brachypodium 
distachyon]
Length=812

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+K + V ASSP SR+T+PK LVS+N+QGT FAGP+ E+G   SWWM+D+G D
Sbjct  656  HQWINPVLAKNITVMASSPNSRYTNPKALVSKNYQGTCFAGPRDENGKKCSWWMVDIGED  715

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS  FMRSW FQGS DG NWT+L VH+++QTIC+PGQFASWPITGP+
Sbjct  716  HQLMCNYYTVRQDGSTTFMRSWVFQGSMDGENWTSLGVHEEEQTICQPGQFASWPITGPS  775

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+ +TGP T   N WN CIC LELYGYFR
Sbjct  776  ALLPFRFFRLALTGPATGMSNTWNLCICFLELYGYFR  812



>ref|XP_003545003.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Glycine max]
 gb|KHN12601.1| BTB/POZ domain-containing protein [Glycine soja]
Length=802

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 134/158 (85%), Gaps = 2/158 (1%)
 Frame = +3

Query  6    HQWVNPILS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
            H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   SWWM+DLG
Sbjct  644  HPWVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCSWWMVDLG  703

Query  180  YDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITG  359
             DHQLMCNYYT+RQDGS+AF R WN QGS DG +WTNLRVH++D++ICKPGQFASWPI G
Sbjct  704  QDHQLMCNYYTLRQDGSKAFPRCWNVQGSLDGKSWTNLRVHENDRSICKPGQFASWPIIG  763

Query  360  PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
            PN LLPFR+FR+V+TG  TD  NPWN CIC LELYGYF
Sbjct  764  PNALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYF  801



>ref|XP_006596517.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Glycine max]
Length=806

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 134/158 (85%), Gaps = 2/158 (1%)
 Frame = +3

Query  6    HQWVNPILS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
            H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   SWWM+DLG
Sbjct  648  HPWVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCSWWMVDLG  707

Query  180  YDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITG  359
             DHQLMCNYYT+RQDGS+AF R WN QGS DG +WTNLRVH++D++ICKPGQFASWPI G
Sbjct  708  QDHQLMCNYYTLRQDGSKAFPRCWNVQGSLDGKSWTNLRVHENDRSICKPGQFASWPIIG  767

Query  360  PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
            PN LLPFR+FR+V+TG  TD  NPWN CIC LELYGYF
Sbjct  768  PNALLPFRYFRVVLTGTTTDATNPWNFCICYLELYGYF  805



>gb|EEC79014.1| hypothetical protein OsI_19541 [Oryza sativa Indica Group]
Length=806

 Score =   253 bits (646),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+K + VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G D
Sbjct  650  HQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPD  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG  
Sbjct  710  HQLMCNYYTVRQDGSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQT  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++T P T   + WN CIC LELYGYFR
Sbjct  770  ALLPFRFFRVMLTAPATGVSHTWNLCICFLELYGYFR  806



>emb|CDM85346.1| unnamed protein product [Triticum aestivum]
Length=805

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 2/157 (1%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+K + VTASSP SR+TDPK LVS+N+QGT FAGP+ EDG   SWWM+D+G D
Sbjct  651  HQWINPVLAKNITVTASSPNSRYTDPKALVSKNYQGTCFAGPRDEDGKKCSWWMVDIGQD  710

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS AFMRSW  QGS DG NWT+L V++D++ IC+PGQFASWPITGP+
Sbjct  711  HQLMCNYYTVRQDGSTAFMRSWVLQGSMDGENWTSLVVNEDERAICQPGQFASWPITGPS  770

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+ +TGP T   N WN CIC LELYGYFR
Sbjct  771  ALLPFRFFRLALTGPTTS--NTWNLCICFLELYGYFR  805



>ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Citrus sinensis]
 ref|XP_006473786.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Citrus sinensis]
 gb|KDO85089.1| hypothetical protein CISIN_1g040529mg [Citrus sinensis]
Length=806

 Score =   250 bits (639),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            H WVNP+L+KR+ +TASSP SR+TDPK L SR +QG SFAGP++EDG+  +WWM+D+G D
Sbjct  650  HPWVNPVLAKRINITASSPISRYTDPKALASRTYQGLSFAGPRMEDGHNCTWWMVDIGQD  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+R DGSRA++R WNFQGS DG +WTNLRVH++DQT+CK GQFASW + GPN
Sbjct  710  HQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVHENDQTMCKHGQFASWAVIGPN  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             L PFRFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  770  ALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYFH  806



>ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Citrus sinensis]
Length=817

 Score =   250 bits (639),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            H WVNP+L+KR+ +TASSP SR+TDPK L SR +QG SFAGP++EDG+  +WWM+D+G D
Sbjct  661  HPWVNPVLAKRINITASSPISRYTDPKALASRTYQGLSFAGPRMEDGHNCTWWMVDIGQD  720

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+R DGSRA++R WNFQGS DG +WTNLRVH++DQT+CK GQFASW + GPN
Sbjct  721  HQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVHENDQTMCKHGQFASWAVIGPN  780

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             L PFRFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  781  ALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYFH  817



>ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
 gb|ESR48595.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
Length=818

 Score =   250 bits (638),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            H WVNP+L+KR+ +TASSP SR+TDPK L SR +QG SFAGP++EDG+  +WWM+D+G D
Sbjct  662  HPWVNPVLAKRINITASSPISRYTDPKALASRTYQGLSFAGPRMEDGHNCTWWMVDIGQD  721

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+R DGSRA++R WNFQGS DG +WTNLRVH++DQT+CK GQFASW + GPN
Sbjct  722  HQLMCNYYTLRMDGSRAYIRYWNFQGSMDGKSWTNLRVHENDQTMCKHGQFASWAVIGPN  781

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             L PFRFFR+V+ GP  D  N WN CIC LELYGYF 
Sbjct  782  ALRPFRFFRVVLMGPTADAANSWNFCICFLELYGYFH  818



>ref|XP_009141084.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
 ref|XP_009141086.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
Length=801

 Score =   249 bits (637),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++++T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWWM+DLG 
Sbjct  644  SHQWVNPVLAKKISITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWWMVDLGE  703

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFASWPIT  
Sbjct  704  DHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFASWPITAA  763

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  764  NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  801



>ref|XP_009141083.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Brassica rapa]
Length=806

 Score =   249 bits (637),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +HQWVNP+L+K++++T+SSP SRFTDPK L S+ + GTSFAGP++EDG ISSWWM+DLG 
Sbjct  649  SHQWVNPVLAKKISITSSSPTSRFTDPKALASKTYVGTSFAGPRMEDGRISSWWMVDLGE  708

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DHQLMCNYYT RQDGSRA+ RSW FQGS DG  WT+LRVH++DQT+CK GQFASWPIT  
Sbjct  709  DHQLMCNYYTFRQDGSRAYARSWKFQGSMDGNTWTDLRVHENDQTMCKAGQFASWPITAA  768

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  769  NALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  806



>ref|XP_007160598.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 ref|XP_007160599.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32592.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32593.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
Length=802

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 134/158 (85%), Gaps = 2/158 (1%)
 Frame = +3

Query  6    HQWVNPILS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
            H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   +WWM+DLG
Sbjct  644  HPWVNPLLAEQRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCTWWMVDLG  703

Query  180  YDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITG  359
             DHQLMCNYYT+RQDGS+AF R WN QGS +G +WTNL VH++D+++CKPGQFASWPI G
Sbjct  704  QDHQLMCNYYTLRQDGSKAFPRFWNIQGSQEGKSWTNLWVHENDRSVCKPGQFASWPIVG  763

Query  360  PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
            PN LLPFR+FR+V+TGP TD  NPWN CIC LELYGYF
Sbjct  764  PNALLPFRYFRVVLTGPTTDATNPWNFCICYLELYGYF  801



>ref|XP_010266159.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266161.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266162.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266163.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
Length=806

