BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN040F16

Length=629
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P04715.1|RBS2_PETHY  RecName: Full=Ribulose bisphosphate carbo...    274   6e-90   Petunia x hybrida [garden petunia]
sp|P04714.1|RBS1_PETHY  RecName: Full=Ribulose bisphosphate carbo...    269   3e-88   Petunia x hybrida [garden petunia]
sp|P26573.1|RBS8_NICPL  RecName: Full=Ribulose bisphosphate carbo...    269   5e-88   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P26576.1|RBSB_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    268   8e-88   Solanum tuberosum [potatoes]
ref|XP_006363111.1|  PREDICTED: ribulose bisphosphate carboxylase...    268   9e-88   Solanum tuberosum [potatoes]
sp|P07180.1|RBS3A_SOLLC  RecName: Full=Ribulose bisphosphate carb...    268   2e-87   Solanum lycopersicum
ref|XP_004232356.1|  PREDICTED: ribulose bisphosphate carboxylase...    268   2e-87   
sp|P26574.1|RBS1_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    268   2e-87   Solanum tuberosum [potatoes]
sp|P26575.1|RBSA_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    267   4e-87   Solanum tuberosum [potatoes]
gb|AFW90575.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    266   4e-87   Solanum tuberosum [potatoes]
gb|AFK36660.1|  unknown                                                 266   5e-87   Lotus japonicus
gb|ABY21254.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    266   6e-87   Solanum tuberosum [potatoes]
gb|AHI85721.1|  stress-induced protein 16                               266   6e-87   Capsicum annuum
sp|P32764.1|RBS3_SOLTU  RecName: Full=Ribulose bisphosphate carbo...    266   7e-87   Solanum tuberosum [potatoes]
gb|ABY21253.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    266   7e-87   Solanum tuberosum [potatoes]
ref|XP_009800809.1|  PREDICTED: ribulose bisphosphate carboxylase...    266   9e-87   Nicotiana sylvestris
gb|AAA34192.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    266   9e-87   Solanum lycopersicum
ref|XP_009595081.1|  PREDICTED: ribulose bisphosphate carboxylase...    265   1e-86   Nicotiana tomentosiformis
ref|XP_004234568.1|  PREDICTED: ribulose bisphosphate carboxylase...    265   1e-86   
ref|XP_009795055.1|  PREDICTED: ribulose bisphosphate carboxylase...    265   1e-86   Nicotiana sylvestris
ref|XP_010044264.1|  PREDICTED: ribulose bisphosphate carboxylase...    265   2e-86   Eucalyptus grandis [rose gum]
ref|XP_010693099.1|  PREDICTED: ribulose bisphosphate carboxylase...    265   3e-86   Beta vulgaris subsp. vulgaris [field beet]
gb|AFB70994.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    265   3e-86   Nicotiana attenuata
ref|XP_006358055.1|  PREDICTED: ribulose-1,5-bisphosphate carboxy...    264   5e-86   Solanum tuberosum [potatoes]
ref|XP_009758143.1|  PREDICTED: ribulose bisphosphate carboxylase...    264   6e-86   Nicotiana sylvestris
ref|XP_010032637.1|  PREDICTED: ribulose bisphosphate carboxylase...    263   8e-86   Eucalyptus grandis [rose gum]
dbj|BAI53118.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    263   9e-86   Eucalyptus globulus [blue gum]
sp|Q41351.1|RBS_STELP  RecName: Full=Ribulose bisphosphate carbox...    263   1e-85   Stellaria longipes
gb|ABY21255.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    263   1e-85   Solanum tuberosum [potatoes]
ref|XP_008381263.1|  PREDICTED: ribulose bisphosphate carboxylase...    263   2e-85   
gb|AFK33868.1|  unknown                                                 262   2e-85   Lotus japonicus
ref|XP_009625434.1|  PREDICTED: ribulose bisphosphate carboxylase...    262   2e-85   Nicotiana tomentosiformis
ref|XP_009767108.1|  PREDICTED: ribulose bisphosphate carboxylase...    262   3e-85   Nicotiana sylvestris
ref|XP_004233493.1|  PREDICTED: ribulose bisphosphate carboxylase...    262   3e-85   
gb|AGT97045.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    262   3e-85   Capsicum annuum
gb|AFK48034.1|  unknown                                                 262   3e-85   Lotus japonicus
gb|AAR83879.1|  Cristal-Glass1 protein                                  262   3e-85   Capsicum annuum
ref|NP_001275244.1|  ribulose bisphosphate carboxylase small chai...    261   4e-85   Solanum tuberosum [potatoes]
ref|XP_002521232.1|  Ribulose bisphosphate carboxylase small chai...    261   6e-85   Ricinus communis
ref|XP_009357812.1|  PREDICTED: ribulose bisphosphate carboxylase...    261   6e-85   Pyrus x bretschneideri [bai li]
sp|O65349.1|RBS_CAPAN  RecName: Full=Ribulose bisphosphate carbox...    261   7e-85   Capsicum annuum
ref|XP_008368660.1|  PREDICTED: ribulose bisphosphate carboxylase...    261   7e-85   Malus domestica [apple tree]
gb|AFK42721.1|  unknown                                                 261   1e-84   Lotus japonicus
ref|XP_010693054.1|  PREDICTED: ribulose bisphosphate carboxylase...    260   1e-84   Beta vulgaris subsp. vulgaris [field beet]
gb|AAA34191.1|  ribulose-1,5-bisphosphate carboxylase, small subu...    260   1e-84   Solanum lycopersicum
ref|XP_009342656.1|  PREDICTED: ribulose bisphosphate carboxylase...    260   2e-84   Pyrus x bretschneideri [bai li]
ref|XP_010263805.1|  PREDICTED: ribulose bisphosphate carboxylase...    260   2e-84   Nelumbo nucifera [Indian lotus]
ref|XP_010693059.1|  PREDICTED: ribulose bisphosphate carboxylase...    259   2e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010693073.1|  PREDICTED: ribulose bisphosphate carboxylase...    259   2e-84   Beta vulgaris subsp. vulgaris [field beet]
sp|Q96542.1|RBS_BETPN  RecName: Full=Ribulose bisphosphate carbox...    259   4e-84   Betula pendula [white birch]
ref|XP_004303137.1|  PREDICTED: ribulose bisphosphate carboxylase...    259   6e-84   Fragaria vesca subsp. vesca
gb|AAW31667.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    258   6e-84   Ammopiptanthus mongolicus
gb|AAA33866.1|  ribulose 1,5-bisphosphate carboxylase small subunit     258   7e-84   Malus domestica x Pyrus communis
sp|Q02980.1|RBS_MALSP  RecName: Full=Ribulose bisphosphate carbox...    258   7e-84   Malus sp.
sp|P24007.1|RBS_PYRPY  RecName: Full=Ribulose bisphosphate carbox...    258   7e-84   Pyrus pyrifolia [sha li]
sp|Q08186.1|RBS6_MESCR  RecName: Full=Ribulose bisphosphate carbo...    258   2e-83   Mesembryanthemum crystallinum
sp|O22077.1|RBS_FAGCR  RecName: Full=Ribulose bisphosphate carbox...    257   2e-83   Fagus crenata
gb|AAA33036.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    257   2e-83   Mesembryanthemum crystallinum
ref|XP_010265138.1|  PREDICTED: ribulose bisphosphate carboxylase...    257   2e-83   Nelumbo nucifera [Indian lotus]
gb|KCW52065.1|  hypothetical protein EUGRSUZ_J01502                     257   3e-83   Eucalyptus grandis [rose gum]
sp|P16032.2|RBS1_MESCR  RecName: Full=Ribulose bisphosphate carbo...    257   3e-83   Mesembryanthemum crystallinum
gb|ABK96567.1|  unknown                                                 256   4e-83   Populus trichocarpa x Populus deltoides
ref|XP_009774104.1|  PREDICTED: ribulose bisphosphate carboxylase...    256   4e-83   Nicotiana sylvestris
ref|XP_010036887.1|  PREDICTED: ribulose bisphosphate carboxylase...    256   5e-83   
gb|AFK40375.1|  unknown                                                 256   5e-83   Medicago truncatula
sp|Q04450.1|RBS2_MESCR  RecName: Full=Ribulose bisphosphate carbo...    256   6e-83   Mesembryanthemum crystallinum
ref|XP_006383456.1|  Ribulose bisphosphate carboxylase small chai...    256   8e-83   Populus trichocarpa [western balsam poplar]
gb|ABS72189.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    256   9e-83   Corchorus olitorius [Nalta jute]
gb|AAU14862.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    256   1e-82   Fagus sylvatica
dbj|BAE46384.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    255   1e-82   Panax ginseng [Asiatic ginseng]
ref|XP_003618736.1|  Ribulose bisphosphate carboxylase small chain      255   1e-82   Medicago truncatula
dbj|BAI53119.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    255   1e-82   Eucalyptus globulus [blue gum]
sp|Q42516.1|RBS1_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    255   2e-82   Amaranthus hypochondriacus [prince's feather]
ref|XP_009602965.1|  PREDICTED: ribulose bisphosphate carboxylase...    254   2e-82   Nicotiana tomentosiformis
gb|AAA33035.1|  ribulose-1-5-bisphosphate carboxylase                   255   2e-82   Mesembryanthemum crystallinum
sp|Q9XGX5.1|RBS2_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    255   2e-82   Amaranthus hypochondriacus [prince's feather]
ref|XP_010669829.1|  PREDICTED: ribulose bisphosphate carboxylase...    255   2e-82   Beta vulgaris subsp. vulgaris [field beet]
gb|AIR75141.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    254   2e-82   Blitum nuttallianum
sp|Q08184.1|RBS4_MESCR  RecName: Full=Ribulose bisphosphate carbo...    254   5e-82   Mesembryanthemum crystallinum
ref|XP_004299075.1|  PREDICTED: ribulose bisphosphate carboxylase...    254   5e-82   Fragaria vesca subsp. vesca
ref|XP_011021244.1|  PREDICTED: ribulose bisphosphate carboxylase...    254   5e-82   Populus euphratica
ref|XP_002532149.1|  Ribulose bisphosphate carboxylase small chai...    253   7e-82   Ricinus communis
ref|XP_010263795.1|  PREDICTED: ribulose bisphosphate carboxylase...    253   8e-82   Nelumbo nucifera [Indian lotus]
gb|AEJ33935.1|  chloroplast putative ribulose-1,5-bisphosphate ca...    253   1e-81   Wolffia australiana
ref|XP_006482254.1|  PREDICTED: ribulose bisphosphate carboxylase...    253   1e-81   Citrus sinensis [apfelsine]
ref|XP_003618735.1|  Ribulose bisphosphate carboxylase small chain      253   1e-81   Medicago truncatula
emb|CAD11990.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    253   1e-81   Coffea arabica [arabica coffee]
ref|XP_006430779.1|  hypothetical protein CICLE_v10012893mg             252   2e-81   Citrus clementina [clementine]
gb|AAA33037.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase s...    252   2e-81   Mesembryanthemum crystallinum
sp|Q08183.1|RBS3_MESCR  RecName: Full=Ribulose bisphosphate carbo...    252   3e-81   Mesembryanthemum crystallinum
sp|O65194.1|RBS_MEDSA  RecName: Full=Ribulose bisphosphate carbox...    252   3e-81   Medicago sativa [alfalfa]
gb|AFO67218.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    251   4e-81   Aralia elata
ref|XP_008446602.1|  PREDICTED: ribulose bisphosphate carboxylase...    251   4e-81   Cucumis melo [Oriental melon]
ref|XP_002531624.1|  Ribulose bisphosphate carboxylase small chai...    251   4e-81   Ricinus communis
sp|Q9XGX4.1|RBS3_AMAHP  RecName: Full=Ribulose bisphosphate carbo...    251   5e-81   Amaranthus hypochondriacus [prince's feather]
gb|AIR75140.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    251   5e-81   Blitum nuttallianum
sp|P18960.1|RBS_SILPR  RecName: Full=Ribulose bisphosphate carbox...    251   5e-81   Silene latifolia subsp. alba [white campion]
sp|P08705.1|RBS_HELAN  RecName: Full=Ribulose bisphosphate carbox...    251   6e-81   Helianthus annuus
gb|AIR75142.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    250   7e-81   Chenopodium album [lamb's-quarters]
ref|XP_002305162.2|  Ribulose bisphosphate carboxylase small chai...    250   2e-80   
gb|ABK95229.1|  unknown                                                 250   2e-80   Populus trichocarpa [western balsam poplar]
ref|XP_008244506.1|  PREDICTED: ribulose bisphosphate carboxylase...    250   2e-80   Prunus mume [ume]
gb|ABK15574.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    249   2e-80   Camellia sinensis [black tea]
gb|AAO25119.1|  ribulose-1,5-bisphosphate carboxylase small subunit     249   3e-80   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AGV08375.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    249   3e-80   Arachis hypogaea [goober]
ref|XP_007215051.1|  hypothetical protein PRUPE_ppa012123mg             249   4e-80   Prunus persica
sp|Q43832.1|RBS2_SPIOL  RecName: Full=Ribulose bisphosphate carbo...    249   4e-80   Spinacia oleracea
gb|AAB81105.1|  ribulose 1,5-bisphosphate carboxylase small subunit     249   4e-80   Spinacia oleracea
sp|P19311.1|RBS5_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    248   6e-80   Lemna gibba
sp|P19312.1|RBS6_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    248   8e-80   Lemna gibba
gb|ABK96431.1|  unknown                                                 248   9e-80   Populus trichocarpa x Populus deltoides
ref|XP_004135094.1|  PREDICTED: ribulose bisphosphate carboxylase...    248   9e-80   Cucumis sativus [cucumbers]
emb|CCF55356.1|  ribulose-1,5-bisphosphate carboxylase small subunit    248   1e-79   Cucumis sativus [cucumbers]
sp|P17673.1|RBS_TRIRP  RecName: Full=Ribulose bisphosphate carbox...    248   1e-79   Trifolium repens [creeping white clover]
ref|XP_011035062.1|  PREDICTED: ribulose bisphosphate carboxylase...    248   1e-79   Populus euphratica
emb|CAA32701.1|  ribulose bisphosphate carboxylase                      247   2e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003600302.1|  Ribulose bisphosphate carboxylase small chai...    247   2e-79   
sp|Q40250.1|RBS_LACSA  RecName: Full=Ribulose bisphosphate carbox...    247   2e-79   Lactuca sativa [cultivated lettuce]
sp|Q08185.1|RBS5_MESCR  RecName: Full=Ribulose bisphosphate carbo...    247   2e-79   Mesembryanthemum crystallinum
ref|NP_198658.1|  ribulose bisphosphate carboxylase small chain 2B      247   2e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AIB04188.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    247   2e-79   Camellia oleifera [abura-tsubaki]
gb|KEH21538.1|  ribulose bisphosphate carboxylase small chain           247   2e-79   Medicago truncatula
ref|XP_003637843.1|  Ribulose bisphosphate carboxylase small chai...    247   2e-79   
ref|XP_003636970.1|  Ribulose bisphosphate carboxylase small chai...    247   3e-79   
gb|AIF75285.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    246   4e-79   Arabidopsis thaliana [mouse-ear cress]
emb|CAA10290.1|  ribulose 1,5-bisphosphate carboxylase small subunit    246   4e-79   Cicer arietinum [garbanzo]
gb|AAG24884.1|AF303941_1  ribulose-1,5-bisphosphate carboxylase s...    246   4e-79   Glycine max [soybeans]
ref|NP_198657.1|  ribulose bisphosphate carboxylase small chain 3B      246   5e-79   Arabidopsis thaliana [mouse-ear cress]
emb|CAA32702.1|  ribulose bisphosphate carboxylase                      246   5e-79   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198659.1|  ribulose bisphosphate carboxylase small chain 1B      246   5e-79   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235314.1|  uncharacterized protein LOC100500504               246   5e-79   Glycine max [soybeans]
ref|NP_001241137.1|  ribulose bisphosphate carboxylase small chai...    246   7e-79   Glycine max [soybeans]
gb|AIF75353.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    244   7e-79   Nicotiana sylvestris
ref|XP_006391132.1|  hypothetical protein EUTSA_v10019199mg             246   8e-79   Eutrema salsugineum [saltwater cress]
gb|ACJ85905.1|  unknown                                                 245   9e-79   Medicago truncatula
sp|Q42823.1|RBS_GLYTA  RecName: Full=Ribulose bisphosphate carbox...    245   9e-79   Glycine tabacina
gb|AIF75357.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    244   1e-78   Nicotiana tomentosiformis
gb|AIF75289.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    244   1e-78   Arabidopsis thaliana [mouse-ear cress]
gb|KEH21531.1|  ribulose bisphosphate carboxylase small chain           245   1e-78   Medicago truncatula
gb|AIF75288.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    244   1e-78   Arabidopsis suecica
gb|AAF19793.1|AF162210_1  ribulose-1,5-bisphosphate carboxylase/o...    245   1e-78   Lactuca sativa [cultivated lettuce]
emb|CBY05833.1|  Ribulose 1,5-bisphosphate carboxylase small subu...    245   1e-78   Coffea canephora [robusta coffee]
sp|P19308.1|RBS2_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    245   1e-78   Lemna gibba
gb|KEH21536.1|  ribulose bisphosphate carboxylase small chain           245   1e-78   Medicago truncatula
sp|P08474.1|RBS_CUCSA  RecName: Full=Ribulose bisphosphate carbox...    245   2e-78   Cucumis sativus [cucumbers]
gb|KEH21530.1|  ribulose bisphosphate carboxylase small chain           245   2e-78   Medicago truncatula
gb|AIF75346.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    244   2e-78   Nicotiana sylvestris