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L++++ VTASSP SR+TDPKVLVSR +Q TSFAGP++EDG   +WWM+DLG D
Sbjct  650  HQWVNPVLAQKITVTASSPASRYTDPKVLVSRTYQATSFAGPRMEDGKNCAWWMVDLGQD  709

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCN YT+RQDGS  +MR W  QGS DG NWT+L+VH +DQTICKPGQFASWP+ GP 
Sbjct  710  HQLMCNCYTLRQDGSNVYMRCWALQGSLDGRNWTDLKVHGNDQTICKPGQFASWPVQGPA  769

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             +LPFRFFR+++TGP T   +PWN  IC LELYGYF 
Sbjct  770  AVLPFRFFRVILTGPTTSNSSPWNLSICFLELYGYFH  806



>ref|NP_001174372.1| Os05g0345500 [Oryza sativa Japonica Group]
 dbj|BAH93100.1| Os05g0345500 [Oryza sativa Japonica Group]
Length=152

 Score =   229 bits (583),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  45   VTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQLMCNYYTIRQD  224
            VTASSP SR+TDPK LVS+N+Q T FAGP++EDG + SWWM+D+G DHQLMCNYYT+RQD
Sbjct  9    VTASSPNSRYTDPKALVSKNYQATCFAGPRLEDGKMCSWWMVDIGPDHQLMCNYYTVRQD  68

Query  225  GSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPLLPFRFFRIVMT  404
            GS  FMRSW  QGS DG +WT+L VH+DDQTIC+PGQFASWPITG   LLPFRFFR+++T
Sbjct  69   GSATFMRSWVLQGSMDGRSWTSLHVHEDDQTICQPGQFASWPITGQTALLPFRFFRVMLT  128

Query  405  GPGTDEMNPWNCCICVLELYGYFR  476
             P T   N WN CIC LELYGYFR
Sbjct  129  APATGVSNTWNLCICFLELYGYFR  152



>ref|XP_004512607.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Cicer arietinum]
Length=815

 Score =   244 bits (623),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 129/158 (82%), Gaps = 2/158 (1%)
 Frame = +3

Query  6    HQWVNPILS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
            HQWVNP+L+  K++ +TASSP SR+TDPKVL SR ++GT FAGP++E+G+  SWWM+DLG
Sbjct  657  HQWVNPLLAEPKKITITASSPHSRYTDPKVLASRTYRGTCFAGPRLENGHNCSWWMVDLG  716

Query  180  YDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITG  359
             DHQLMCNYYT+RQDGS+AF R WN QGS DG +W  LR+H++D TICKPGQFASWPI  
Sbjct  717  QDHQLMCNYYTMRQDGSKAFPRCWNIQGSMDGKSWRELRIHENDGTICKPGQFASWPIVA  776

Query  360  PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
            PN LLPFR+FRI +TGP TD  NPWN  IC  ELYGYF
Sbjct  777  PNALLPFRYFRIALTGPTTDATNPWNFSICYFELYGYF  814



>ref|XP_004512608.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Cicer arietinum]
 ref|XP_004512609.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Cicer arietinum]
 ref|XP_004512610.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X4 [Cicer arietinum]
Length=795

 Score =   244 bits (623),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 129/158 (82%), Gaps = 2/158 (1%)
 Frame = +3

Query  6    HQWVNPILS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
            HQWVNP+L+  K++ +TASSP SR+TDPKVL SR ++GT FAGP++E+G+  SWWM+DLG
Sbjct  637  HQWVNPLLAEPKKITITASSPHSRYTDPKVLASRTYRGTCFAGPRLENGHNCSWWMVDLG  696

Query  180  YDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITG  359
             DHQLMCNYYT+RQDGS+AF R WN QGS DG +W  LR+H++D TICKPGQFASWPI  
Sbjct  697  QDHQLMCNYYTMRQDGSKAFPRCWNIQGSMDGKSWRELRIHENDGTICKPGQFASWPIVA  756

Query  360  PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
            PN LLPFR+FRI +TGP TD  NPWN  IC  ELYGYF
Sbjct  757  PNALLPFRYFRIALTGPTTDATNPWNFSICYFELYGYF  794



>ref|XP_004964253.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g30600-like [Setaria italica]
Length=862

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 125/159 (79%), Gaps = 2/159 (1%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+K + V ASSP SR TDPK LVS+N+QGT FAGP +EDG   SWWM+D+G D
Sbjct  704  HQWMNPVLAKNITVVASSPNSRHTDPKALVSKNYQGTCFAGPCIEDGKKISWWMVDIGQD  763

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS  FMRSW  QGS DG NWT+LRVH++D TIC PGQFASWP+ GP 
Sbjct  764  HQLMCNYYTVRQDGSTTFMRSWVLQGSMDGRNWTSLRVHEEDATICHPGQFASWPVVGPP  823

Query  366  PLLPFRFFRIVMTGP--GTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+ +TGP  G    N WN CIC LELYGY R
Sbjct  824  ALLPFRFFRVALTGPAAGGSVSNAWNLCICFLELYGYLR  862



>ref|XP_008377082.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Malus domestica]
Length=797

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 127/157 (81%), Gaps = 8/157 (5%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+L+KR+ +TASSP SRFTDPK LVSR ++        +EDG+ S+WW +D+G D
Sbjct  649  HQWVNPVLAKRITITASSPPSRFTDPKALVSRTYR--------IEDGHKSTWWTVDIGAD  700

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQL+CN YT+RQDGSRA+MR WNFQGS DG  WTNLRVH++DQTICKPGQFASWP+ G N
Sbjct  701  HQLICNNYTLRQDGSRAYMRYWNFQGSLDGKTWTNLRVHENDQTICKPGQFASWPVIGQN  760

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+V+TGP  D  NPWN CIC LELYGYF 
Sbjct  761  ALLPFRFFRVVLTGPTADASNPWNFCICFLELYGYFH  797



>ref|XP_009759339.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nicotiana 
sylvestris]
Length=810

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 125/157 (80%), Gaps = 14/157 (9%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSKRV +TASSP SR TDPKVLVSRNFQGTS AGPQ+EDG  +SWWM+D+G D
Sbjct  668  HQWVNPVLSKRVTITASSPISRCTDPKVLVSRNFQGTSLAGPQMEDGRNASWWMVDVGQD  727

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQLMCNYYT+RQDGS AFMR WNFQGS DG +WTNLR+       C P        TGPN
Sbjct  728  HQLMCNYYTLRQDGSGAFMRRWNFQGSLDGKSWTNLRI------XCSP--------TGPN  773

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR++MT P TD+ NPWNCCIC LELYGYFR
Sbjct  774  ALLPFRFFRLLMTAPTTDDTNPWNCCICFLELYGYFR  810



>ref|XP_002437659.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
 gb|EER89026.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
Length=807

 Score =   241 bits (614),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQW+NP+L+K + V ASSP SR TDPK LVS+N+QGT FAGP +E+G   SWWM+D+G D
Sbjct  653  HQWMNPVLTKNITVVASSPNSRHTDPKALVSKNYQGTCFAGPCIENGKKLSWWMVDIGQD  712

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            +QLMCNYYT+RQDGS  FMRSW  QGS DG NWT+LRVH DD TIC PGQFASWPI GP 
Sbjct  713  YQLMCNYYTVRQDGSTTFMRSWALQGSMDGRNWTSLRVHDDDPTICHPGQFASWPIVGPA  772

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+ +TGP       WN CIC LELYGYFR
Sbjct  773  ALLPFRFFRVALTGPAAG--CAWNLCICFLELYGYFR  807



>ref|XP_006828729.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
 gb|ERM96145.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
Length=827

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            H WVNP L+KRV VTASSP SR+TDPK LVSR +Q TSFAGP++  G   +WW ID+G D
Sbjct  671  HDWVNPFLAKRVIVTASSPASRYTDPKSLVSRTYQATSFAGPRIVGGKNCAWWKIDIGQD  730

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            H+LMCNYYTIRQDGS  F R W+ QGS D  NWT+LRVH++D+TICKP QFASWPI  PN
Sbjct  731  HELMCNYYTIRQDGSTGFTRHWSLQGSRDAENWTDLRVHENDRTICKPAQFASWPIHPPN  790

Query  366  PLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             LLPFRFFR+++TG  T + NPWN C+C LELYGYFR
Sbjct  791  ALLPFRFFRVLLTGLTTSDSNPWNLCMCFLELYGYFR  827



>gb|EPS65824.1| hypothetical protein M569_08953, partial [Genlisea aurea]
Length=780

 Score =   225 bits (574),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            HQWVNP+LSK+V +T SSP SRFTDPKVLVSR++QGTSFAGP++E+G  ++WWM+D+G D
Sbjct  647  HQWVNPVLSKKVFITGSSPVSRFTDPKVLVSRSYQGTSFAGPRMENGKNTAWWMVDIGDD  706

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            HQL+CNYYTIRQDGSRAF+R W+ QGSTDG NW +LRVH++D T+CK GQ+ASWP+ G N
Sbjct  707  HQLICNYYTIRQDGSRAFLRHWSLQGSTDGANWASLRVHENDATMCKSGQYASWPVVGSN  766

Query  366  PLLPFRFFRIVMTG  407
             LLPFRFFRI +TG
Sbjct  767  ALLPFRFFRIALTG  780



>ref|XP_002962812.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
 gb|EFJ36275.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
Length=792

 Score =   224 bits (570),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 91/157 (58%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            AH+W+NP+++K++ ++ASSP SR+TDPKVL SRN+Q TSFAGP +E G   SWW +DLG 
Sbjct  635  AHEWMNPMVTKQITLSASSPHSRYTDPKVLASRNYQATSFAGPCIERGETVSWWRVDLGP  694

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DH+LMCNYY++RQDGS  F R+W FQGS DG  WT+LR H+ D +I +P Q+ASWP+ G 
Sbjct  695  DHKLMCNYYSVRQDGSTNFARNWTFQGSGDGETWTDLRKHEKDHSIYRPAQYASWPVHGS  754

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
              L+PFRFFR+++  P      PWN  IC LELYGY 
Sbjct  755  KSLIPFRFFRVLLQQPIAAVAAPWNLSICYLELYGYL  791



>ref|XP_002965955.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
 gb|EFJ33375.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
Length=772

 Score =   222 bits (566),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 91/157 (58%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            AH+W+NP+++K++ ++ASSP SR+TDPKVL SRN+Q TSFAGP +E G   SWW +DLG 
Sbjct  615  AHEWMNPMVTKQITLSASSPPSRYTDPKVLASRNYQATSFAGPCIERGETVSWWRVDLGP  674

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            DH+LMCNYY++RQDGS  F R+W FQGS DG  WT+LR H+ D +I +P Q+ASWP+ G 
Sbjct  675  DHKLMCNYYSVRQDGSTNFARNWTFQGSGDGETWTDLRKHEKDHSIYRPAQYASWPVHGS  734

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
              L+PFRFFR+++  P      PWN  IC LELYGY 
Sbjct  735  KSLIPFRFFRVLLQQPIAAVAAPWNLSICYLELYGYL  771



>ref|XP_001751401.1| predicted protein [Physcomitrella patens]
 gb|EDQ83718.1| predicted protein, partial [Physcomitrella patens]
Length=784

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +H W+NP L+K++ V+ASSP SRFTD K LVSRN+QGTSFAGP    G +S+WW +DLG 
Sbjct  627  SHPWMNPALTKKLVVSASSPPSRFTDAKALVSRNYQGTSFAGPCNVGGQMSAWWKVDLGA  686

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            D QL+CNYYT+RQD S +FMR+W+ QGS DG  WT LR H +DQTI   GQ+ASWP+ G 
Sbjct  687  DQQLLCNYYTVRQDSSSSFMRNWSLQGSVDGQRWTQLRTHHNDQTIGHGGQYASWPVFGA  746

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            N LLPFRFFR+++ GP T    PWN  +C LELYGY R
Sbjct  747  NALLPFRFFRVILLGPTTSVSTPWNLSLCYLELYGYLR  784



>gb|AAB63076.1| unknown protein [Arabidopsis thaliana]
Length=114

 Score =   192 bits (488),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = +3

Query  135  VEDGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQ  314
            +EDG+ISSWW++DLG +HQLMCNYYT RQDGSRAF R W FQGS DG  WT+LRVH+DDQ
Sbjct  1    MEDGHISSWWVVDLGEEHQLMCNYYTFRQDGSRAFTRFWKFQGSMDGKTWTDLRVHEDDQ  60

Query  315  TICKPGQFASWPITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
            T+CK GQFASWPIT  N LLPFRFFR+V+TGP  D   PWN CIC LELYGYFR
Sbjct  61   TMCKAGQFASWPITAANALLPFRFFRLVLTGPTADTSTPWNFCICYLELYGYFR  114



>gb|KIY99757.1| hypothetical protein MNEG_8204 [Monoraphidium neglectum]
Length=725

 Score =   190 bits (482),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 85/157 (54%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            + QWVNP+L+KR+ V ASSP SRFTDPK LVS  F  TSFA P+ E G  SSWW++DLG 
Sbjct  528  SKQWVNPVLAKRIEVRASSPASRFTDPKALVSGAFLRTSFACPRYEGGQPSSWWLVDLGP  587

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
             H+L+CNYYT+R D S  F R W  Q S D  +W +LR H  D  I  PGQ+ASWP++GP
Sbjct  588  SHRLLCNYYTMRHDSSSDFPRHWVLQASNDLQHWVDLRRHIADAAIRLPGQYASWPVSGP  647

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
               +PFR FR+++ GP      PWN C+  +E YGYF
Sbjct  648  ASHMPFRAFRLLLAGPTLSAATPWNFCLSHVEFYGYF  684



>ref|XP_005845262.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
 gb|EFN53160.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
Length=669

 Score =   184 bits (467),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 78/157 (50%), Positives = 110/157 (70%), Gaps = 0/157 (0%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
            +  WVNP+L+ R+ V ASSP  R TDPK L   NF   +FAGP++E+G +SSWW++DLG 
Sbjct  497  SQPWVNPVLAGRLQVRASSPACRSTDPKALAGNNFARCNFAGPRMENGQLSSWWVLDLGP  556

Query  183  DHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
            +H+L+CN+YT+R DGS  F+RSW  QGS DG +W +LR H  D+T+  PGQ+ASWP++  
Sbjct  557  EHRLICNHYTLRHDGSTDFLRSWVLQGSNDGASWADLRRHISDRTVRMPGQYASWPVSSH  616

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
               +P+R FR+++ GP  +  NP + C+   ELYGY 
Sbjct  617  AAAVPYRMFRLLLVGPNPEAANPHHVCLSFWELYGYL  653



>ref|XP_005650913.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26369.1| hypothetical protein COCSUDRAFT_46062 [Coccomyxa subellipsoidea 
C-169]
Length=448

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 101/158 (64%), Gaps = 5/158 (3%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
             ++VNP LS R+ VTASSP  RFTDPK +VS +F   + AG Q  DG   +WW +DLG  
Sbjct  285  QKFVNPALSGRLQVTASSPSCRFTDPKAVVSGHFLRNNAAG-QRRDGG--TWWRVDLGEQ  341

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPN  365
            H+LMCNYYT+R D S  + RSW  Q STDG  W +LR H DD TI   GQ+ASWP+TG  
Sbjct  342  HRLMCNYYTMRHDASPDYARSWALQASTDGTVWVDLRQHADDCTINMAGQYASWPVTGHA  401