gb|AIF75359.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    244   2e-78   Nicotiana tomentosiformis
gb|AEX60842.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    244   2e-78   Gossypium hirsutum [American cotton]
gb|AFS41733.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    244   2e-78   Gossypium hirsutum [American cotton]
gb|AEX60839.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    244   2e-78   Gossypium hirsutum [American cotton]
gb|AIF75349.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    243   2e-78   Nicotiana sylvestris
gb|AFS41753.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    244   2e-78   Gossypium mustelinum
gb|AIF75367.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    243   3e-78   Nicotiana tomentosiformis
sp|P08135.1|RBS_RAPSA  RecName: Full=Ribulose bisphosphate carbox...    244   3e-78   Raphanus sativus
ref|XP_006285820.1|  hypothetical protein CARUB_v10007296mg             244   3e-78   Capsella rubella
ref|XP_002888576.1|  ribulose bisphosphate carboxylase small chai...    244   3e-78   Arabidopsis lyrata subsp. lyrata
ref|XP_010926041.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   3e-78   Elaeis guineensis
gb|KDP20120.1|  hypothetical protein JCGZ_05889                         244   3e-78   Jatropha curcas
gb|AEX60841.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    244   3e-78   Gossypium hirsutum [American cotton]
ref|XP_008339672.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   3e-78   
ref|XP_009140170.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   3e-78   Brassica rapa
gb|AIF75295.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    243   3e-78   Arabidopsis suecica
gb|KEH21539.1|  ribulose bisphosphate carboxylase small chain           244   4e-78   Medicago truncatula
gb|AIF75351.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    243   4e-78   Nicotiana sylvestris
ref|XP_008352922.1|  PREDICTED: ribulose bisphosphate carboxylase...    244   4e-78   
sp|P07689.1|RBS3_PEA  RecName: Full=Ribulose bisphosphate carboxy...    244   4e-78   Pisum sativum [garden pea]
gb|AFS41744.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    244   4e-78   Gossypium tomentosum
ref|XP_002868775.1|  ribulose bisphosphate carboxylase small chai...    244   5e-78   
gb|ACU13285.1|  unknown                                                 243   5e-78   Glycine max [soybeans]
gb|AIF75321.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    243   5e-78   Brassica rapa
sp|P00865.1|RBS1_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    243   5e-78   Glycine max [soybeans]
ref|XP_010103758.1|  hypothetical protein L484_014647                   243   6e-78   Morus notabilis
sp|P00869.1|RBS2_PEA  RecName: Full=Ribulose bisphosphate carboxy...    243   6e-78   Pisum sativum [garden pea]
sp|Q39746.1|RBS4_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    243   6e-78   Flaveria pringlei
gb|AFS41724.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    243   7e-78   Gossypium raimondii
ref|XP_006285696.1|  hypothetical protein CARUB_v10007166mg             243   7e-78   Capsella rubella
ref|XP_010440948.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   7e-78   Camelina sativa [gold-of-pleasure]
gb|AIF75364.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    242   8e-78   Nicotiana tomentosiformis
gb|ADB85091.1|  ribulose 1,5-bisphosphate carboxylase small subunit     243   8e-78   Jatropha curcas
ref|NP_176880.1|  ribulose bisphosphate carboxylase small chain 1A      243   8e-78   Arabidopsis thaliana [mouse-ear cress]
gb|AIF75355.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    242   9e-78   Nicotiana sylvestris
ref|XP_009356790.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   9e-78   Pyrus x bretschneideri [bai li]
ref|NP_001235266.1|  ribulose-1,5-bisphosphate carboxylase small ...    243   9e-78   
ref|XP_006284616.1|  hypothetical protein CARUB_v10005847mg             243   1e-77   Capsella rubella
gb|AFS41748.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    243   1e-77   Gossypium tomentosum
emb|CDP20139.1|  unnamed protein product                                242   1e-77   Coffea canephora [robusta coffee]
ref|XP_010435745.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010521010.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_010435743.1|  PREDICTED: ribulose bisphosphate carboxylase...    243   1e-77   Camelina sativa [gold-of-pleasure]
gb|AFS41732.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    243   1e-77   Gossypium hirsutum [American cotton]
gb|AIF75322.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    242   1e-77   Brassica napus [oilseed rape]
gb|AAA82069.1|  ribulose 1,5-bisphosphate carboxylase small subun...    242   1e-77   Glycine soja [wild soybean]
emb|CDY52468.1|  BnaA04g27920D                                          242   1e-77   Brassica napus [oilseed rape]
gb|AIF75296.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    241   1e-77   Arabidopsis arenosa
gb|AFS41754.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    242   2e-77   Gossypium mustelinum
gb|AIF75283.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    241   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450911.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   2e-77   Camelina sativa [gold-of-pleasure]
sp|Q39749.1|RBS7_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    242   2e-77   Flaveria pringlei
gb|AFS41729.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    242   2e-77   Gossypium hirsutum [American cotton]
gb|AIF75323.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    242   2e-77   Brassica napus [oilseed rape]
gb|AFS41727.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    242   2e-77   Gossypium hirsutum [American cotton]
ref|XP_010450912.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   2e-77   Camelina sativa [gold-of-pleasure]
gb|AAF06098.1|  ribulose 1,5-bisphosphate carboxylase small chain...    242   2e-77   Manihot esculenta [manioc]
ref|XP_010450913.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   2e-77   Camelina sativa [gold-of-pleasure]
sp|Q39745.1|RBS3_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    241   2e-77   Flaveria pringlei
ref|XP_009403968.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010440945.1|  PREDICTED: ribulose bisphosphate carboxylase...    242   3e-77   Camelina sativa [gold-of-pleasure]
sp|Q42822.1|RBS_GLYTO  RecName: Full=Ribulose bisphosphate carbox...    241   3e-77   Glycine tomentella [wooly glycine]
gb|AFS41725.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    241   3e-77   Gossypium raimondii
gb|AIF75361.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    241   3e-77   Nicotiana tomentosiformis
gb|AIF75363.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    241   3e-77   Nicotiana tabacum [American tobacco]
gb|KHG18747.1|  Ribulose bisphosphate carboxylase small chain, ch...    241   3e-77   Gossypium arboreum [tree cotton]
sp|P31333.2|RBS_GOSHI  RecName: Full=Ribulose bisphosphate carbox...    241   3e-77   Gossypium hirsutum [American cotton]
gb|AIF75340.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    241   3e-77   Brassica oleracea
gb|ACO35888.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    241   3e-77   Ageratina adenophora
gb|AIF75291.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    241   3e-77   Arabidopsis arenosa
ref|XP_008807113.1|  PREDICTED: ribulose bisphosphate carboxylase...    241   4e-77   Phoenix dactylifera
ref|XP_002868776.1|  ribulose bisphosphate carboxylase                  241   4e-77   Arabidopsis lyrata subsp. lyrata
gb|AIF75344.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    241   4e-77   Brassica oleracea
gb|ACQ90230.1|  virus-resistance protein                                243   4e-77   Brassica rapa subsp. chinensis [bok-choy]
gb|AIF75294.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    240   4e-77   Arabidopsis suecica
ref|NP_001119331.1|  ribulose bisphosphate carboxylase small chai...    241   5e-77   Arabidopsis thaliana [mouse-ear cress]
sp|P12468.1|RBS4_SOYBN  RecName: Full=Ribulose bisphosphate carbo...    241   5e-77   Glycine max [soybeans]
sp|P19310.1|RBS4_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    241   5e-77   Lemna gibba
gb|KDP29409.1|  hypothetical protein JCGZ_18330                         240   5e-77   Jatropha curcas
ref|XP_007033270.1|  Ribulose bisphosphate carboxylase (small cha...    241   5e-77   Theobroma cacao [chocolate]
ref|XP_006391472.1|  hypothetical protein EUTSA_v10019202mg             241   5e-77   Eutrema salsugineum [saltwater cress]
sp|Q39747.1|RBS5_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    241   5e-77   Flaveria pringlei
emb|CDX99682.1|  BnaC04g34390D                                          241   5e-77   
ref|XP_006405770.1|  hypothetical protein EUTSA_v10027955mg             241   6e-77   Eutrema salsugineum [saltwater cress]
gb|ABA46901.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    241   6e-77   Musa acuminata AAA Group [Cavendish banana]
gb|AEX60843.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    241   6e-77   Gossypium hirsutum [American cotton]
gb|AIR75139.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    240   6e-77   Spinacia turkestanica
emb|CDY67657.1|  BnaCnng55860D                                          241   6e-77   Brassica napus [oilseed rape]
emb|CDX67402.1|  BnaA07g14420D                                          241   7e-77   
gb|AIL82451.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    240   8e-77   Spinacia oleracea
gb|AIR75136.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    240   8e-77   Spinacia oleracea
ref|XP_010916368.1|  PREDICTED: ribulose bisphosphate carboxylase...    240   1e-76   Elaeis guineensis
gb|AIF75324.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    240   1e-76   Brassica rapa
gb|AIF75342.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    240   1e-76   Brassica oleracea
gb|AAG40356.1|AF325004_1  At1g67090                                     240   1e-76   Arabidopsis thaliana [mouse-ear cress]
gb|AFS41770.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    239   1e-76   Gossypium gossypioides
ref|XP_010511625.1|  PREDICTED: ribulose bisphosphate carboxylase...    240   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_009139778.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   2e-76   Brassica rapa
ref|XP_009125072.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   2e-76   Brassica rapa
gb|AIF75292.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    239   2e-76   Arabidopsis suecica
gb|KCW52064.1|  hypothetical protein EUGRSUZ_J01502                     240   2e-76   Eucalyptus grandis [rose gum]
gb|ABB51649.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    239   2e-76   Brassica napus [oilseed rape]
gb|AIF75365.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    238   2e-76   Nicotiana tabacum [American tobacco]
ref|XP_008797838.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   2e-76   Phoenix dactylifera
gb|AAF06100.1|  ribulose 1,5-bisphosphate carboxylase small chain...    239   3e-76   Manihot esculenta [manioc]
sp|Q39748.1|RBS6_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    239   3e-76   Flaveria pringlei
gb|AIF75317.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    239   3e-76   Brassica rapa
ref|XP_010551266.1|  PREDICTED: ribulose bisphosphate carboxylase...    239   3e-76   Tarenaya hassleriana [spider flower]
emb|CDY01665.1|  BnaC04g30870D                                          239   3e-76   
gb|AIF75337.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    239   4e-76   Brassica oleracea
sp|Q39744.1|RBS2_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    239   4e-76   Flaveria pringlei
ref|XP_009390221.1|  PREDICTED: ribulose bisphosphate carboxylase...    238   5e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFS41763.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    238   5e-76   Gossypium herbaceum [Arabian cotton]
gb|KJB10450.1|  hypothetical protein B456_001G201800                    238   5e-76   Gossypium raimondii
gb|ABQ42552.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    238   6e-76   Musa acuminata AAA Group [Cavendish banana]
gb|AIF75332.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    238   7e-76   Brassica oleracea
sp|Q39743.1|RBS1_FLAPR  RecName: Full=Ribulose bisphosphate carbo...    238   8e-76   Flaveria pringlei
sp|P00872.2|RBS1_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    238   8e-76   Lemna gibba
sp|P19309.1|RBS3_LEMGI  RecName: Full=Ribulose bisphosphate carbo...    238   8e-76   Lemna gibba
emb|CAA53083.1|  ribulose-1,5-bisphosphate carboxylase /oxygenase...    238   8e-76   Brassica napus [oilseed rape]
ref|XP_006663954.1|  PREDICTED: ribulose bisphosphate carboxylase...    238   8e-76   Oryza brachyantha
gb|AIR75138.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    237   9e-76   Spinacia tetrandra
sp|Q42915.1|RBS_MANES  RecName: Full=Ribulose bisphosphate carbox...    238   9e-76   Manihot esculenta [manioc]
gb|ABA46900.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    238   1e-75   Musa acuminata AAA Group [Cavendish banana]
emb|CAA31948.1|  ribulose bisphosphate carboxylase                      238   1e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225932.1|  hypothetical protein PRUPE_ppa012174mg             237   1e-75   Prunus persica
sp|P05346.2|RBS1_BRANA  RecName: Full=Ribulose bisphosphate carbo...    237   1e-75   Brassica napus [oilseed rape]
gb|AFS41765.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    237   1e-75   Gossypium armourianum
ref|XP_006302885.1|  hypothetical protein CARUB_v10021016mg             237   2e-75   Capsella rubella
gb|AIF75313.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    237   2e-75   Brassica rapa
dbj|BAJ08160.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        237   2e-75   Brassica rapa subsp. chinensis [bok-choy]
emb|CAD21856.1|  putative ribulose 1,5 biphosphate carboxylase sm...    237   2e-75   Rumex obtusifolius
gb|KJB43046.1|  hypothetical protein B456_007G181300                    236   2e-75   
sp|P29684.1|RBS_HEVBR  RecName: Full=Ribulose bisphosphate carbox...    236   3e-75   
ref|XP_004962611.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   3e-75   
gb|AFS41766.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    236   4e-75   
ref|XP_011015710.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   4e-75   
ref|XP_008243231.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   5e-75   
gb|ABL97974.1|  ribulose bisphosphate carboxylase                       235   5e-75   
emb|CAA30290.1|  rubisco ssu precursor                                  236   5e-75   
ref|XP_009380302.1|  PREDICTED: ribulose bisphosphate carboxylase...    236   6e-75   
gb|AFS41771.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    235   6e-75   
sp|O24045.1|RBS_MUSAC  RecName: Full=Ribulose bisphosphate carbox...    235   7e-75   
sp|P07089.1|RBS_FLATR  RecName: Full=Ribulose bisphosphate carbox...    235   7e-75   
emb|CAH59401.1|  Rubisco SSU                                            235   8e-75   
gb|AAA84592.1|  ribulose 1,5-bisphosphate carboxylase                   235   9e-75   
gb|AGV54682.1|  ribulose bisphosphate carboxylase                       235   9e-75   
ref|XP_007151650.1|  hypothetical protein PHAVU_004G064800g             235   9e-75   
ref|XP_007033269.1|  Ribulose bisphosphate carboxylase (small cha...    235   9e-75   
gb|AAA33686.1|  ribulose 1,5-bisphosphate carboxylase small subun...    234   1e-74   
gb|ABL97962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    235   1e-74   
gb|AIF75298.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    234   1e-74   
gb|AFS41762.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    234   1e-74   
gb|ABA46899.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    235   1e-74   
gb|AAP31054.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    234   1e-74   
gb|AIF75299.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    234   1e-74   
emb|CAA42618.1|  ribulose bisphosphate carboxylase                      234   3e-74   
gb|AAP31053.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    233   5e-74   
dbj|BAA35165.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    233   5e-74   
gb|ADT78691.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    233   5e-74   