Query  366  PLLPFRFFRIVMT--GPGTDEMNPWNCCICVLELYGYF  473
               PFRFF++++T   P + + N     +  LE YGYF
Sbjct  402  ARRPFRFFQLLLTPAAPASGKANGRVFSLSYLEFYGYF  439



>ref|XP_011399599.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
 gb|KFM26661.1| BTB/POZ domain-containing protein [Auxenochlorella protothecoides]
Length=465

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 92/158 (58%), Gaps = 2/158 (1%)
 Frame = +3

Query  6    HQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
             QWVNP+LS RV V ASSP  R T+P   V+      +FA P+ E G + SWW +DLG  
Sbjct  285  QQWVNPMLSGRVKVQASSPACRSTNPASCVALGPPRLNFAAPRSEAGRLVSWWSLDLGPR  344

Query  186  HQLMCNYYTIRQDGSRAFMRSWNFQGSTDG--VNWTNLRVHKDDQTICKPGQFASWPITG  359
            HQL C+ YT+R D S   +RSW  Q S DG    W +LR H++D T+  PGQ+ SW +TG
Sbjct  345  HQLACSAYTLRHDKSHDPLRSWTLQASRDGPQCGWEDLRRHENDLTLRLPGQYGSWAVTG  404

Query  360  PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
                +P+R FRI +        NPW+  +  +ELYG  
Sbjct  405  HAATVPYRCFRICVMQMQKGNENPWHASLAQIELYGNL  442



>ref|XP_001697437.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP00099.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=113

 Score =   118 bits (296),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = +3

Query  141  DGNISSWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTI  320
            +G  SSWW +DLG  HQL   YYT+R DGS+ F RSW  QGS D  NW +L+ H +D T+
Sbjct  1    NGVASSWWQVDLGEQHQLAITYYTLRHDGSQDFARSWVLQGSHDLSNWVDLKRHANDTTV  60

Query  321  CKPGQFASWPITGPNPLLPFRFFRIVMTGPGT--DEMNPWNCCICVLELYGYF  473
              PGQ+ASWP+ GP    P+R FR+++T P    +  + +N C+  +E YG+ 
Sbjct  61   KVPGQYASWPVIGPAAATPYRAFRLLLTAPNASPNPASRYNFCLSNVEFYGFM  113



>ref|XP_002950189.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
 gb|EFJ48857.1| hypothetical protein VOLCADRAFT_48365 [Volvox carteri f. nagariensis]
Length=108

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 2/108 (2%)
 Frame = +3

Query  156  SWWMIDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQ  335
            SWW +DLG  HQL   YYT+R DGS+ F+RSW  QGS D   W +L+ H +D TI  PGQ
Sbjct  1    SWWQVDLGEQHQLAITYYTLRHDGSQDFVRSWVLQGSHDLAVWVDLKRHSNDTTIKVPGQ  60

Query  336  FASWPITGPNPLLPFRFFRIVMTGPGT--DEMNPWNCCICVLELYGYF  473
            +ASWP+ GP   +P+R FR+++T P    +  +  N C+  LELYG+ 
Sbjct  61   YASWPVIGPAAAVPYRAFRLLLTAPNASPNPASRHNFCLSNLELYGFL  108



>ref|XP_004339299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR17286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=775

 Score =   109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 85/154 (55%), Gaps = 8/154 (5%)
 Frame = +3

Query  12   WVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQ  191
            WVNP  +  V V  S+P SR+++P+ +V R F  T +       G    W ++ L  +  
Sbjct  629  WVNPCRAGLVKVVCSAPPSRYSNPEAVVDRAFHTTWYTS-----GRPHPWLIVQLLKEKA  683

Query  192  LMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  371
             +   Y IRQDGS  F+RSW+ QGS DG +W +L  H +D  +  P ++  WP++    +
Sbjct  684  FVMKGYAIRQDGSTVFLRSWSMQGSNDGQSWVDLSTHVNDCGLASPSRWVFWPVSS---V  740

Query  372  LPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
            +P+  FR++MTGP    ++P    +  +E YG+F
Sbjct  741  VPYAQFRLIMTGPSASPVSPNTLALSNIEFYGFF  774



>ref|XP_006596518.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Glycine max]
Length=714

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 2/64 (3%)
 Frame = +3

Query  6    HQWVNPILS--KRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
            H WVNP+L+  +++ +TASSP SR+TDPKVLVSR +QGT FAGP++E+G   SWWM+DLG
Sbjct  648  HPWVNPLLAEPRKITITASSPHSRYTDPKVLVSRTYQGTCFAGPRLENGQNCSWWMVDLG  707

Query  180  YDHQ  191
             DHQ
Sbjct  708  QDHQ  711



>gb|KDD72973.1| hypothetical protein H632_c2675p1, partial [Helicosporidium sp. 
ATCC 50920]
Length=110

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +3

Query  168  IDLGYDHQLMCNYYTIRQDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASW  347
            +DLG   +L   +Y +R D SR F+R W  Q S DG  W ++R H  D ++    Q+A+W
Sbjct  1    VDLGPRRRLALTHYALRHDASRDFLRDWVVQASADGEAWVDVRRHASDPSLKVAHQWAAW  60

Query  348  PITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
            P+ G     P+R  R+++  P     NPW+  +   E YG+ 
Sbjct  61   PLVGHAAARPWRALRVLLDRPNAGADNPWHLALSAWEFYGHL  102



>ref|XP_005708947.1| ubiquitin-protein ligase [Galdieria sulphuraria]
 gb|EME32427.1| ubiquitin-protein ligase [Galdieria sulphuraria]
Length=970

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 46/133 (35%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = +3

Query  15   VNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  194
            VNP     V++T+SS  SRF   + L   +   + FA   + + +   W+ +DLG +  L
Sbjct  821  VNPHKYNIVSITSSSG-SRFAKLESLAESSVNRSCFA---LSNSSSLVWFALDLGAERVL  876

Query  195  MCNYYTIRQDGSRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  371
             C++YT+  DGS + F+R+W  +GS DG +WT L+ H++D+T+  P Q A+W +  P   
Sbjct  877  ACSFYTLAHDGSESNFLRNWCLEGSKDGKSWTVLKEHQNDETLQSPLQRATWRLEEPTSQ  936

Query  372  LPFRFFRIVMTGP  410
            + +R+FR++   P
Sbjct  937  VFYRYFRVIARPP  949



>ref|XP_004333299.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR11286.1| BTB/POZ domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=764

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 52/142 (37%), Positives = 76/142 (54%), Gaps = 14/142 (10%)
 Frame = +3

Query  12   WVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNI-SSWWMIDLGYDH  188
            W NP  + R+ VTASS      DP  LVS+          ++  G++ +SW+ IDLG   
Sbjct  618  WTNPHSAGRLRVTASS--IEKGDPVKLVSKK-------PSELWSGDVPASWFAIDLGPSR  668

Query  189  QLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
             L+ NYYT+R  G+     +R+W+ QGS+DG  W  L+ H +D ++  P    SWPI  P
Sbjct  669  TLVPNYYTLRHGGNYKADSLRTWDLQGSSDGKTWIVLKRHTNDTSLSGPFATHSWPI--P  726

Query  363  NPLLPFRFFRIVMTGPGTDEMN  428
            +    +R FRI+ TG  +   N
Sbjct  727  SVTEAYRHFRILQTGHNSSNHN  748



>ref|XP_011189870.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
cucurbitae]
Length=2889

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  12    WVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1172  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1224

Query  180   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  353
                 L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +PG  A+WPI
Sbjct  1225  V--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEPGSTATWPI  1282

Query  354   T-GPNPLLPFRFFRIVMTG  407
                P+ +  FR  R+   G
Sbjct  1283  VCAPDEMHGFRHIRVQQNG  1301



>ref|XP_011189869.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
cucurbitae]
Length=2893

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  12    WVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1172  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1224

Query  180   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  353
                 L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +PG  A+WPI
Sbjct  1225  V--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEPGSTATWPI  1282

Query  354   T-GPNPLLPFRFFRIVMTG  407
                P+ +  FR  R+   G
Sbjct  1283  VCAPDEMHGFRHIRVQQNG  1301



>ref|XP_011189868.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
cucurbitae]
Length=2901

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  12    WVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1184  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1236

Query  180   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  353
                 L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +PG  A+WPI
Sbjct  1237  V--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEPGSTATWPI  1294

Query  354   T-GPNPLLPFRFFRIVMTG  407
                P+ +  FR  R+   G
Sbjct  1295  VCAPDEMHGFRHIRVQQNG  1313



>ref|XP_011189866.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
 ref|XP_011189867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
cucurbitae]
Length=2905

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 50/139 (36%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  12    WVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1184  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1236

Query  180   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  353
                 L+ N YT+R  +   R+ +R+W  QGS DGV WT L  H DD+++ +PG  A+WPI
Sbjct  1237  V--YLIPNAYTLRHARGYGRSALRNWMLQGSKDGVTWTTLVTHTDDKSLVEPGSTATWPI  1294

Query  354   T-GPNPLLPFRFFRIVMTG  407
                P+ +  FR  R+   G
Sbjct  1295  VCAPDEMHGFRHIRVQQNG  1313



>ref|XP_005708288.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
 gb|EME31768.1| ubiquitin-protein ligase isoform 1 [Galdieria sulphuraria]
Length=944

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 51/155 (33%), Positives = 83/155 (54%), Gaps = 11/155 (7%)
 Frame = +3

Query  15   VNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  194
            +NP     V +++SS  +RF+  + LV      +SFA P   D +  +W+ +D G  ++L
Sbjct  793  INPHKHGVVKISSSSG-ARFSRLENLVESGANRSSFALP---DSSGLAWFSLDFGTKYEL  848

Query  195  MCNYYTIRQDGSRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  371
             C+ Y++  DGS + F+R+W  +GS DG  W+ L+ H +D+++  P Q + W I      
Sbjct  849  ACSAYSLVHDGSESNFLRNWCLEGSKDGTQWSILKEHINDKSLQHPLQRSVWKIDNVMSQ  908

Query  372  LPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
              FR+FRI+    G+  +N  N     LE YG  R
Sbjct  909  EFFRYFRILARSRGS-RLNLGN-----LEFYGRLR  937



>ref|XP_005708289.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
 gb|EME31769.1| ubiquitin-protein ligase isoform 2 [Galdieria sulphuraria]
Length=960

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 51/155 (33%), Positives = 83/155 (54%), Gaps = 11/155 (7%)
 Frame = +3

Query  15   VNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDHQL  194
            +NP     V +++SS  +RF+  + LV      +SFA P   D +  +W+ +D G  ++L
Sbjct  809  INPHKHGVVKISSSSG-ARFSRLENLVESGANRSSFALP---DSSGLAWFSLDFGTKYEL  864

Query  195  MCNYYTIRQDGSRA-FMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGPNPL  371
             C+ Y++  DGS + F+R+W  +GS DG  W+ L+ H +D+++  P Q + W I      
Sbjct  865  ACSAYSLVHDGSESNFLRNWCLEGSKDGTQWSILKEHINDKSLQHPLQRSVWKIDNVMSQ  924

Query  372  LPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
              FR+FRI+    G+  +N  N     LE YG  R
Sbjct  925  EFFRYFRILARSRGS-RLNLGN-----LEFYGRLR  953



>ref|XP_011414031.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Crassostrea gigas]
Length=2445

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 85/162 (52%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A +WVNP     + VT+S     P+ +  D   +VSR+    S A     + +  +W+ I
Sbjct  1097  AVEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD----SAALNCHTNDDKKAWFAI  1149

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW  L+ HKDD ++ +PG  A+
Sbjct  1150  DLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGSTAT  1207

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+T P +    +R  +I  TG        +   +  +E+YG
Sbjct  1208  WPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1248



>ref|XP_011414030.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Crassostrea gigas]
Length=2448

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 85/162 (52%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A +WVNP     + VT+S     P+ +  D   +VSR+    S A     + +  +W+ I
Sbjct  1100  AVEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD----SAALNCHTNDDKKAWFAI  1152

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW  L+ HKDD ++ +PG  A+
Sbjct  1153  DLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGSTAT  1210

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+T P +    +R  +I  TG        +   +  +E+YG
Sbjct  1211  WPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1251



>gb|EKC30956.1| E3 ubiquitin-protein ligase HECTD1 [Crassostrea gigas]
Length=2380

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 52/162 (32%), Positives = 85/162 (52%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A +WVNP     + VT+S     P+ +  D   +VSR+    S A     + +  +W+ I
Sbjct  1097  AVEWVNPAQYGLIVVTSSEGRNLPYGKLED---IVSRD----SAALNCHTNDDKKAWFAI  1149

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++  +YT+R  +   R+ +R+W FQ S DG+NW  L+ HKDD ++ +PG  A+
Sbjct  1150  DLGV--WIVPTHYTLRHARGYGRSALRNWQFQVSKDGINWVTLKTHKDDTSLNEPGSTAT  1207

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+T P +    +R  +I  TG        +   +  +E+YG
Sbjct  1208  WPLTPPEDEKQGWRHIKIQQTGRNASGQTHY-LSVSGMEIYG  1248



>ref|XP_004521542.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X1 
[Ceratitis capitata]
 ref|XP_004521543.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X2 
[Ceratitis capitata]
 ref|XP_004521544.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X3 
[Ceratitis capitata]
Length=2900

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 16/140 (11%)
 Frame = +3

Query  9     QWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  176
             +WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDL
Sbjct  1180  EWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDL  1232

Query  177   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  350
             G    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A+WP
Sbjct  1233  GV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEPGSTATWP  1290

Query  351   IT-GPNPLLPFRFFRIVMTG  407
             I   P+ +  FR  RI   G
Sbjct  1291  IVCSPDEMQGFRHIRIQQNG  1310



>ref|XP_004521546.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X5 
[Ceratitis capitata]
Length=2888

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 16/140 (11%)
 Frame = +3

Query  9     QWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  176
             +WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDL
Sbjct  1168  EWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDL  1220

Query  177   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  350
             G    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A+WP
Sbjct  1221  GV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEPGSTATWP  1278

Query  351   IT-GPNPLLPFRFFRIVMTG  407
             I   P+ +  FR  RI   G
Sbjct  1279  IVCSPDEMQGFRHIRIQQNG  1298



>ref|XP_004521545.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X4 
[Ceratitis capitata]
Length=2896

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 16/140 (11%)
 Frame = +3

Query  9     QWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  176
             +WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDL
Sbjct  1180  EWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDL  1232

Query  177   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  350
             G    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A+WP
Sbjct  1233  GV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEPGSTATWP  1290

Query  351   IT-GPNPLLPFRFFRIVMTG  407
             I   P+ +  FR  RI   G
Sbjct  1291  IVCSPDEMQGFRHIRIQQNG  1310



>ref|XP_004521547.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like isoform X6 
[Ceratitis capitata]
Length=2477

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 16/140 (11%)
 Frame = +3

Query  9     QWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  176
             +WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDL
Sbjct  1180  EWVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDL  1232

Query  177   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  350
             G    ++ N YT+R  +   R+ +R+W  QGS DG  WT L  H DD+++ +PG  A+WP
Sbjct  1233  GV--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGATWTTLVTHNDDKSLVEPGSTATWP  1290

Query  351   IT-GPNPLLPFRFFRIVMTG  407
             I   P+ +  FR  RI   G
Sbjct  1291  IVCSPDEMQGFRHIRIQQNG  1310



>ref|XP_011199881.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bactrocera 
dorsalis]
Length=2883