gb|AFS41772.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    233   6e-74   
dbj|BAK23964.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    233   7e-74   
ref|NP_001066606.1|  Os12g0291400                                       233   9e-74   
gb|ABK96590.1|  unknown                                                 233   1e-73   
dbj|BAA35153.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    232   1e-73   
sp|O24634.1|RBS1_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    232   1e-73   
dbj|BAA35162.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    231   2e-73   
sp|O22572.1|RBS2_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    232   2e-73   
ref|NP_001066604.1|  Os12g0291100                                       232   2e-73   
ref|XP_011089882.1|  PREDICTED: ribulose bisphosphate carboxylase...    232   2e-73   
gb|EAY97115.1|  hypothetical protein OsI_19041                          231   2e-73   
gb|EMT06085.1|  hypothetical protein F775_43781                         231   2e-73   
dbj|BAB19812.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    231   2e-73   
ref|NP_001066559.1|  Os12g0274700                                       231   2e-73   
gb|EYU38174.1|  hypothetical protein MIMGU_mgv1a014707mg                231   2e-73   
sp|O22573.1|RBS3_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    231   3e-73   
gb|EYU38172.1|  hypothetical protein MIMGU_mgv1a014686mg                231   3e-73   
dbj|BAJ86022.1|  predicted protein                                      231   3e-73   
ref|XP_006663961.1|  PREDICTED: ribulose bisphosphate carboxylase...    231   4e-73   
gb|EMT21846.1|  Ribulose bisphosphate carboxylase small chain PW9...    231   4e-73   
ref|XP_006663955.1|  PREDICTED: ribulose bisphosphate carboxylase...    231   4e-73   
dbj|BAJ89884.1|  predicted protein                                      231   5e-73   
ref|XP_006664952.1|  PREDICTED: ribulose bisphosphate carboxylase...    230   5e-73   
ref|XP_003576920.1|  PREDICTED: ribulose bisphosphate carboxylase...    231   5e-73   
ref|XP_011099669.1|  PREDICTED: ribulose bisphosphate carboxylase...    231   6e-73   
gb|EPS63610.1|  ribulose bisphosphate carboxylase small chain           230   6e-73   
emb|CDY12616.1|  BnaA02g12840D                                          231   6e-73   
emb|CAA10497.1|  hypothetical protein                                   230   6e-73   
dbj|BAA35167.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    230   6e-73   
ref|XP_010528479.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    231   7e-73   
gb|ACA42439.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    231   7e-73   
dbj|BAJ90202.1|  predicted protein                                      230   8e-73   
sp|O22645.1|RBS5_FRIAG  RecName: Full=Ribulose bisphosphate carbo...    230   8e-73   
ref|NP_001031981.1|  ribulose bisphosphate carboxylase small chai...    230   9e-73   
ref|XP_011099670.1|  PREDICTED: ribulose bisphosphate carboxylase...    230   9e-73   
dbj|BAJ90404.1|  predicted protein                                      230   1e-72   
ref|XP_003577109.1|  PREDICTED: ribulose bisphosphate carboxylase...    230   1e-72   
ref|XP_009127519.1|  PREDICTED: ribulose bisphosphate carboxylase...    230   1e-72   
dbj|BAA35158.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    229   1e-72   
ref|XP_009127518.1|  PREDICTED: ribulose bisphosphate carboxylase...    230   1e-72   
dbj|BAA35145.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    229   1e-72   
gb|EMT25898.1|  Ribulose bisphosphate carboxylase small chain PWS...    229   1e-72   
ref|XP_003581511.1|  PREDICTED: ribulose bisphosphate carboxylase...    229   1e-72   
dbj|BAA35161.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    229   1e-72   
ref|NP_001066607.1|  Os12g0292400                                       229   1e-72   
gb|EMT21850.1|  Ribulose bisphosphate carboxylase small chain PW9...    229   2e-72   
dbj|BAJ90550.1|  predicted protein                                      229   2e-72   
gb|AAC14064.1|  ribulose 1,5-bisphosphate carboxylase small subunit     229   2e-72   
dbj|BAA35150.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    228   2e-72   
ref|XP_009127523.1|  PREDICTED: ribulose bisphosphate carboxylase...    229   2e-72   
emb|CDY42338.1|  BnaC02g17150D                                          229   2e-72   
dbj|BAA35156.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    228   3e-72   
gb|AIF75311.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    229   3e-72   
emb|CAA10496.1|  hypothetical protein                                   228   3e-72   
ref|XP_006842277.1|  hypothetical protein AMTR_s00079p00061090          229   3e-72   
gb|AIF75328.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    228   3e-72   
gb|EMS44969.1|  Ribulose bisphosphate carboxylase small chain PW9...    228   4e-72   
ref|XP_003573910.1|  PREDICTED: ribulose bisphosphate carboxylase...    228   4e-72   
dbj|BAA35169.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    228   5e-72   
gb|AEX60835.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    228   5e-72   
ref|XP_004962301.1|  PREDICTED: ribulose bisphosphate carboxylase...    228   5e-72   
sp|P26667.1|RBS2_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    228   6e-72   
gb|AFO59569.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    228   6e-72   
gb|AIF75326.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    228   6e-72   
ref|XP_004962302.1|  PREDICTED: ribulose bisphosphate carboxylase...    228   6e-72   
gb|EMT21848.1|  Ribulose bisphosphate carboxylase small chain PW9...    228   7e-72   
gb|EYU45444.1|  hypothetical protein MIMGU_mgv1a014737mg                228   7e-72   
dbj|BAB19810.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    228   7e-72   
gb|AAF17589.1|AF202645_1  ribulose-1,5-bisphosphate carboxylase s...    227   8e-72   
dbj|BAA00539.1|  small subunit of ribulose-1,5-bisphosphate carbo...    228   8e-72   
sp|P00871.2|RBS1_WHEAT  RecName: Full=Ribulose bisphosphate carbo...    227   8e-72   
dbj|BAK23963.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    227   8e-72   
dbj|BAA35148.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    226   1e-71   
sp|O48550.1|RBS_ZANAE  RecName: Full=Ribulose bisphosphate carbox...    227   1e-71   
gb|AAC83374.1|  ribulose-1,5-bisphosphate carboxylase small subunit     226   1e-71   
gb|AAF17590.1|AF202646_1  ribulose-1,5-bisphosphate carboxylase s...    226   1e-71   
gb|AAF07942.1|AF192773_1  ribulose-1,5-bisphosphate carboxylase s...    226   1e-71   
dbj|BAK23962.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    226   2e-71   
dbj|BAB19811.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    226   2e-71   
gb|EAY82834.1|  hypothetical protein OsI_38046                          226   2e-71   
gb|AAB70543.1|  ribulose 1,5-bisphosphate carboxylase small subunit     226   2e-71   
dbj|BAA35179.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    226   2e-71   
gb|AEB00556.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    226   2e-71   
gb|AFS41756.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    226   3e-71   
gb|AIR75143.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    225   3e-71   
gb|AEA48975.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    226   3e-71   
dbj|BAJ40065.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    226   3e-71   
dbj|BAA35170.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    226   3e-71   
dbj|BAA35147.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    226   3e-71   
gb|AAF07946.1|AF192777_1  ribulose-1,5-bisphosphate carboxylase s...    225   4e-71   
emb|CAH59404.1|  Rubisco SSU                                            226   4e-71   
emb|CDY42337.1|  BnaC02g17140D                                          226   4e-71   
dbj|BAB19814.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    226   5e-71   
gb|AAF07949.1|AF192780_1  ribulose-1,5-bisphosphate carboxylase s...    225   5e-71   
gb|AAF17591.1|AF202647_1  ribulose-1,5-bisphosphate carboxylase s...    225   5e-71   
ref|XP_002276967.1|  PREDICTED: ribulose bisphosphate carboxylase...    226   5e-71   
gb|ABC86738.1|  ribulose-1,5-bisphophate carboxylase/oxygenase sm...    226   5e-71   
gb|AAC78643.1|  ribulose-1,5-bisphosphate carboxylase small subunit     225   6e-71   
gb|AEX60840.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    224   7e-71   
gb|AAC67588.1|  ribulose-1,5-bisphosphate carboxylase small subunit     224   8e-71   
gb|ABR25969.1|  ribulose bisphosphate carboxylase small chain c         224   1e-70   
gb|AAF07947.1|AF192778_1  ribulose-1,5-bisphosphate carboxylase s...    224   1e-70   
ref|XP_002450304.1|  hypothetical protein SORBIDRAFT_05g003480          224   2e-70   
gb|AFI60243.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   2e-70   
gb|ABY66908.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    224   2e-70   
emb|CBI15452.3|  unnamed protein product                                223   2e-70   
gb|ABQ42090.1|  ribulose bisphosphate carboxylase small chain (Ru...    224   2e-70   
gb|AIF75302.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    223   2e-70   
gb|AIF75301.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    223   2e-70   
gb|AIF75300.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    223   2e-70   
gb|AEX60837.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   3e-70   
gb|AIR75144.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    222   4e-70   
gb|AEX60836.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    223   4e-70   
dbj|BAA35164.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    223   4e-70   
gb|ABQ42164.1|  ribulose bisphosphate carboxylase small chain (Ru...    223   5e-70   
emb|CAG25595.1|  putative rubisco small subunit                         223   5e-70   
ref|XP_007036525.1|  Ribulose bisphosphate carboxylase (small cha...    223   6e-70   
dbj|BAP82418.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    223   7e-70   
gb|AHC28978.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    222   8e-70   
gb|AAF07945.1|AF192776_1  ribulose-1,5-bisphosphate carboxylase s...    222   8e-70   
gb|KEH21537.1|  ribulose bisphosphate carboxylase small chain           223   9e-70   
ref|NP_001105294.1|  ribulose bisphosphate carboxylase small chai...    222   9e-70   
emb|CAA70416.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    222   1e-69   
gb|AAA33685.2|  ribulose 1,5 bisphosphate carboxylase                   221   1e-69   
gb|AAF07943.1|AF192774_1  ribulose-1,5-bisphosphate carboxylase s...    222   1e-69   
gb|AEX60838.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   1e-69   
gb|AIF75330.1|  chloroplast ribulose 1,5-bisphosphate carboxylase...    222   2e-69   
dbj|BAA35166.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    221   2e-69   
gb|ABQ42089.1|  ribulose bisphosphate carboxylase small chain (Ru...    222   2e-69   
gb|ACS68693.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    221   2e-69   
dbj|BAA35178.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    221   2e-69   
gb|EMS44970.1|  Ribulose bisphosphate carboxylase small chain PWS...    221   2e-69   
dbj|BAA35151.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    221   3e-69   
gb|AAC83373.1|  ribulose-1,5-bisphosphate carboxylase small subunit     221   3e-69   
dbj|BAA35173.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    220   3e-69   
dbj|BAB19813.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    221   3e-69   
ref|XP_004962610.1|  PREDICTED: ribulose bisphosphate carboxylase...    220   4e-69   
gb|AAF07985.1|AF200303_1  ribulose-1,5-bisphosphate carboxylase s...    220   5e-69   
dbj|BAA35172.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    219   1e-68   
gb|ABY66909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    219   2e-68   
sp|Q40004.1|RBS_HORVU  RecName: Full=Ribulose bisphosphate carbox...    218   5e-68   
emb|CAA68419.1|  ribulose 1,5-bisphosphate carboxylase/oxygenase        217   6e-68   
gb|AAD27881.1|AF139469_1  ribulose-1,5-bisphosphate carboxylase s...    218   7e-68   
gb|ABA46878.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    217   8e-68   
gb|ABA46875.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    216   2e-67   
ref|WP_026003795.1|  hypothetical protein                               214   3e-67   
gb|ABA46877.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    215   4e-67   
gb|ABA46882.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    215   5e-67   
gb|AGJ76629.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    215   5e-67   
gb|ABA46879.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    214   6e-67   
gb|AAC83372.1|  ribulose-1,5-bisphosphate carboxylase small subunit     214   7e-67   
gb|ABA46889.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    214   7e-67   
ref|XP_006485852.1|  PREDICTED: ribulose bisphosphate carboxylase...    217   8e-67   
gb|ABA46911.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    214   1e-66   
ref|XP_003555148.2|  PREDICTED: LOW QUALITY PROTEIN: ribulose bis...    214   1e-66   
gb|ABA46898.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    214   1e-66   
gb|AAK16227.1|AF044395_1  ribulose-1,5-bisphosphate carboxylase s...    213   1e-66   
gb|ABA46883.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    214   1e-66   
gb|ABA46910.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    213   2e-66   
emb|CAA42617.1|  ribulose bisphosphate carboxylase                      213   2e-66   
gb|EYU38175.1|  hypothetical protein MIMGU_mgv1a014707mg                213   2e-66   
dbj|BAA35175.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    213   3e-66   
gb|ABA46888.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    213   3e-66   
sp|P10053.1|RBS_PINTH  RecName: Full=Ribulose bisphosphate carbox...    213   4e-66   
pdb|3RUB|S  Chain S, Crystal Structure Of The Unactivated Form Of...    211   5e-66   
gb|ABA46891.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    212   5e-66   
gb|AAF06097.1|  ribulose 1,5-bisphosphate carboxylase small chain...    213   6e-66   
ref|WP_037767734.1|  hypothetical protein                               211   7e-66   
gb|ABR45726.1|  RBCS1                                                   212   7e-66   
gb|ABA46909.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    212   8e-66   
gb|ABR45725.1|  RBCS1                                                   212   8e-66   
dbj|BAA35176.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase ...    211   9e-66   
gb|AAK16228.1|AF044396_1  ribulose-1,5-bisphosphate carboxylase s...    210   1e-65   
gb|ABA46887.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    211   1e-65   
sp|P16031.1|RBS_LARLA  RecName: Full=Ribulose bisphosphate carbox...    212   2e-65   
sp|Q38793.1|RBS_AEGTA  RecName: Full=Ribulose bisphosphate carbox...    211   3e-65   
gb|ABA46892.1|  chloroplast ribulose-1,5-bisphosphate carboxylase...    210   3e-65   
ref|XP_009357814.1|  PREDICTED: ribulose bisphosphate carboxylase...    210   4e-65   
pdb|4RUB|S  Chain S, A Crystal Form Of Ribulose-1,5-Bisphosphate ...    208   7e-65   
gb|EMS48023.1|  Ribulose bisphosphate carboxylase small chain, ch...    209   7e-65   
gb|ABK21690.1|  unknown                                                 210   1e-64   
sp|Q41373.1|RBS_SACHY  RecName: Full=Ribulose bisphosphate carbox...    209   1e-64   
gb|ACN40080.1|  unknown                                                 209   2e-64   
gb|AAK16231.1|AF044399_1  ribulose-1,5-bisphosphate carboxylase s...    207   2e-64   
gb|ABK21347.1|  unknown                                                 209   2e-64   
gb|ACN40169.1|  unknown                                                 209   3e-64   
gb|ABK21447.1|  unknown                                                 208   4e-64   
gb|ABK21259.1|  unknown                                                 208   5e-64   
gb|ABK21852.1|  unknown                                                 208   5e-64   
gb|EMS50269.1|  Ribulose bisphosphate carboxylase small chain PW9...    208   5e-64   
gb|ABK21876.1|  unknown                                                 208   7e-64   
gb|ABK22359.1|  unknown                                                 208   7e-64   
emb|CAA38346.1|  ribulose bisphosphate carboxylase                      207   7e-64   



>sp|P04715.1|RBS2_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU11A, 
chloroplastic; Short=RuBisCO small subunit SSU11A; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS1 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu11A) precursor - garden petunia
 emb|CAA27445.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   274 bits (700),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYLP L+ EQLL
Sbjct  25   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLTDEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K++EYLLNKGWVPCLEFETE GFVYRE+HASP YYDGRYWTMWKLPMFGCTDATQV+ EL
Sbjct  85   KEIEYLLNKGWVPCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E KKAYP AW+RI+GFDN RQVQCI FIAYKP
Sbjct  145  QEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKP  177



>sp|P04714.1|RBS1_PETHY RecName: Full=Ribulose bisphosphate carboxylase small chain SSU8, 
chloroplastic; Short=RuBisCO small subunit SSU8; Flags: 
Precursor [Petunia x hybrida]
 pir||RKPJS8 ribulose-bisphosphate carboxylase (EC 4.1.1.39) small chain  
(ssu8) precursor - garden petunia
 emb|CAA27444.1| ribulose 1,5-bisphosphate carboxylase [Petunia x hybrida]
Length=180

 Score =   269 bits (688),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS  SFPV+ K   D TSI++NG RVQCMQVWPP+G KK+ETLSYLP L+ EQLL
Sbjct  25   PFNGLKSAVSFPVSSKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLTDEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K++EYLLNKGWVPCLEFETE GFVYRE+HASP YYDGRYWTMWKLPMFGCTDATQV+ EL
Sbjct  85   KEIEYLLNKGWVPCLEFETEHGFVYREYHASPRYYDGRYWTMWKLPMFGCTDATQVLGEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E KKAYP AW+RI+GFDN RQVQCI FIAYKP
Sbjct  145  QEAKKAYPNAWIRIIGFDNVRQVQCISFIAYKP  177



>sp|P26573.1|RBS8_NICPL RecName: Full=Ribulose bisphosphate carboxylase small chain 8B, 
chloroplastic; Short=RuBisCO small subunit 8B; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA31994.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
 gb|AAA34110.1| ribulose bisphosphate carboxylase [Nicotiana plumbaginifolia]
Length=180

 Score =   269 bits (687),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             ++EYLL  GWVPCLEFETE+GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  85   SEIEYLLKSGWVPCLEFETERGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  145  EEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>sp|P26576.1|RBSB_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49415.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   268 bits (686),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTASFPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSTASFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  85   KEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  145  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_006363111.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 ref|XP_006363112.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic-like [Solanum tuberosum]
 sp|P26577.1|RBSC_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2C, 
chloroplastic; Short=RuBisCO small subunit 2C; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49416.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   268 bits (686),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTASFPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSTASFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  85   KEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  145  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>sp|P07180.1|RBS3A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3A/3C, 
chloroplastic; Short=RuBisCO small subunit 3A/3C; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA29402.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 emb|CAA29404.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
 gb|AAA34190.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTASFPV++K   D TSI++NG RV CMQVWPP  +KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             ++EYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  85   SEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  145  QEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_004232356.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic [Solanum lycopersicum]
 sp|P05349.1|RBS3B_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA29403.1| ribulose 1,5-bisphosphate carboxylase/oxyenase [Solanum lycopersicum]
 dbj|BAA01888.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum lycopersicum]
Length=180

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTASFPV++K   D TSI++NG RV CMQVWPP  +KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSTASFPVSRKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             ++EYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  85   SEIEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  145  QEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>sp|P26574.1|RBS1_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49413.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+ EQLL
Sbjct  26   PFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLTDEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   KEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +ECKK+YP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  QECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>sp|P26575.1|RBSA_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49414.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=180

 Score =   267 bits (682),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSAASFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  85   KEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  145  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AFW90575.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Solanum tuberosum]
Length=181

 Score =   266 bits (681),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTA+FPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+ EQLL
Sbjct  26   PFTGLKSTATFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLTDEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   KEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +ECK AYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  QECKNAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>gb|AFK36660.1| unknown [Lotus japonicus]
 gb|AFK45650.1| unknown [Lotus japonicus]
Length=177

 Score =   266 bits (681),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  22   PFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTVEQLA  81

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFG TDA+QV+ EL
Sbjct  82   KEVEYLIRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGTTDASQVLKEL  141

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP A++RI+GFDNKRQVQCI FIA++P+
Sbjct  142  EEAKKAYPNAFIRIIGFDNKRQVQCISFIAHRPE  175



>gb|ABY21254.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   266 bits (680),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FPV++K   D TSI++NG RV+CMQVWPP   KK+ETLSYLP L+ EQLL
Sbjct  26   PFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQVWPPINTKKYETLSYLPDLTDEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   KEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +ECKK+YP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  QECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>gb|AHI85721.1| stress-induced protein 16 [Capsicum annuum]
Length=180

 Score =   266 bits (680),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPVT+K+  D TSI++NG RVQCM VWPP   KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSAASFPVTRKNNLDITSIASNGGRVQCMLVWPPINKKKYETLSYLPDLSDEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K++EYLL KGWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E+
Sbjct  85   KEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  145  QEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>sp|P32764.1|RBS3_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA49417.1| ribulose bisphosphate carboxylase [Solanum tuberosum]
Length=181

 Score =   266 bits (680),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQL  237
            PFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP LS EQL
Sbjct  25   PFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQL  84

Query  238  LKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAE  417
            LK+VEYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+AE
Sbjct  85   LKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAE  144

Query  418  LEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            ++E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  145  VQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>gb|ABY21253.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   266 bits (680),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+ EQLL
Sbjct  26   PFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLTDEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTD TQV+AE+
Sbjct  86   KEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDTTQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +ECKK+YP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  QECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009800809.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   266 bits (679),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>gb|AAA34192.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=180

 Score =   266 bits (679),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVTKK   D TSI++NG RV CMQVWPP  +KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  85   SEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  145  QEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_009595081.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009609566.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana tomentosiformis]
 gb|AAP03874.1| putative ribulose bisphosphate carboxylase small subunit protein 
precursor [Nicotiana tabacum]
Length=180

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLSEEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             ++EYLL  GWVPCLEFETE+GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  85   SEIEYLLKNGWVPCLEFETERGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
             E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  145  GEAKKAYPEAWIRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_004234568.1| PREDICTED: ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic [Solanum lycopersicum]
 sp|P07179.2|RBS2A_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 2A, 
chloroplastic; Short=RuBisCO small subunit 2A; AltName: Full=LESS 
5; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34189.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
(EC 4.1.1.39) [Solanum lycopersicum]
 emb|CAA29401.2| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=180

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVTKK   D TSI++NG RV CMQVWPP  +KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSSATFPVTKKQNLDITSIASNGGRVSCMQVWPPINMKKYETLSYLPDLSDEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             ++EYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  85   SEIEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  145  QEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_009795055.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009795056.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009772497.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Nicotiana sylvestris]
 sp|P69249.1|RBS_TOBAC RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; AltName: Full=TSSU3-8; 
Flags: Precursor [Nicotiana tabacum]
 sp|P69250.1|RBS1_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA25862.1| unnamed protein product [Nicotiana sylvestris]
 emb|CAA26208.1| small subunit ribulose 1,5-bisphosphate carboxylase [Nicotiana 
tabacum]
 prf||1103193A carboxylase,RBP
Length=180

 Score =   265 bits (678),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  85   SEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  145  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_010044264.1| PREDICTED: ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic-like [Eucalyptus grandis]
 dbj|BAI53120.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
 gb|KCW86324.1| hypothetical protein EUGRSUZ_B03013 [Eucalyptus grandis]
Length=179

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+KS+ D TS+S+NG RVQCMQVWPP G KKFETLSYLPPLS E L 
Sbjct  24   PFTGLKSASAFPVTRKSSEDITSLSSNGGRVQCMQVWPPIGKKKFETLSYLPPLSPESLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL  GWVPCLEFE E GFVYRE H+SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSGWVPCLEFELEHGFVYREHHSSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDNKRQVQCI FIAYKP
Sbjct  144  EEAKKAYPTAFIRIIGFDNKRQVQCISFIAYKP  176



>ref|XP_010693099.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=181

 Score =   265 bits (676),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKST++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPL+TEQLL
Sbjct  26   PFNGLKSTSAFPVTRKSNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLTTEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +V YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+
Sbjct  86   AEVNYLLVKGWIPCLEFEIKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  146  EEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKP  178



>gb|AFB70994.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Nicotiana attenuata]
Length=180

 Score =   265 bits (676),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  25   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA QV+AE+
Sbjct  85   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDAAQVLAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  145  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_006358055.1| PREDICTED: ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Solanum tuberosum]
Length=181

 Score =   264 bits (674),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST +FPV++K   D TSI++NG RV+CMQVWPP  +KK+ETLSYLP L+ EQLL
Sbjct  26   PFTGLKSTPTFPVSRKQNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLTDEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   KEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +ECK AYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  QECKNAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009758143.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana sylvestris]
 sp|P22433.1|RBS2_NICSY RecName: Full=Ribulose bisphosphate carboxylase small chain S41, 
chloroplastic; Short=RuBisCO small subunit S41; Flags: Precursor 
[Nicotiana sylvestris]
 emb|CAA37516.1| NySS41 [Nicotiana sylvestris]
Length=181

 Score =   264 bits (674),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_010032637.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Eucalyptus grandis]
Length=181

 Score =   263 bits (673),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YLL  GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  86   KEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKKAYP A+VRI+GFDNKRQVQCI FIA+KP
Sbjct  146  EECKKAYPTAFVRIIGFDNKRQVQCISFIAFKP  178



>dbj|BAI53118.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   263 bits (673),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YLL  GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  86   KEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKKAYP A+VRI+GFDNKRQVQCI FIA+KP
Sbjct  146  EECKKAYPTAFVRIIGFDNKRQVQCISFIAFKP  178



>sp|Q41351.1|RBS_STELP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Stellaria longipes]
 gb|AAA69018.1| ribulose 1,5-bisphosphate carboxylase small subunit [Stellaria 
longipes]
Length=180

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPV++K+  D TSI++NG RV+CMQVWPP  +KK+ETLSYLP LS+EQLL
Sbjct  25   PFTGLKSNASFPVSRKTNLDITSIASNGGRVRCMQVWPPINMKKYETLSYLPDLSSEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             ++EYLL  GWVPCLEFETE GFVYRE  +SPGYYDGRYWTMWKLPMFGCTDATQV AE+
Sbjct  85   SEIEYLLKNGWVPCLEFETEHGFVYREHTSSPGYYDGRYWTMWKLPMFGCTDATQVAAEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E KKAYP A +RI+GFDN RQVQCI FIAYKP+
Sbjct  145  QEAKKAYPDAHIRIIGFDNVRQVQCISFIAYKPE  178