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  12    WVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1167  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1219

Query  180   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  353
                 ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +PG  A+WPI
Sbjct  1220  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEPGSTATWPI  1277

Query  354   T-GPNPLLPFRFFRIVMTG  407
                P+ +  FR  R+   G
Sbjct  1278  VCAPDEMHGFRHIRVQQNG  1296



>ref|XP_011199880.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bactrocera 
dorsalis]
Length=2887

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  12    WVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1167  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1219

Query  180   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  353
                 ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +PG  A+WPI
Sbjct  1220  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEPGSTATWPI  1277

Query  354   T-GPNPLLPFRFFRIVMTG  407
                P+ +  FR  R+   G
Sbjct  1278  VCAPDEMHGFRHIRVQQNG  1296



>ref|XP_011199876.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199877.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
 ref|XP_011199878.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bactrocera 
dorsalis]
Length=2899

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  12    WVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1179  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1231

Query  180   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  353
                 ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +PG  A+WPI
Sbjct  1232  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEPGSTATWPI  1289

Query  354   T-GPNPLLPFRFFRIVMTG  407
                P+ +  FR  R+   G
Sbjct  1290  VCAPDEMHGFRHIRVQQNG  1308



>ref|XP_011199879.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bactrocera 
dorsalis]
Length=2895

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 16/139 (12%)
 Frame = +3

Query  12    WVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
             WVNP     V VT+S     P+ +  D   ++SR+   +       +D N  +W+ IDLG
Sbjct  1179  WVNPAQYGLVQVTSSEGKTLPYGKLED---ILSRD---SVSVNCHTKD-NKKAWFAIDLG  1231

Query  180   YDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPI  353
                 ++ N YT+R  +   R+ +R+W  QGS DG+ WT L  H DD+++ +PG  A+WPI
Sbjct  1232  V--YIIPNAYTLRHARGYGRSALRNWMLQGSKDGITWTTLVTHTDDKSLVEPGSTATWPI  1289

Query  354   T-GPNPLLPFRFFRIVMTG  407
                P+ +  FR  R+   G
Sbjct  1290  VCAPDEMHGFRHIRVQQNG  1308



>ref|XP_005178040.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Musca 
domestica]
Length=2792

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = +3

Query  9     QWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  176
             +WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ IDL
Sbjct  1146  EWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCHTKDNKKAWFAIDL  1198

Query  177   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  350
             G    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++ +PG  A+WP
Sbjct  1199  GV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGSTATWP  1256

Query  351   IT-GPNPLLPFRFFRIVMTG  407
             I   P+    FR  RI   G
Sbjct  1257  IVCAPDENQGFRHIRIQQNG  1276



>ref|XP_011290265.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Musca 
domestica]
Length=2804

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = +3

Query  9     QWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  176
             +WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ IDL
Sbjct  1158  EWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCHTKDNKKAWFAIDL  1210

Query  177   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  350
             G    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++ +PG  A+WP
Sbjct  1211  GV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGSTATWP  1268

Query  351   IT-GPNPLLPFRFFRIVMTG  407
             I   P+    FR  RI   G
Sbjct  1269  IVCAPDENQGFRHIRIQQNG  1288



>ref|XP_011290264.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Musca 
domestica]
Length=2836

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = +3

Query  9     QWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  176
             +WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ IDL
Sbjct  1190  EWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCHTKDNKKAWFAIDL  1242

Query  177   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  350
             G    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++ +PG  A+WP
Sbjct  1243  GV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGSTATWP  1300

Query  351   IT-GPNPLLPFRFFRIVMTG  407
             I   P+    FR  RI   G
Sbjct  1301  IVCAPDENQGFRHIRIQQNG  1320



>ref|XP_005178039.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Musca 
domestica]
Length=2847

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = +3

Query  9     QWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  176
             +WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ IDL
Sbjct  1201  EWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCHTKDNKKAWFAIDL  1253

Query  177   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  350
             G    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++ +PG  A+WP
Sbjct  1254  GV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGSTATWP  1311

Query  351   IT-GPNPLLPFRFFRIVMTG  407
             I   P+    FR  RI   G
Sbjct  1312  IVCAPDENQGFRHIRIQQNG  1331



>ref|XP_011290263.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Musca 
domestica]
Length=2848

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 16/140 (11%)
 Frame = +3

Query  9     QWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDL  176
             +WVNP     V VT+S     P+ +  D   ++SR+    S +       N  +W+ IDL
Sbjct  1202  EWVNPAQYNLVQVTSSEGKTLPYGKLED---ILSRD----SISVNCHTKDNKKAWFAIDL  1254

Query  177   GYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  350
             G    ++ N YT+R  +   R+ +R+W  Q S DGVNWT L  H DD+++ +PG  A+WP
Sbjct  1255  GV--FIIPNAYTLRHARGYGRSALRNWMLQASKDGVNWTTLVTHADDKSLVEPGSTATWP  1312

Query  351   IT-GPNPLLPFRFFRIVMTG  407
             I   P+    FR  RI   G
Sbjct  1313  IVCAPDENQGFRHIRIQQNG  1332



>ref|XP_639138.1| BTB/POZ domain-containing protein [Dictyostelium discoideum AX4]
 gb|EAL65772.1| BTB/POZ domain-containing protein [Dictyostelium discoideum AX4]
Length=863

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 53/156 (34%), Positives = 77/156 (49%), Gaps = 16/156 (10%)
 Frame = +3

Query  9    QWVNPILSKRVAVTASS-PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYD  185
            +W NP  + ++ +T+SS       D   L    F               +SW MIDLG +
Sbjct  711  KWSNPHSTSKIKITSSSIDKGNLYDIVELTPNAFWTKDVP---------ASWVMIDLGPN  761

Query  186  HQLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITG  359
              ++  YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++       SWP+TG
Sbjct  762  RTVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVLKRHTNDPSLNYKYATHSWPVTG  821

Query  360  PNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
                  FR+FRI+ TG  ++  N     I  LE+YG
Sbjct  822  CET--AFRYFRILQTGKNSNNRN--FLVIGGLEIYG  853



>gb|AAB47544.1| MigA [Dictyostelium discoideum]
Length=813

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 14/155 (9%)
 Frame = +3

Query  9    QWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGYDH  188
            +W NP  + ++ +T+SS         V ++ N    +F    V     +SW MIDLG + 
Sbjct  661  KWSNPHSTSKIKITSSSIDKGNLYDIVELTPN----AFWTKDVP----ASWVMIDLGPNR  712

Query  189  QLMCNYYTIRQDGSRAF--MRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPITGP  362
             ++  YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++       SWP+TG 
Sbjct  713  TVVPMYYTIRHGLSYKSDSLRTWDFQGSTNGEQWTVLKRHTNDPSLNYKYATHSWPVTGC  772

Query  363  NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
                 FR+FRI+ TG  ++  N     I  LE+YG
Sbjct  773  ET--AFRYFRILQTGKNSNNRN--FLVIGGLEIYG  803



>ref|XP_005842130.1| hypothetical protein GUITHDRAFT_41514, partial [Guillardia theta 
CCMP2712]
 gb|EKX55150.1| hypothetical protein GUITHDRAFT_41514, partial [Guillardia theta 
CCMP2712]
Length=111

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 59/113 (52%), Gaps = 8/113 (7%)
 Frame = +3

Query  153  SSWWMIDLGYDHQLMCNYYTIRQDG--SRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICK  326
            S W  +DLG    L+   Y+I      S   MRSW F+GS +  +W  LR H +D  +  
Sbjct  1    SPWLAVDLGEGRGLIATAYSIMHGSGSSSNAMRSWRFEGSNNKNSWITLREHLNDPRMQT  60

Query  327  PGQFASWPITGPNP----LLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYF  473
            PGQ  ++ +   +     L  FR+FRI++TGP +   N +  C C LELYG +
Sbjct  61   PGQVETFFLHNLDKEVTRLQAFRYFRILLTGPNSS--NFFRLCACRLELYGRY  111