>gb|ABY21255.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Solanum tuberosum]
Length=181

 Score =   263 bits (671),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FPV++K   D TSI++NG RV+CMQVWPP   KK+ETLSYLP L+ EQLL
Sbjct  26   PFTGLKSAATFPVSRKQNLDITSIASNGGRVRCMQVWPPINTKKYETLSYLPDLTDEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFETE G VYRE H SPGYYDGRYW MWKLPMFGCTDATQV+AE+
Sbjct  86   KEVEYLLKNGWVPCLEFETEHGIVYREKHKSPGYYDGRYWNMWKLPMFGCTDATQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +ECKK+YP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  QECKKSYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_008381263.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Malus domestica]
Length=183

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L 
Sbjct  29   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLA  87

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  148  EEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  180



>gb|AFK33868.1| unknown [Lotus japonicus]
Length=177

 Score =   262 bits (669),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  22   PFTGLKSMAGFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTVEQLA  81

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWVPCLEFETEKGFVYRE   SPGYYDGRYWTMWKLPMFG TDA+QV+ EL
Sbjct  82   KEVEYLIRKGWVPCLEFETEKGFVYRENLKSPGYYDGRYWTMWKLPMFGTTDASQVLKEL  141

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP A++RI+GFDNKRQVQCI FIA++P+
Sbjct  142  EEAKKAYPNAFIRIIGFDNKRQVQCISFIAHRPE  175



>ref|XP_009625434.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic [Nicotiana tomentosiformis]
Length=181

 Score =   262 bits (670),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS +SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSASSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009767108.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_004233493.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Solanum lycopersicum]
 sp|P08706.2|RBS1_SOLLC RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; AltName: Full=LESS 
17; Flags: Precursor [Solanum lycopersicum]
 gb|AAA34188.1| ribulose-1,5-bisphophate carboxylase/ oxygenase small subunit 
[Solanum lycopersicum]
 emb|CAA29400.1| ribulose 1,5-bisphosphate carboxylase/oxygenase [Solanum lycopersicum]
Length=181

 Score =   262 bits (669),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 1/155 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQL  237
            PFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP LS EQL
Sbjct  25   PFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQL  84

Query  238  LKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAE  417
            L ++EYLL  GWVPCLEFETE+GFVYRE ++SPGYYDGRYWTMWKLPMFGCTDATQV+AE
Sbjct  85   LSEIEYLLKNGWVPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAE  144

Query  418  LEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            ++E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  145  VQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  179



>gb|AGT97045.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=180

 Score =   262 bits (669),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  64   FTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLK  243
            F GLKS ASFPVT+K   D TSI++NG RVQCM VWPP   KK+ETLSYLP LS EQLLK
Sbjct  26   FNGLKSAASFPVTRKQDLDITSIASNGGRVQCMLVWPPINKKKYETLSYLPDLSDEQLLK  85

Query  244  QVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELE  423
            ++EYLL KGWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++
Sbjct  86   EIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQ  145

Query  424  ECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>gb|AFK48034.1| unknown [Lotus japonicus]
Length=181

 Score =   262 bits (669),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FPV +K   D TSI+ NG RVQCMQVWPP G KKFETLSYLPPL+TEQLL
Sbjct  27   PFTGLKSMAGFPV-RKVNNDITSIANNGGRVQCMQVWPPIGKKKFETLSYLPPLTTEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGC+DATQV+ EL
Sbjct  86   KEVEYLLRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDATQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E  KAYP A+VRI+GFDN RQVQCI FIA++P
Sbjct  146  DEAVKAYPNAFVRIIGFDNVRQVQCISFIAHRP  178



>gb|AAR83879.1| Cristal-Glass1 protein [Capsicum annuum]
Length=180

 Score =   262 bits (669),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  64   FTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLK  243
            F GLKS ASFPVT+K   D TSI++NG RVQCM VWPP   KK+ETLSYLP LS EQLLK
Sbjct  26   FNGLKSAASFPVTRKQDLDITSIASNGGRVQCMLVWPPINKKKYETLSYLPDLSDEQLLK  85

Query  244  QVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELE  423
            ++EYLL KGWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++
Sbjct  86   EIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQ  145

Query  424  ECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>ref|NP_001275244.1| ribulose bisphosphate carboxylase small chain C, chloroplastic 
[Solanum tuberosum]
 sp|P10647.1|RBS0_SOLTU RecName: Full=Ribulose bisphosphate carboxylase small chain C, 
chloroplastic; Short=RuBisCO small subunit C; Flags: Precursor 
[Solanum tuberosum]
 gb|AAA33838.1| ribulose bisphosphate carboxylase (EC 4.1.1.39) [Solanum tuberosum]
Length=181

 Score =   261 bits (668),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 135/155 (87%), Gaps = 1/155 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQL  237
            PFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP LS EQL
Sbjct  25   PFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDLSDEQL  84

Query  238  LKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAE  417
            LK+VEYLL  GWVPCLEFETE GFVYRE ++SPGYYDGRYWTMWKLPMFGCTD TQV+AE
Sbjct  85   LKEVEYLLKNGWVPCLEFETEHGFVYREHNSSPGYYDGRYWTMWKLPMFGCTDGTQVLAE  144

Query  418  LEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            ++E K AYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  145  VQEAKNAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_002521232.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF41184.1| Ribulose bisphosphate carboxylase small chain 1B, chloroplast 
precursor, putative [Ricinus communis]
Length=181

 Score =   261 bits (667),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPVT+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  24   PFTGLKSAASFPVTRKANNDITSIASNGGRVQCMQVWPPLGKKKFETLSYLPDLTDEQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL KGW+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGC+D+TQV+ EL
Sbjct  84   KEVDYLLRKGWIPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCSDSTQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E KKAYP +++RI+GFDN+RQVQCI FIAYKP
Sbjct  144  DEAKKAYPNSFIRIIGFDNRRQVQCISFIAYKP  176



>ref|XP_009357812.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=183

 Score =   261 bits (667),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  29   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSPESLA  87

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELETGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  148  EEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  180



>sp|O65349.1|RBS_CAPAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Capsicum annuum]
 gb|AAC17126.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Capsicum annuum]
Length=187

 Score =   261 bits (667),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  64   FTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLLK  243
            F GLKS ASFPVT+K   D TSI++NG RV+CM VWPP   KK+ETLSYLP LS EQLLK
Sbjct  26   FNGLKSAASFPVTRKQDLDITSIASNGGRVECMLVWPPINKKKYETLSYLPDLSDEQLLK  85

Query  244  QVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAELE  423
            ++EYLL KGWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTDATQV+ E++
Sbjct  86   EIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQ  145

Query  424  ECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            E KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  EAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  178



>ref|XP_008368660.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Malus domestica]
Length=179

 Score =   261 bits (666),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLSTE L 
Sbjct  25   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  84   KEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP +++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AFK42721.1| unknown [Lotus japonicus]
Length=182

 Score =   261 bits (666),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FPV +K+  D TSI++NG RVQCMQVWPP G KKFETLSYLPPL+TEQLL
Sbjct  28   PFTGLKSMAGFPV-RKANNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPPLTTEQLL  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGC+DA QV+ EL
Sbjct  87   KEVEYLLRKGWVPCLEFETEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCSDAAQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E  +AYP A+VRI+GFDN RQVQCI FIA++P
Sbjct  147  DEAVRAYPNAFVRIIGFDNVRQVQCISFIAHRP  179



>ref|XP_010693054.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=179

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS ++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPL+TEQLL
Sbjct  25   PFNGLKSASAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLTTEQLL  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +V YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+
Sbjct  84   AEVNYLLVKGWIPCLEFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCTDPAQVVNEV  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDD  525
            EE KKAYP A+VRI+GFDNKRQVQCI FIAYKP D
Sbjct  144  EEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKPKD  178



>gb|AAA34191.1| ribulose-1,5-bisphosphate carboxylase, small subunit precursor 
[Solanum lycopersicum]
Length=181

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSA-ADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQL  237
            PFTGLKS ASFPVTKK+   D TS+++NG RV+CMQVWPP  +KK+ETLSYLP  S EQL
Sbjct  25   PFTGLKSAASFPVTKKNNNVDITSLASNGGRVRCMQVWPPINMKKYETLSYLPDFSDEQL  84

Query  238  LKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAE  417
            L ++EYLL  GWVPCLEFETE+GFVYRE ++SPGYYDGRYWTMWKLPMFGCTDATQV+AE
Sbjct  85   LSEIEYLLKNGWVPCLEFETERGFVYRENNSSPGYYDGRYWTMWKLPMFGCTDATQVLAE  144

Query  418  LEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            ++E KKAYP AWVRI+GFDN RQVQCI FIAYKP+
Sbjct  145  VQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_009342656.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Pyrus x bretschneideri]
Length=183

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L 
Sbjct  29   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLA  87

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP +++RI+GFDN RQVQCI FIAYKP
Sbjct  148  EEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  180



>ref|XP_010263805.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+S+NG RVQCMQVWPP   KKFETLSYLPPLS E L 
Sbjct  27   PFTGLKSVSAFPVTRKTNNDITSLSSNGGRVQCMQVWPPIAKKKFETLSYLPPLSPESLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL  GW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+AEL
Sbjct  87   KEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDNKRQVQCI FIAYKP
Sbjct  147  EEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKP  179



>ref|XP_010693059.1| PREDICTED: ribulose bisphosphate carboxylase small chain [Beta 
vulgaris subsp. vulgaris]
Length=180

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP GLKKFETLSYLPPL+TEQLL
Sbjct  26   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPLGLKKFETLSYLPPLTTEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +V YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+
Sbjct  85   AEVNYLLVKGWIPCLEFEVKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  145  EEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKP  177



>ref|XP_010693073.1| PREDICTED: ribulose bisphosphate carboxylase small chain-like 
[Beta vulgaris subsp. vulgaris]
Length=180

 Score =   259 bits (663),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP GLKKFETLSYLPPL+TEQLL
Sbjct  26   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPLGLKKFETLSYLPPLTTEQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +V YLL KGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV E+
Sbjct  85   AEVNYLLVKGWIPCLEFEVKDGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDPAQVVNEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  145  EEVKKAYPDAFVRIIGFDNKRQVQCISFIAYKP  177



>sp|Q96542.1|RBS_BETPN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Betula pendula]
 emb|CAA69102.1| ribulose-bisphosphate carboxylase [Betula pendula]
Length=182

 Score =   259 bits (662),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFT LKST++FPVT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+EQL 
Sbjct  27   PFTCLKSTSAFPVTQKTNNDITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSEQLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K  +PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGC D++QV+ EL
Sbjct  87   KEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKKAYP A++RI+GFDNKRQVQ I FIAYKP
Sbjct  147  EECKKAYPSAFIRIIGFDNKRQVQIISFIAYKP  179



>ref|XP_004303137.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score =   259 bits (661),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FP+T+K+ +D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL++E L 
Sbjct  27   PFTGLKSASAFPITRKTNSDITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTSESLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V++LL   WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  87   KEVDFLLRNKWVPCLEFELEKGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  147  EEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>gb|AAW31667.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ammopiptanthus mongolicus]
Length=174

 Score =   258 bits (660),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPV +K  +D T+I+ NG RVQCM VWPP G KKFETLSYLPPLS E L 
Sbjct  17   PFTGLKSMASFPVPRKVNSDITTIANNGGRVQCMLVWPPLGRKKFETLSYLPPLSIESLT  76

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGWVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGC+DA+QV+ EL
Sbjct  77   KEVEYLLRKGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCSDASQVMKEL  136

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  137  EECKKEYPTAFVRIIGFDNKRQVQCISFIAYKP  169



>gb|AAA33866.1| ribulose 1,5-bisphosphate carboxylase small subunit [Malus domestica 
x Pyrus communis]
Length=179

 Score =   258 bits (660),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLSTE L 
Sbjct  25   PFTGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  84   KEVDYLLRKNWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP +++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  176



>sp|Q02980.1|RBS_MALSP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Malus sp.]
 emb|CAA46475.1| ribulose bisphosphate carboxylase [Malus sp.]
Length=183

 Score =   258 bits (660),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+++ PVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLSTE L 
Sbjct  29   PFTGLKSSSASPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSTESLA  87

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP +++RI+GFDN RQVQCI FIAYKP
Sbjct  148  EEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  180



>sp|P24007.1|RBS_PYRPY RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Pyrus pyrifolia]
 dbj|BAA00450.1| RuBisCO small subunit [Pyrus pyrifolia var. culta]
Length=183

 Score =   258 bits (660),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS+++FPVT+KS  D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS+E L 
Sbjct  29   PFNGLKSSSAFPVTRKSN-DITSIASNGGRVQCMQVWPPLGLKKFETLSYLPPLSSESLA  87

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP +++RI+GFDN RQVQCI FIAYKP
Sbjct  148  EEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKP  180



>sp|Q08186.1|RBS6_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 6, 
chloroplastic; Short=RuBisCO small subunit 6; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03698.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=186

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+KS+ D +++ +NG +VQCMQVWPP G KKFETLSYLPPLS E LL
Sbjct  29   PFTGLKSVSAFPVTRKSSNDLSTVPSNGGKVQCMQVWPPLGKKKFETLSYLPPLSEESLL  88

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  89   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  148

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQC+ FIAYKP
Sbjct  149  EEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP  181



>sp|O22077.1|RBS_FAGCR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Fagus crenata]
 dbj|BAA23214.1| small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase 
[Fagus crenata]
Length=182

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTA+FP T+KS  D TS+++NG RVQCM+VWPP GL+KFETLSYLPPLS E L 
Sbjct  27   PFTGLKSTAAFPATRKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSIESLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            KQ+EYL+ KGW+PCLEFE E  FVYRE + SPGYYDGRYW MWKLPMFGCTDATQV+AEL
Sbjct  87   KQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDDK  528
            +E  K YP + +RI+GFDNKRQVQCI FIAYKP  K
Sbjct  147  QEASKTYPTSHIRIIGFDNKRQVQCISFIAYKPPAK  182



>gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVTKKS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  24   PFTGLKSVSAFPVTKKSN-DITSIASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  83   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  175



>ref|XP_010265138.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=182

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF+GLKS  +FPVT+K+  D +S+ +NG RVQCMQVWPP G KKFETLSYLPPLS E L 
Sbjct  27   PFSGLKSAXAFPVTRKANNDISSLPSNGGRVQCMQVWPPLGKKKFETLSYLPPLSPESLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL  GW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+AEL
Sbjct  87   KEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLAEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDNKRQVQCI FIAYKP
Sbjct  147  EEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKP  179



>gb|KCW52065.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=180

 Score =   257 bits (656),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 134/153 (88%), Gaps = 2/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YLL  GWVPCLEFETE GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  86   KEIDYLLRSGWVPCLEFETE-GFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKKAYP A+VRI+GFDNKRQVQCI FIA+KP
Sbjct  145  EECKKAYPTAFVRIIGFDNKRQVQCISFIAFKP  177



>sp|P16032.2|RBS1_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03693.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 prf||1802403A RuBisCO:SUBUNIT=small
Length=182

 Score =   257 bits (656),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A+FPVTKK+  D TS++TNG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  26   PFNGLKSVAAFPVTKKNN-DITSVATNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  85   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  145  EEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  177



>gb|ABK96567.1| unknown [Populus trichocarpa x Populus deltoides]
Length=181

 Score =   256 bits (655),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKST++FPVT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+TEQL 
Sbjct  26   PFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTTEQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            +++EYLL   WVPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL
Sbjct  86   REIEYLLRNKWVPCLEFELEKGWVYREHHQSPGYYDGRYWTMWKLPMFGCTEASQVLIEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP ++VRI+GFDN RQVQCI FIA KP
Sbjct  146  EEAKKAYPNSFVRIIGFDNTRQVQCISFIASKP  178



>ref|XP_009774104.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana sylvestris]
Length=181

 Score =   256 bits (655),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  SFPV++K     TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  26   PFTGLKSATSFPVSRKQNLYITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  86   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  146  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  179



>ref|XP_010036887.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW48548.1| hypothetical protein EUGRSUZ_K02223 [Eucalyptus grandis]
Length=181

 Score =   256 bits (654),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+KSA D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E+LL
Sbjct  27   PFTGLKSASAFPVTRKSA-DITSLASNGGRVQCMQVWPPIGKKKFETLSYLPPLSREELL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K++EYLL   WVPCLEFE EKGFVYR+ H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  86   KEIEYLLRMNWVPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCTDPLQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E  K YP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  146  DEAIKTYPNAFVRIIGFDNKRQVQCISFIAYKP  178



>gb|AFK40375.1| unknown [Medicago truncatula]
Length=180

 Score =   256 bits (654),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL+
Sbjct  25   PFTGLKSSAAFPVTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTEEQLV  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG TD++QV+ EL
Sbjct  85   KEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             E K AYP +++RI+GFDN RQVQCI FIA+ P
Sbjct  145  AEAKAAYPESFIRIIGFDNVRQVQCISFIAHTP  177



>sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=180

 Score =   256 bits (654),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVTKKS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  24   PFTGLKSVSAFPVTKKSN-DITSIASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  83   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A+ RI+GFDN RQVQCI FIAYKP
Sbjct  143  EEAKKAYPEAFTRIIGFDNVRQVQCISFIAYKP  175



>ref|XP_006383456.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95904.1| unknown [Populus trichocarpa]
 gb|ABK96181.1| unknown [Populus trichocarpa]
 gb|ERP61253.1| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=181

 Score =   256 bits (653),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKST++FPVT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+TEQL 
Sbjct  26   PFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTTEQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            +++EYLL   WVPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL
Sbjct  86   QEIEYLLRNKWVPCLEFELEKGWVYREHHQSPGYYDGRYWTMWKLPMFGCTEASQVLIEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP +++RI+GFDN RQVQCI FIA KP
Sbjct  146  EEAKKAYPNSFIRIIGFDNTRQVQCISFIASKP  178



>gb|ABS72189.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
1A [Corchorus olitorius]
Length=183

 Score =   256 bits (653),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  25   PFTGLKSASAFPTTRKNNRDITSIASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL  GW+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  85   KEVDYLLRSGWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN+RQVQCI FIAYKP
Sbjct  145  EEAKKAYPDAFIRIIGFDNRRQVQCISFIAYKP  177



>gb|AAU14862.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Fagus sylvatica]
Length=181

 Score =   256 bits (653),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTA+FP T+KS  D TS+++NG RVQCM+VWPP GL+KFETLSYLPPLS E L 
Sbjct  27   PFTGLKSTAAFPATQKSNNDITSLASNGGRVQCMKVWPPLGLQKFETLSYLPPLSLESLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            KQ+EYL+ KGW+PCLEFE E  FVYRE + SPGYYDGRYW MWKLPMFGCTDATQV+AEL
Sbjct  87   KQIEYLILKGWIPCLEFELEHPFVYRENNRSPGYYDGRYWVMWKLPMFGCTDATQVLAEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E  K YP + +RI+GFDNKRQVQCI FIAYKP
Sbjct  147  QEASKTYPTSHIRIIGFDNKRQVQCISFIAYKP  179



>dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Panax ginseng]
Length=183

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTA+FPVT+K   D TS+ +NG RVQCM+VWPP GLKKFETLSYLP L+ EQL 
Sbjct  27   PFTGLKSTAAFPVTRK-VNDITSLPSNGGRVQCMKVWPPLGLKKFETLSYLPQLTQEQLS  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL  GWVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+
Sbjct  86   KEVDYLLRSGWVPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSSQVLKEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIA+KP
Sbjct  146  EECKKEYPNAYIRIIGFDNVRQVQCISFIAFKP  178



>ref|XP_003618736.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|ACJ84141.1| unknown [Medicago truncatula]
 gb|AES74954.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=180

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  25   PFTGLKSSAAFPVTKKTNNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPPLTEEQLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG TD++QV+ EL
Sbjct  85   KEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             E K AYP +++RI+GFDN RQVQCI FIA+ P
Sbjct  145  AEAKAAYPESFIRIIGFDNVRQVQCISFIAHTP  177



>dbj|BAI53119.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Eucalyptus globulus]
Length=181

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+KSA D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E+LL
Sbjct  27   PFTGLKSASAFPVTRKSA-DITSLASNGGRVQCMQVWPPIGKKKFETLSYLPPLSREELL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K++EYLL   WVPCLEFE EKGFVYR+ H SPGYYDGRYWTMWKLPMFGCTD  QV  EL
Sbjct  86   KEIEYLLRMNWVPCLEFELEKGFVYRDNHKSPGYYDGRYWTMWKLPMFGCTDPLQVFKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E  K YP A+VRI+GFDNKRQVQCI FIAYKP
Sbjct  146  DEAIKTYPNAFVRIIGFDNKRQVQCISFIAYKP  178



>sp|Q42516.1|RBS1_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37438.1|AF150665_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
 emb|CAA60636.1| ribulose 1,5-bisphosphate carboxylase-oxygenase [Amaranthus hypochondriacus]
Length=183

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A+FP+TKKS+ DF+S+ +NG RVQCMQVWPP G KKFETLSYLPPLS  QLL
Sbjct  27   PFNGLKSFATFPITKKSSNDFSSLPSNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLL  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             QV+YLLNKGW+PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD  QV+ E+
Sbjct  87   AQVQYLLNKGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEV  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDNKRQVQC+ FIAYKP
Sbjct  147  EEAKKAYPSAFIRIIGFDNKRQVQCVSFIAYKP  179



>ref|XP_009602965.1| PREDICTED: ribulose bisphosphate carboxylase small chain S41, 
chloroplastic-like [Nicotiana tomentosiformis]
Length=179

 Score =   254 bits (650),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 132/154 (86%), Gaps = 2/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS  QLL
Sbjct  26   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLS--QLL  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  84   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP AW+RI+GFDN RQVQCI FIAYKP+
Sbjct  144  EEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPE  177



>gb|AAA33035.1| ribulose-1-5-bisphosphate carboxylase [Mesembryanthemum crystallinum]
Length=182

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A+FPVTKK+  D TS++TNG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  26   PFNGLKSVAAFPVTKKNN-DITSVATNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  85   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             E KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  145  REAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  177



>sp|Q9XGX5.1|RBS2_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37439.1|AF150666_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=184

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS ASFPVT+KS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS  QLL
Sbjct  29   PFNGLKSIASFPVTRKSN-DITSIASNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLL  87

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             QV+YLLNKGW+PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD  QV+ E+
Sbjct  88   AQVQYLLNKGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEV  147

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDD  525
            EE KKAYP A++RI+GFDNKRQVQC+ FIAYKP D
Sbjct  148  EEAKKAYPTAFIRIIGFDNKRQVQCVSFIAYKPAD  182



>ref|XP_010669829.1| PREDICTED: ribulose bisphosphate carboxylase small chain 6, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=183

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FPVTK S+ D +S+ +NG RVQCMQVWPP G KKFETLSYLPPL+TE LL
Sbjct  29   PFTGLKSIAAFPVTK-SSNDLSSLPSNGGRVQCMQVWPPLGKKKFETLSYLPPLTTEALL  87

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +V+YLLNKGW+PCLEFE + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD  QVV EL
Sbjct  88   GEVQYLLNKGWIPCLEFEVKDGFVYREHNNSPGYYDGRYWTMWKLPMFGCTDPAQVVNEL  147

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP A+VRI+GFD  RQVQCI FIAYKP+
Sbjct  148  EEVKKAYPQAFVRIIGFDKNRQVQCISFIAYKPE  181



>gb|AIR75141.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   254 bits (648),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 1/149 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP G+KK+ETLSYLPPL+TE LL
Sbjct  18   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPIGMKKYETLSYLPPLTTESLL  76

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +V+YLLNKGW+PCLEFETE GFVYRE   +PGYYDGRYWTMWKLPMFGCTD  QVV EL
Sbjct  77   AEVQYLLNKGWIPCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPAQVVNEL  136

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFI  507
            +ECKKAYP A++RI+GFDNKRQVQCI FI
Sbjct  137  DECKKAYPNAFIRIIGFDNKRQVQCISFI  165



>sp|Q08184.1|RBS4_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA33038.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
 gb|AAA03696.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G+KKFETLSYLPPLS E LL
Sbjct  27   PFNGLKSISAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGMKKFETLSYLPPLSEESLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  86   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQC+ FIAYKP
Sbjct  146  EEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP  178



>ref|XP_004299075.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=180

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS ++FPVT+K A D T++++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  26   PFNGLKSASAFPVTRK-ANDITTLASNGGRVQCMQVWPPVGLKKFETLSYLPPLSVESLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTDA+QV+AEL
Sbjct  85   KEVEYLLRNKWVPCLEFELEHGFVYREHGNSPGYYDGRYWTMWKLPMFGCTDASQVIAEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KK YP A++RI+GFDN RQVQC+ FIAYKP
Sbjct  145  EEAKKTYPEAFIRIIGFDNIRQVQCVSFIAYKP  177



>ref|XP_011021244.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Populus euphratica]
Length=181

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKST++FPVT+K+  D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+TEQL 
Sbjct  26   PFNGLKSTSAFPVTRKANNDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTTEQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YLL   WVPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT A+QV+ EL
Sbjct  86   KEIDYLLRMKWVPCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMFGCTQASQVLIEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP +++RI+GFDN RQVQCI FIA KP
Sbjct  146  EEAKKAYPNSFIRIIGFDNVRQVQCISFIASKP  178



>ref|XP_002532149.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30223.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=185

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++FPVT+K+  D T+++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  27   PFTGLKSTSAFPVTRKTNTDITTLANNGGRVQCMQVWPPLGKKKFETLSYLPDLTREQLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGWVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGC+DA QV+ EL
Sbjct  87   KEVEYLLRKGWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCSDAVQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E  KAYP ++VRI+GFDN RQVQCI FIAYKP
Sbjct  147  DEAIKAYPNSFVRIIGFDNVRQVQCISFIAYKP  179



>ref|XP_010263795.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Nelumbo nucifera]
Length=184

 Score =   253 bits (647),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 133/155 (86%), Gaps = 2/155 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSIS--TNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQ  234
            PFTGLKS ++FPVT+K+  D TS+   +NG RVQCMQVWPP G KKFETLSYLPPLS E 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLPLPSNGGRVQCMQVWPPTGKKKFETLSYLPPLSPES  86

Query  235  LLKQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVA  414
            L K+V+YLL  GW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+A
Sbjct  87   LAKEVDYLLRMGWIPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDSSQVLA  146

Query  415  ELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            ELEE KKAYP A++RI+GFDNKRQVQCI FIAYKP
Sbjct  147  ELEEAKKAYPNAFIRIIGFDNKRQVQCISFIAYKP  181



>gb|AEJ33935.1| chloroplast putative ribulose-1,5-bisphosphate carboxylase/oxygenase 
small subunit [Wolffia australiana]
Length=177

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GL+S+A+ P T+K+ AD +++ +NG + +CMQVWPP GLKKFETLSYLPPLSTE L 
Sbjct  25   PFNGLRSSAALPATRKANADLSTLLSNGGKARCMQVWPPEGLKKFETLSYLPPLSTEALA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+  GW+PC+EF  E GFVYRE+HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+
Sbjct  85   KEVEYLIRNGWIPCIEFSKE-GFVYREYHASPGYYDGRYWTMWKLPMFGCTDASQVIAEV  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP  +VRI+GFDNKRQVQC+ FIAYKP
Sbjct  144  EEAKKAYPDYFVRIIGFDNKRQVQCVSFIAYKP  176



>ref|XP_006482254.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=182

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+++FP TKK+  D TSI++NG RVQCM+VWPP GLKKFETLSYLPPLS E LL
Sbjct  27   PFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALL  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K++ YLL  GW+PCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPM+GCTDATQV+ E+
Sbjct  87   KEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEV  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             E +K YP ++VRI+GFDNKRQVQCI F+A KP
Sbjct  147  GEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP  179



>ref|XP_003618735.1| Ribulose bisphosphate carboxylase small chain [Medicago truncatula]
 gb|AES74953.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=177

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ +QL 
Sbjct  22   PFTGLKSSAGFPVTKKTNNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTEDQLA  81

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWVPCLEFE EKGFVYRE H+SPGYYDGRYWTMWKLP+FG TD++QV+ EL
Sbjct  82   KEVEYLIRKGWVPCLEFELEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDSSQVLKEL  141

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             E K AYP +++RI+GFDN RQVQCI FIA+ P
Sbjct  142  AEAKAAYPESFIRIIGFDNVRQVQCISFIAHTP  174



>emb|CAD11990.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
 emb|CAD11991.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Coffea arabica]
Length=181

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP GLKK+ETLSYLP L+ EQLL
Sbjct  27   PFNGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPRGLKKYETLSYLPDLTDEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YL+  GWVPCLEFE EKGFVYRE+H SPGYYDGRYWTMWKLPM+GCTDATQV+ E+
Sbjct  86   KEIDYLIRSGWVPCLEFELEKGFVYREYHRSPGYYDGRYWTMWKLPMYGCTDATQVLNEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             EC K YP  WVRI+GFDN RQVQCI FIA KP
Sbjct  146  GECLKEYPNCWVRIIGFDNVRQVQCISFIAAKP  178