>ref|XP_003288046.1| hypothetical protein DICPUDRAFT_16127 [Dictyostelium purpureum]
 gb|EGC35433.1| hypothetical protein DICPUDRAFT_16127 [Dictyostelium purpureum]
Length=602

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 83/157 (53%), Gaps = 14/157 (9%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASSPFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLGY  182
              +W NP L+ ++ +T+SS         V ++ N    +F    V     +SW MID+G 
Sbjct  448  KEKWSNPHLTSKIKITSSSVDKGNLHDIVEITPN----AFWTKDVP----ASWVMIDVGP  499

Query  183  DHQLMCNYYTIRQDGS--RAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWPIT  356
            +  ++ +YYTIR   S     +R+W+FQGST+G  WT L+ H +D ++       SWPIT
Sbjct  500  NRSVVPHYYTIRHGLSFKSDSLRTWDFQGSTNGEQWTVLKRHTNDLSLNFKYATHSWPIT  559

Query  357  GPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
            G      +R+FRI+ TG  ++  N     I  +E+YG
Sbjct  560  GCET--AYRYFRILQTGKNSNNRN--FLVIGGIEIYG  592



>ref|XP_011406508.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Amphimedon 
queenslandica]
Length=2146

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 49/162 (30%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = +3

Query  12    WVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMIDLG  179
             WVNP     V V++S     P+    D   ++ R+    + A    +D + +SW+ +D G
Sbjct  1026  WVNPAAHHIVVVSSSDGRILPYGNLDD---ILCRD---DTPANCHTKD-DRNSWFAVDTG  1078

Query  180   YDHQLMCNYYTIRQD---GSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFASWP  350
                     +Y++R     G+R+ +RSW+FQ S DGV WT +  H +D ++ +PG  ASW 
Sbjct  1079  V--WFFPTHYSLRHSRGYGNRSALRSWDFQVSKDGVTWTTVYSHVNDNSLNEPGSTASWS  1136

Query  351   ITGPNPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYGYFR  476
             ++ P     +R  R+++TGP       +   +  LE+YG  R
Sbjct  1137  LSPPTDPEGWRHLRLILTGPNASGHTHY-LSLSGLEVYGEVR  1177



>ref|XP_002424807.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
 gb|EEB12069.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis]
Length=2686

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 52/142 (37%), Positives = 76/142 (54%), Gaps = 16/142 (11%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             + +WVNP     V VT+S     P+ R  D   ++SR+   +S       D +  +W+ I
Sbjct  1101  SSEWVNPAQYGLVMVTSSDGRNLPYGRLED---ILSRD---SSALNCHTND-DRKAWFAI  1153

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    L+ + YTIR  +   R+ +R+W FQ S DGVNWT L  H DD ++ +PG  AS
Sbjct  1154  DLGL--WLIPSCYTIRHARGYGRSALRNWLFQVSKDGVNWTTLYTHTDDTSLNEPGSTAS  1211

Query  345   WPITGP-NPLLPFRFFRIVMTG  407
             WP+  P +    +R  R+  TG
Sbjct  1212  WPLDPPLDETQGWRHVRLQQTG  1233



>ref|XP_004909451.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Heterocephalus 
glaber]
Length=2562

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864091.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Heterocephalus 
glaber]
Length=2563

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_007429074.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Python 
bivittatus]
Length=2523

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1198  WPLDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_004909450.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Heterocephalus 
glaber]
Length=2607

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864090.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Heterocephalus 
glaber]
Length=2608

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004909448.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004909449.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Heterocephalus 
glaber]
 gb|EHB18581.1| E3 ubiquitin-protein ligase HECTD1 [Heterocephalus glaber]
Length=2609

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_004864088.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004864089.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Heterocephalus 
glaber]
Length=2610

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/162 (33%), Positives = 84/162 (52%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +  LELYG
Sbjct  1198  WPLDPPKDEKQGWRHVRIKQMGKNASGQTHY-LSLSGLELYG  1238



>ref|XP_007063755.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Chelonia mydas]
Length=2577

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WPI  P
Sbjct  1198  WPIDPP  1203



>ref|XP_007429075.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Python 
bivittatus]
Length=2509

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1198  WPLDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>gb|EMP32200.1| E3 ubiquitin-protein ligase HECTD1 [Chelonia mydas]
Length=2610

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1127  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1179

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1180  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1237

Query  345   WPITGP  362
             WPI  P
Sbjct  1238  WPIDPP  1243



>ref|XP_010631867.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Fukomys 
damarensis]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007429073.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Python 
bivittatus]
Length=2570

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1198  WPLDSPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_005196337.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bos 
taurus]
Length=1507

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005196336.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bos 
taurus]
Length=1739

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010631866.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Fukomys 
damarensis]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008162333.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Chrysemys 
picta bellii]
Length=2523

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPVDPP  1203



>ref|XP_010333269.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Saimiri 
boliviensis boliviensis]
Length=2331

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDTP  1203



>ref|XP_010333268.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Saimiri 
boliviensis boliviensis]
Length=2563

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDTP  1203



>ref|XP_009909049.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Picoides pubescens]
Length=2570

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WPI  P
Sbjct  1198  WPIDPP  1203



>ref|XP_010961316.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Camelus 
bactrianus]
Length=2321

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005881051.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Myotis 
brandtii]
 ref|XP_006085914.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Myotis 
lucifugus]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755203.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Mustela 
putorius furo]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006056669.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bubalus 
bubalis]
Length=2502

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005695270.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Capra 
hircus]
Length=2502

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010961314.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Camelus 
bactrianus]
Length=2553

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755201.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Mustela 
putorius furo]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004801249.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Mustela putorius 
furo]
Length=2566

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005196334.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bos 
taurus]
 ref|XP_877459.4| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Bos 
taurus]
Length=1786

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006116433.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Pelodiscus 
sinensis]
Length=2523

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPVDPP  1203



>ref|XP_009004155.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Callithrix 
jacchus]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005377022.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Chinchilla 
lanigera]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005285367.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chrysemys 
picta bellii]
Length=2509

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPVDPP  1203



>ref|XP_004055105.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Gorilla gorilla 
gorilla]
Length=2520

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1029  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1081

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1082  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1139

Query  345   WPITGP  362
             WP+  P
Sbjct  1140  WPLDPP  1145



>ref|XP_006116431.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pelodiscus 
sinensis]
Length=2529

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1093  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1145

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1146  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1203

Query  345   WPITGP  362
             WP+  P
Sbjct  1204  WPVDPP  1209



>ref|XP_006085913.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Myotis 
lucifugus]
Length=2561

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005881050.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Myotis 
brandtii]
Length=2561

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011374706.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pteropus 
vampyrus]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010586873.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Loxodonta 
africana]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_009004153.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Callithrix 
jacchus]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006085912.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Myotis 
lucifugus]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005881054.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Myotis 
brandtii]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004467983.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform 3 [Dasypus 
novemcinctus]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005285366.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Chrysemys 
picta bellii]
Length=2570

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPVDPP  1203



>ref|XP_011222356.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Ailuropoda 
melanoleuca]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010845303.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Bison 
bison bison]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010372961.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Rhinopithecus 
roxellana]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007984591.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Chlorocebus 
sabaeus]
 ref|XP_009425898.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Pan 
troglodytes]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006056670.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Bubalus 
bubalis]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007098141.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Panthera 
tigris altaica]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005222132.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X10 [Bos 
taurus]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006056668.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bubalus 
bubalis]
Length=2561

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005695269.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Capra 
hircus]
Length=2561

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005377020.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chinchilla 
lanigera]
Length=2561