>ref|XP_006430779.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
 gb|ESR44019.1| hypothetical protein CICLE_v10012893mg [Citrus clementina]
Length=182

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+++FP TKK+  D TSI++NG RVQCM+VWPP GLKKFETLSYLPPLS E LL
Sbjct  27   PFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALL  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K++ YL+  GW+PCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPM+GCTDATQV+ E+
Sbjct  87   KEISYLIRSGWIPCLEFELEKGWVYREHHRSPGYYDGRYWTMWKLPMYGCTDATQVLKEV  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             E +K YP ++VRI+GFDNKRQVQCI FIA KP
Sbjct  147  GEVQKEYPHSFVRIIGFDNKRQVQCISFIAAKP  179



>gb|AAA33037.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  27   PFNGLKSVSAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLI  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  86   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  146  EEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  178



>sp|Q08183.1|RBS3_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03695.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Mesembryanthemum crystallinum]
Length=183

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPLS E L+
Sbjct  27   PFNGLKSVSAFPVTRKNN-DITSVASNGGRVQCMQVWPPLGKKKFETLSYLPPLSEESLM  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  86   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  146  EEAKKAYPEAFIRIIGFDNVRQVQCISFIAYKP  178



>sp|O65194.1|RBS_MEDSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Medicago sativa]
 gb|AAC13293.1| ribulose-1,5-bisphosphate carboxylase small subunit [Medicago 
sativa]
Length=180

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A FPVTKK+  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  25   PFTGLKSSAGFPVTKKTNNDITSIASNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGW+PCLEFE EKGFVYRE H SPGYYDGRYWTMW+LP+FG TD++QV+ EL
Sbjct  85   KEVEYLIRKGWIPCLEFELEKGFVYRENHRSPGYYDGRYWTMWRLPLFGATDSSQVLKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDD  525
             +CK  YP +++RI+GFDN RQVQCI FIA+ P +
Sbjct  145  ADCKAEYPDSFIRIIGFDNVRQVQCISFIAHTPKN  179



>gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Aralia elata]
Length=183

 Score =   251 bits (642),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTA+FPVT+K   D TS+ +NG RVQCM+VWPP GLKKFETLSYLPPL+ E+L 
Sbjct  27   PFTGLKSTAAFPVTRK-VNDITSLPSNGGRVQCMKVWPPLGLKKFETLSYLPPLTNEELA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL  GWVPCLEFE E G+VYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+
Sbjct  86   KEVDYLLRSGWVPCLEFELEHGWVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLNEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIA+KP
Sbjct  146  EECKKEYPNAFIRIIGFDNVRQVQCISFIAFKP  178



>ref|XP_008446602.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Cucumis melo]
Length=185

 Score =   251 bits (642),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FPVT+K+  D T++++NG RVQCM+VWPP GLKKFETLSYLP +S EQL 
Sbjct  27   PFTGLKSAAAFPVTRKNN-DITTLASNGGRVQCMKVWPPLGLKKFETLSYLPDMSNEQLG  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL KGW+PC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QVV E+
Sbjct  86   KEVDYLLRKGWIPCIEFDIHSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVVNEI  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KK YP A++R++GFDN RQVQCI FIAYKP
Sbjct  146  EEAKKEYPDAYIRVIGFDNVRQVQCISFIAYKP  178



>ref|XP_002531624.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF30752.1| Ribulose bisphosphate carboxylase small chain, chloroplast precursor, 
putative [Ricinus communis]
Length=180

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS++ FPVT+K   D T++++NG +V CMQVWPP G KKFETLSYLPPLS E L 
Sbjct  25   PFTGLKSSSVFPVTRKQNNDITTLASNGGKVHCMQVWPPVGKKKFETLSYLPPLSEESLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL  GWVPCLEFE E GFVYRE H SPGYYDGR WTMWKLPMFGCTD++QV+ EL
Sbjct  85   KEVDYLLRMGWVPCLEFELEHGFVYRENHRSPGYYDGRCWTMWKLPMFGCTDSSQVLKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EE KKAYP +++RI+GFDNKRQVQCI FIAYKP 
Sbjct  145  EEAKKAYPNSFIRIIGFDNKRQVQCISFIAYKPS  178



>sp|Q9XGX4.1|RBS3_AMAHP RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Amaranthus hypochondriacus]
 gb|AAD37440.1|AF150667_1 ribulose 1,5 bisphosphate carboxylase small subunit precursor 
[Amaranthus hypochondriacus]
Length=180

 Score =   251 bits (641),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS ASFPVT+KS  D TSI++NG RVQCMQVWPP G KKFETLSYLPPLS  QLL
Sbjct  26   PFNGLKSIASFPVTRKSN-DITSIASNGGRVQCMQVWPPVGKKKFETLSYLPPLSDAQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             QV+YLLN GW+PC+EFE E  FVYRE H SPGY DGRYWTMWKLPM+GCTD  QV+ E+
Sbjct  85   AQVQYLLNNGWIPCIEFELEHPFVYRENHRSPGYQDGRYWTMWKLPMYGCTDPAQVLNEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDNKRQVQC+ FIA+KP
Sbjct  145  EEAKKAYPSAFIRIIGFDNKRQVQCVSFIAFKP  177



>gb|AIR75140.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Blitum nuttallianum]
Length=165

 Score =   251 bits (640),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQ WPP G+KK+ETLSYLPPL+TE LL
Sbjct  18   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQAWPPIGMKKYETLSYLPPLTTESLL  76

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +V+YLLNKGW+PCLEFETE GFVYRE   +PGYYDGRYWTMWKLPMFGC D  QVV EL
Sbjct  77   AEVQYLLNKGWIPCLEFETEHGFVYREHGNTPGYYDGRYWTMWKLPMFGCIDPAQVVNEL  136

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFI  507
            +ECKKAYP A++RI+GFDNKRQVQCI FI
Sbjct  137  DECKKAYPNAFIRIIGFDNKRQVQCISFI  165



>sp|P18960.1|RBS_SILPR RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Silene latifolia subsp. alba]
 gb|AAB39037.1| ribulose bisphosphate carboxylase precursor [Silene latifolia 
subsp. alba]
Length=177

 Score =   251 bits (641),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF+GLKST++FPV++KS  D TS++TNG RV CMQVWPP  LKKFETLSYLP LS E LL
Sbjct  24   PFSGLKSTSAFPVSRKSNVDITSLATNGGRVNCMQVWPPRNLKKFETLSYLPTLSEESLL  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K++ YLL KGWVPCLEFE     VYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV AE+
Sbjct  84   KEINYLLIKGWVPCLEFEVGPAHVYRENNKSPGYYDGRYWTMWKLPMFGCTDASQVAAEV  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
             ECK AYP A VRI+GFDNKRQVQCI FIAYKP+
Sbjct  144  VECKNAYPDAHVRIIGFDNKRQVQCISFIAYKPE  177



>sp|P08705.1|RBS_HELAN RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Helianthus annuus]
 emb|CAA68490.1| ribulose bisphosphate carboxylase [Helianthus annuus]
 emb|CAA28737.1| RuBisCO (SSU) [Helianthus annuus]
Length=178

 Score =   251 bits (640),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FP TKK A DF+++ +NG RVQCM+VWPP GLKK+ETLSYLPPL+  QL 
Sbjct  24   PFTGLKSNAAFPTTKK-ANDFSTLPSNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  83   KEVDYLLRKKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
             ECKK YP AW+RI+GFDN RQVQCIMFIA +PD
Sbjct  143  AECKKEYPQAWIRIIGFDNVRQVQCIMFIASRPD  176



>gb|AIR75142.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Chenopodium album]
Length=164

 Score =   250 bits (639),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKST +FPVTKK+  D TS+++NG RVQCMQVWPP G KKFETLSYLPPL+TE LL
Sbjct  17   PFNGLKSTVAFPVTKKND-DITSLASNGGRVQCMQVWPPVGKKKFETLSYLPPLTTESLL  75

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +V+YLLNKGWVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD TQVV EL
Sbjct  76   SEVQYLLNKGWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDPTQVVNEL  135

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFI  507
            EE KKAYP A++RI+GFD+ RQVQCI FI
Sbjct  136  EEAKKAYPNAFIRIIGFDSFRQVQCISFI  164



>ref|XP_002305162.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
 gb|ABK95372.1| unknown [Populus trichocarpa]
 gb|ABK95841.1| unknown [Populus trichocarpa]
 gb|EEE85673.2| Ribulose bisphosphate carboxylase small chain 1A family protein 
[Populus trichocarpa]
Length=182

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L 
Sbjct  27   PFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YLL   WVPCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL
Sbjct  87   KEIDYLLRSKWVPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLLEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQCI FIA KP
Sbjct  147  EEAKKAYPNAFIRIIGFDNTRQVQCISFIAAKP  179



>gb|ABK95229.1| unknown [Populus trichocarpa]
 gb|ABK95250.1| unknown [Populus trichocarpa]
Length=182

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L 
Sbjct  27   PFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YLL   WVPCLEFE EKG+VYRE H+SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL
Sbjct  87   KEIDYLLRSKWVPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLLEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQCI FIA KP
Sbjct  147  EEAKKAYPNAFIRIIGFDNTRQVQCISFIAAKP  179



>ref|XP_008244506.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
isoform X1 [Prunus mume]
Length=182

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FP TKK+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSASAFPGTKKTN-DITSIASNGGRVQCMKVWPTVGLKKFETLSYLPPLSPESLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  87   KEVDYLLRKNWVPCLEFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKA P +++RI+GFDN RQVQCI FIAYKP
Sbjct  147  EEAKKANPNSFIRIIGFDNVRQVQCISFIAYKP  179



>gb|ABK15574.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia sinensis]
Length=176

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++FPVT+K   D TS+++NG RVQCM+VWPP GLKKFETLSYLPPL+  QL 
Sbjct  21   PFTGLKSTSAFPVTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFETLSYLPPLTQAQLG  80

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YL+  GW+PCLEF  + GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ E+
Sbjct  81   KEVDYLIRLGWIPCLEFSVQGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEV  140

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP +++RI+GFDNKRQVQCI FI YKP
Sbjct  141  EECKKEYPQSFIRIIGFDNKRQVQCISFICYKP  173



>gb|AAO25119.1| ribulose-1,5-bisphosphate carboxylase small subunit [Chrysanthemum 
x morifolium]
Length=179

 Score =   249 bits (636),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  +FPVTKKS  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPL+  QL 
Sbjct  25   PFTGLKSNVAFPVTKKSN-DFSSLPSNGGRVQCMKVWPPLGLKKYETLSYLPPLTETQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL   WVPCLEFE E GF YRE + SPGYYDGRYWTMWKLPMFGC DA+QV+ EL
Sbjct  84   KEVEYLLRNKWVPCLEFELEHGFPYRENNRSPGYYDGRYWTMWKLPMFGCNDASQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
             ECKK YP +WVRI+GFDN RQVQCI FIA+KPD
Sbjct  144  NECKKEYPQSWVRIIGFDNVRQVQCISFIAHKPD  177



>gb|AGV08375.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Arachis hypogaea]
Length=182

 Score =   249 bits (636),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FPVT+K+  D TS++ NG RVQCMQVWPP G KKFETLSYLP L+ EQL 
Sbjct  27   PFTGLKSLAGFPVTRKANNDITSVANNGGRVQCMQVWPPVGKKKFETLSYLPDLTDEQLR  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL KGWVPCLEFE   GF YRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRKGWVPCLEFEVGYGFPYRENHRSPGYYDGRYWTMWKLPMFGCTDSGQVIKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP A+VRI+GFDN RQVQCI FIAYKP
Sbjct  147  QEAKAAYPKAFVRIIGFDNVRQVQCISFIAYKP  179



>ref|XP_007215051.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
 gb|EMJ16250.1| hypothetical protein PRUPE_ppa012123mg [Prunus persica]
Length=183

 Score =   249 bits (636),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FP  KK+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPPLS E L 
Sbjct  29   PFTGLKSASAFPGAKKTN-DITSIASNGGRVQCMKVWPTVGLKKFETLSYLPPLSPESLA  87

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVPCLEFE EKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  88   KEVDYLLRKNWVPCLEFELEKGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  147

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKA P +++RI+GFDN RQVQCI FIAYKP
Sbjct  148  EEAKKANPNSFIRIIGFDNVRQVQCISFIAYKP  180



>sp|Q43832.1|RBS2_SPIOL RecName: Full=Ribulose bisphosphate carboxylase small chain 2, 
chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA66201.1| ribulose-bisphosphate carboxylase [Spinacia oleracea]
Length=180

 Score =   249 bits (635),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  26   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  85   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFD+ RQVQC+ FIAYKP
Sbjct  145  EECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKP  177



>gb|AAB81105.1| ribulose 1,5-bisphosphate carboxylase small subunit [Spinacia 
oleracea]
Length=180

 Score =   249 bits (635),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 130/153 (85%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  26   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  85   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFD+ RQVQC+ FIAYKP
Sbjct  145  EECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKP  177



>sp|P19311.1|RBS5_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5A, 
chloroplastic; Short=RuBisCO small subunit SSU5A; Flags: 
Precursor [Lemna gibba]
 emb|CAA35099.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   248 bits (634),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GL+S+ +FP T+K+  D +++ +NG RV CMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  25   PFNGLRSSVAFPATRKANNDLSTLPSNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+
Sbjct  85   KEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEV  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP  +VRI+GFDNKRQVQCI FIAYKP
Sbjct  144  EEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>sp|P19312.1|RBS6_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU5B, 
chloroplastic; Short=RuBisCO small subunit SSU5B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35100.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   248 bits (633),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GL+S+ +FP T+K+  D +++ +NG RV CMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  25   PFNGLRSSVAFPATRKANNDLSTLPSNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+
Sbjct  85   KEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEV  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP  +VRI+GFDNKRQVQCI FIAYKP
Sbjct  144  EEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>gb|ABK96431.1| unknown [Populus trichocarpa x Populus deltoides]
Length=182

 Score =   248 bits (633),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKSTA+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+ E+L 
Sbjct  27   PFNGLKSTAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEEELA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YLL   WVPCLEFE EKG+V+RE H+SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL
Sbjct  87   KEIDYLLRSKWVPCLEFELEKGWVHREHHSSPGYYDGRYWTMWKLPMFGCTEASQVLVEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             E KKAYP A++RI+GFDN RQVQCI FIA KP
Sbjct  147  GEAKKAYPNAFIRIIGFDNTRQVQCISFIAAKP  179



>ref|XP_004135094.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004164158.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Cucumis sativus]
 gb|KGN52085.1| hypothetical protein Csa_5G609710 [Cucumis sativus]
Length=185