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011222354.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Ailuropoda 
melanoleuca]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010845301.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Bison 
bison bison]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010372959.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Rhinopithecus 
roxellana]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006056667.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bubalus 
bubalis]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007098140.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Panthera 
tigris altaica]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005267560.2| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Homo 
sapiens]
 ref|XP_007984589.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Chlorocebus 
sabaeus]
 ref|XP_009247279.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pongo 
abelii]
 ref|XP_009425896.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pan 
troglodytes]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005695268.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Capra 
hircus]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005377019.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Chinchilla 
lanigera]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005222130.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Bos 
taurus]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008565372.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Galeopterus 
variegatus]
Length=2610

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WIIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>gb|ELK17058.1| E3 ubiquitin-protein ligase HECTD1 [Pteropus alecto]
Length=2489

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1050  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1102

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1103  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1160

Query  345   WPITGP  362
             WP+  P
Sbjct  1161  WPLDPP  1166



>ref|XP_010631865.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Fukomys 
damarensis]
Length=2608

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010631864.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Fukomys 
damarensis]
 gb|KFO29273.1| E3 ubiquitin-protein ligase HECTD1 [Fukomys damarensis]
Length=2610

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WMVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005196335.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bos 
taurus]
Length=1784

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007113428.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Physeter 
catodon]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008972942.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pan 
paniscus]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007472588.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Monodelphis 
domestica]
Length=2331

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010333267.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Saimiri 
boliviensis boliviensis]
Length=2608

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDTP  1203



>ref|XP_003924275.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010333266.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Saimiri 
boliviensis boliviensis]
Length=2610

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDTP  1203



>ref|XP_007660828.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X6 [Ornithorhynchus 
anatinus]
Length=2522

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007660814.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Ornithorhynchus 
anatinus]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007472586.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Monodelphis 
domestica]
Length=2563

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008267702.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Oryctolagus 
cuniculus]
Length=2331

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008267700.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Oryctolagus 
cuniculus]
Length=2563

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755202.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Mustela 
putorius furo]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_850301.2| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
isoform 1 [Canis lupus familiaris]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>gb|ELW63202.1| E3 ubiquitin-protein ligase HECTD1 [Tupaia chinensis]
Length=2543

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010586874.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Loxodonta 
africana]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006766087.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Myotis davidii]
Length=2598

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755198.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Mustela 
putorius furo]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004376588.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Trichechus manatus 
latirostris]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006116430.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Pelodiscus 
sinensis]
Length=2570

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPVDPP  1203



>ref|XP_008565371.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Galeopterus 
variegatus]
Length=2172

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3    AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
            A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  696  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  748

Query  171  DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
            DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  749  DLGL--WIIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  806

Query  345  WPITGP  362
            WP+  P
Sbjct  807  WPLDPP  812



>ref|XP_011281667.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Felis catus]
Length=2509

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010214811.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Tinamus 
guttatus]
Length=2523

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1198  WPLDPPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_008101615.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X8 [Anolis 
carolinensis]
Length=2523

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1198  WPLDPPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1238



>ref|XP_008101614.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X7 [Anolis 
carolinensis]
Length=2529

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1093  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1145

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1146  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1203

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1204  WPLDPPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1244



>ref|XP_003792055.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Otolemur garnettii]
Length=2538

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008101612.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Anolis 
carolinensis]
Length=2544

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 53/162 (33%), Positives = 82/162 (51%), Gaps = 17/162 (10%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1108  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--SSALNCHTNDDKN--AWFAI  1160

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1161  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1218

Query  345   WPITGP-NPLLPFRFFRIVMTGPGTDEMNPWNCCICVLELYG  467
             WP+  P +    +R  RI   G        +   +   ELYG
Sbjct  1219  WPLDPPKDEKQGWRHIRIKQMGKNASGQTHY-LSLSGFELYG  1259



>ref|XP_011222355.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Ailuropoda 
melanoleuca]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010845302.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Bison 
bison bison]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010372960.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Rhinopithecus 
roxellana]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_009004154.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Callithrix 
jacchus]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005377021.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Chinchilla 
lanigera]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004467984.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform 4 [Dasypus 
novemcinctus]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006116428.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Pelodiscus 
sinensis]
 ref|XP_006116429.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Pelodiscus 
sinensis]
Length=2576

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1093  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1145

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1146  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1203

Query  345   WPITGP  362
             WP+  P
Sbjct  1204  WPVDPP  1209



>ref|XP_004637178.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Octodon degus]
Length=2586

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010961313.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Camelus 
bactrianus]
Length=2600

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755200.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X3 [Mustela 
putorius furo]
Length=2608

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004755199.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Mustela 
putorius furo]
Length=2609

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007516893.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Erinaceus europaeus]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004584798.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Ochotona princeps]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006116432.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X5 [Pelodiscus 
sinensis]
Length=2502

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 70/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR  + ++      +D N  +W+ I
Sbjct  1093  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSR--ESSALNCHTNDDKN--AWFAI  1145

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT L  H DD ++ +PG  A+
Sbjct  1146  DLGL--WVVPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTTLYTHVDDCSLNEPGSTAT  1203

Query  345   WPITGP  362
             WP+  P
Sbjct  1204  WPVDPP  1209



>ref|XP_008972943.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pan 
paniscus]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_007984590.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Chlorocebus 
sabaeus]
 ref|XP_009247280.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pongo 
abelii]
 ref|XP_009425897.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Pan 
troglodytes]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011374705.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Pteropus 
vampyrus]
Length=2608

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006152455.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Tupaia chinensis]
Length=2609

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011374703.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Pteropus 
vampyrus]
 ref|XP_011374704.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Pteropus 
vampyrus]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_008708622.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Ursus maritimus]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006906925.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Pteropus alecto]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_006085911.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Myotis 
lucifugus]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005377018.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Chinchilla 
lanigera]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004467981.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform 1 [Dasypus 
novemcinctus]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_004421198.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 [Ceratotherium 
simum simum]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_001924707.4| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Sus scrofa]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_003408766.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Loxodonta 
africana]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_002753836.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Callithrix 
jacchus]
 ref|XP_009004149.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Callithrix 
jacchus]
 ref|XP_009004150.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Callithrix 
jacchus]
 ref|XP_009004151.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X1 [Callithrix 
jacchus]
Length=2610

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>gb|AAP13073.1| E3 ligase for inhibin receptor [Homo sapiens]
Length=2612

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1089  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1141

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1142  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1199

Query  345   WPITGP  362
             WP+  P
Sbjct  1200  WPLDPP  1205



>ref|XP_008267701.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X4 [Oryctolagus 
cuniculus]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_005222131.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X9 [Bos 
taurus]
Length=2549

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010586872.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Loxodonta 
africana]
Length=2596

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1073  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1125

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1126  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1183

Query  345   WPITGP  362
             WP+  P
Sbjct  1184  WPLDPP  1189



>ref|XP_010984469.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase HECTD1 
[Camelus dromedarius]
Length=2597

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_011222353.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Ailuropoda 
melanoleuca]
Length=2608

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



>ref|XP_010845300.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1 isoform X2 [Bison 
bison bison]
Length=2608

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = +3

Query  3     AHQWVNPILSKRVAVTASS----PFSRFTDPKVLVSRNFQGTSFAGPQVEDGNISSWWMI  170
             A++WVNP     V VT+S     P+ R  D   ++SR+   ++      +D N  +W+ I
Sbjct  1087  AYEWVNPAAYGLVVVTSSEGRNLPYGRLED---ILSRD--NSALNCHSNDDKN--AWFAI  1139

Query  171   DLGYDHQLMCNYYTIR--QDGSRAFMRSWNFQGSTDGVNWTNLRVHKDDQTICKPGQFAS  344
             DLG    ++ + YT+R  +   R+ +R+W FQ S DG NWT+L  H DD ++ +PG  A+
Sbjct  1140  DLGL--WVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTAT  1197

Query  345   WPITGP  362
             WP+  P
Sbjct  1198  WPLDPP  1203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250