 Score =   248 bits (633),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A FP+T+K+  D T++++NG +VQCM+VWPP GL+KFETLSYLP +S EQL 
Sbjct  27   PFTGLKSSAGFPITRKNNVDITTLASNGGKVQCMKVWPPLGLRKFETLSYLPDMSNEQLS  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+ +YLL  GWVPC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+
Sbjct  87   KECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVIQEI  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KK YP A++R++GFDN RQVQCI FIAYKP
Sbjct  147  EEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP  179



>emb|CCF55356.1| ribulose-1,5-bisphosphate carboxylase small subunit [Cucumis 
sativus]
Length=185

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A FP+T+K+  D T++++NG +VQCM+VWPP GL+KFETLSYLP +S EQL 
Sbjct  27   PFTGLKSSAGFPITRKNNVDITTLASNGGKVQCMKVWPPLGLRKFETLSYLPDMSNEQLS  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+ +YLL  GWVPC+EF+   GFVYRE H SPGYYDGRYWTMWKLPMFGCTD++QV+ E+
Sbjct  87   KECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVIQEI  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KK YP A++R++GFDN RQVQCI FIAYKP
Sbjct  147  EEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP  179



>sp|P17673.1|RBS_TRIRP RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Trifolium repens]
 emb|CAA36542.1| ribulose bisphosphate carboxylase [Trifolium repens]
Length=178

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A FPVTKK+  D TSI++NGSRV CMQVWPP G KKFETLSYLPPL+ EQLL
Sbjct  24   PFTGLKSSAGFPVTKKNN-DITSITSNGSRVNCMQVWPPVGKKKFETLSYLPPLTDEQLL  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGWVPC+EFE EKGFV+R++++SPGYYDGRYWTMW+LP+FG TDA QV+ E+
Sbjct  83   KEVEYLLRKGWVPCVEFELEKGFVHRQYNSSPGYYDGRYWTMWRLPLFGTTDAAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             ECK  YP A++RI+GFDN RQVQCI FIA  P
Sbjct  143  AECKAEYPEAFIRIIGFDNVRQVQCISFIASTP  175



>ref|XP_011035062.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic 
[Populus euphratica]
Length=181

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A+FPV+ + A D TSI++NG RVQCMQVWPP GLKKFETLSYLP L+  +L 
Sbjct  26   PFNGLKSAAAFPVSTRKANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPDLTEAELA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YLL   WVPCLEFE EKG+VYRE H SPGYYDGRYWTMWKLPMFGCT+A+QV+ EL
Sbjct  86   KEIDYLLRSKWVPCLEFELEKGWVYRENHRSPGYYDGRYWTMWKLPMFGCTEASQVLVEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E KKAYP A++RI+GFDN RQVQCI FIA KP
Sbjct  146  QEAKKAYPNAFIRIIGFDNVRQVQCISFIAAKP  178



>emb|CAA32701.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_003600302.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E   AYP A+VRI+GFDN RQVQCI FIA+ PD
Sbjct  146  DEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPD  179



>sp|Q40250.1|RBS_LACSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Lactuca sativa]
 dbj|BAA03103.1| riburose-1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Lactuca sativa]
Length=181

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  +FPVTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPLS E L 
Sbjct  25   PFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALS  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YL+   W+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+
Sbjct  85   KEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             ECKK YP A++R++GFDN RQVQCI FI  KP
Sbjct  145  GECKKEYPNAFIRVIGFDNIRQVQCISFIVAKP  177



>sp|Q08185.1|RBS5_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Mesembryanthemum crystallinum]
 gb|AAA03697.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial [Mesembryanthemum crystallinum]
Length=182

 Score =   247 bits (631),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 131/153 (86%), Gaps = 2/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS ++FPVT+K+  D TS+++NG RVQCM VWPP G+KKFETLSYLPPLS E LL
Sbjct  27   PFNGLKSISAFPVTRKNN-DITSVASNGGRVQCM-VWPPLGMKKFETLSYLPPLSEESLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLLN GWVPCLEFE   GFVYRE   +PGYYDGRYWTMWKLPMFGCTD +QVVAEL
Sbjct  85   KEVQYLLNNGWVPCLEFEPTHGFVYREHGNTPGYYDGRYWTMWKLPMFGCTDPSQVVAEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP A++RI+GFDN RQVQC+ FIAYKP
Sbjct  145  EEAKKAYPEAFIRIIGFDNVRQVQCVSFIAYKP  177



>ref|NP_198658.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
 sp|P10797.2|RBS2B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 2B, 
chloroplastic; Short=RuBisCO small subunit 2B; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB09354.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL24421.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32515.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32536.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAL32621.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAM13287.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAN72105.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO00914.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AAO29974.1| ribulose bisphosphate carboxylase small chain 2b precursor (RuBisCO 
small subunit 2b) [Arabidopsis thaliana]
 gb|AED94314.1| ribulose bisphosphate carboxylase small chain 2B [Arabidopsis 
thaliana]
Length=181

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AIB04188.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Camellia oleifera]
Length=176

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++FPVT+K   D TS+++NG RVQCM+VWPP GLKKFETLSYLPPL+  QL 
Sbjct  21   PFTGLKSTSAFPVTRKLDTDITSLASNGGRVQCMKVWPPLGLKKFETLSYLPPLTQVQLG  80

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YL+  GW+PCLEF    GFVYRE + SPGYYDGRYWTMWKLPMFGCTD++QV+ E+
Sbjct  81   KEVDYLIRLGWIPCLEFSVVGGFVYREHNKSPGYYDGRYWTMWKLPMFGCTDSSQVLKEV  140

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDNKRQVQCI FIA KP
Sbjct  141  EECKKEYPQAFIRIIGFDNKRQVQCISFIACKP  173



>gb|KEH21538.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E   AYP A+VRI+GFDN RQVQCI FIA+ PD
Sbjct  146  DEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPD  179



>ref|XP_003637843.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   247 bits (630),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E   AYP A+VRI+GFDN RQVQCI FIA+ PD
Sbjct  146  DEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPD  179



>ref|XP_003636970.1| Ribulose bisphosphate carboxylase small chain 3A [Medicago truncatula]
Length=181

 Score =   247 bits (630),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E   AYP A+VRI+GFDN RQVQCI FIA+ PD
Sbjct  146  DEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPD  179



>gb|AIF75285.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75286.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
 gb|AIF75287.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
Length=163

 Score =   246 bits (627),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  11   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  70

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  131  EECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>emb|CAA10290.1| ribulose 1,5-bisphosphate carboxylase small subunit [Cicer arietinum]
Length=181

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A FPV +K   D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQLL
Sbjct  27   PFVGLKSMAGFPV-RKVNNDITSIASNGGRVHCMQVWPPIGKKKFETLSYLPPLTEEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWKLP+FGCT+A QV+ EL
Sbjct  86   KEVEYLLRKGWVPCLEFELEKGFVYREHNNSPGYYDGRYWTMWKLPLFGCTEAVQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDD  525
            +E  KAYP A+VRI+GFDN RQVQCI FIA+ P +
Sbjct  146  QEVVKAYPNAFVRIIGFDNVRQVQCISFIAHTPKE  180



>gb|AAG24884.1|AF303941_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS3 [Glycine 
max]
Length=178

 Score =   246 bits (628),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>ref|NP_198657.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 sp|P10798.2|RBS3B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 3B, 
chloroplastic; Short=RuBisCO small subunit 3B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK25834.1|AF360124_1 putative ribulose bisphosphate carboxylase small chain 3b precursor 
[Arabidopsis thaliana]
 gb|AAK95300.1|AF410314_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAL58912.1|AF462822_1 At5g38410/F1O19.10 [Arabidopsis thaliana]
 dbj|BAB09353.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAK93702.1| putative RuBisCO small 3b subunit precursor [Arabidopsis thaliana]
 gb|AAK96743.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAL47390.1| ribulose bisphosphate carboxylase small chain 3b precursor (RuBisCO 
small subunit 3b) [Arabidopsis thaliana]
 gb|AAM19980.1| At5g38410/F1O19.10 [Arabidopsis thaliana]
 gb|AAN31863.1| putative ribulose bisphosphate carboxylase small chain 3b precursor 
(RuBisCO small subunit 3b) [Arabidopsis thaliana]
 gb|AED94311.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=181

 Score =   246 bits (628),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>emb|CAA32702.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
Length=181

 Score =   246 bits (628),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNKDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|NP_198659.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
 sp|P10796.1|RBS1B_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1B, 
chloroplastic; Short=RuBisCO small subunit 1B; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK95269.1|AF410283_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 emb|CAA32700.1| ribulose bisphosphate carboxylase [Arabidopsis thaliana]
 dbj|BAB09355.1| ribulose bisphosphate carboxylase small chain 1b precursor (RuBisCO 
small subunit 1b) [Arabidopsis thaliana]
 gb|AAN28753.1| At5g38430/F1O19.10 [Arabidopsis thaliana]
 gb|AED94315.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
thaliana]
Length=181

 Score =   246 bits (628),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+ASFPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|NP_001235314.1| uncharacterized protein LOC100500504 [Glycine max]
 gb|ACU15604.1| unknown [Glycine max]
 gb|KHN47663.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   246 bits (628),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>ref|NP_001241137.1| ribulose bisphosphate carboxylase small chain 1, chloroplastic-like 
[Glycine max]
 gb|AAG24882.1|AF303939_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS1 [Glycine 
max]
 gb|AAA81328.1| ribulose-1,5-bisphosphate carboxylase small subunit [Glycine 
max]
 gb|KHN07517.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
 gb|KHN07519.1| Ribulose bisphosphate carboxylase small chain 1, chloroplastic 
[Glycine soja]
Length=178

 Score =   246 bits (627),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>gb|AIF75353.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75354.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   244 bits (624),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPQAWIRIIGFDNVRQV  152



>ref|XP_006391132.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
 gb|ESQ28418.1| hypothetical protein EUTSA_v10019199mg [Eutrema salsugineum]
Length=182

 Score =   246 bits (627),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT K+  D TS+++NGS+V CMQVWPP G KKFETLSYLP LS   L 
Sbjct  27   PFTGLKSSAAFPVTHKTNFDITSLASNGSKVHCMQVWPPVGKKKFETLSYLPDLSEVSLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE + SPGYYDGRYWTMWKLP+FGCTD++QV+ E+
Sbjct  87   KEVDYLLRNKWIPCVEFELEHGFVYREHNKSPGYYDGRYWTMWKLPLFGCTDSSQVLKEV  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  147  EECKKEYPNAFIRIIGFDNSRQVQCISFIAYKP  179



>gb|ACJ85905.1| unknown [Medicago truncatula]
 gb|AFK33847.1| unknown [Medicago truncatula]
 gb|KEH21532.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   245 bits (626),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E   AYP A+VRI+GFDN RQVQCI FIA+ P+
Sbjct  146  DEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPE  179



>sp|Q42823.1|RBS_GLYTA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tabacina]
 gb|AAA82071.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tabacina]
Length=178

 Score =   245 bits (626),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FP T+K+  D  SI++NG RVQCMQVWP  G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDIASIASNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGW+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QEAKTAYPNAFIRIIGFDNVRQVQCISFIAYKP  175



>gb|AIF75357.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75358.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   244 bits (623),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP+G KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPYGKKKYETLSYLPDLSEEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             ++EYLL  GWVPCLEFETE+GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   SEIEYLLKNGWVPCLEFETERGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
             E KKAYP AW+RI+GFDN RQV
Sbjct  130  GEAKKAYPEAWIRIIGFDNVRQV  152



>gb|AIF75289.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75290.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  11   PFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  70

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  131  EECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>gb|KEH21531.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   245 bits (626),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E   AYP A+VRI+GFDN RQVQCI FIA+ P+
Sbjct  146  DEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPE  179



>gb|AIF75288.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  70

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  131  EECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>gb|AAF19793.1|AF162210_1 ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Lactuca sativa]
Length=181

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  +FPVTKK+  DF+S+ +NG RVQCM+VWPP GLKK+ETLSYLPPLS E L 
Sbjct  25   PFTGLKSNVAFPVTKKANNDFSSLPSNGGRVQCMKVWPPIGLKKYETLSYLPPLSDEALS  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YL+   WVPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ E+
Sbjct  85   KEIDYLIRNKWVPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEV  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             ECKK YP A++R++GFD+ RQVQCI FI  KP
Sbjct  145  GECKKEYPNAFIRVIGFDSVRQVQCISFIVSKP  177



>emb|CBY05833.1| Ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
 emb|CBY89197.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Coffea canephora]
Length=181

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP G  K ET SYLP L+ EQLL
Sbjct  27   PFTGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPTGKLKNETFSYLPDLTDEQLL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YL+  GW+PCLEFE EKG VYRE+H SPGYYDGRYWTMWKLPMFGCTDATQV+ E+
Sbjct  86   KEIDYLIRNGWIPCLEFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDATQVLKEV  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             EC K YP  WVRI+GFDN RQVQCI FIA KP
Sbjct  146  RECLKEYPNCWVRIIGFDNVRQVQCISFIAAKP  178



>sp|P19308.1|RBS2_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU26, 
chloroplastic; Short=RuBisCO small subunit SSU26; Flags: 
Precursor [Lemna gibba]
 emb|CAA35101.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GL+S+ +FP T+K+  + +++ +NG +V CMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  25   PFNGLRSSVAFPATRKANKNLSTLPSNGGKVSCMQVWPPEGLKKFETLSYLPPLSVEDLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+
Sbjct  85   KEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEV  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP  +VRI+GFDNKRQVQCI FIAYKP
Sbjct  144  EEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>gb|KEH21536.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   245 bits (625),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 129/154 (84%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E   AYP A+VRI+GFDN RQVQCI FIA+ P+
Sbjct  146  DEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTPE  179



>sp|P08474.1|RBS_CUCSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Cucumis sativus]
 gb|AAA33131.1| ribulose bisphosphate carboxylase/oxygenase precursor peptide 
[Cucumis sativus]
Length=189

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A FP+T+K+  D T++++N  +VQCM+VWPP GL+KFETLSYLP +S EQL 
Sbjct  27   PFTGLKSSAGFPITRKNNVDITTLASNAGKVQCMKVWPPLGLRKFETLSYLPDMSNEQLS  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+ +YLL  GWVPC+EF+   GFVYRE H SPG+YDGRYWTMWKLPMFGCTD++QV+ E+
Sbjct  87   KECDYLLRNGWVPCVEFDIGSGFVYRENHRSPGFYDGRYWTMWKLPMFGCTDSSQVIQEI  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KK YP A++R++GFDN RQVQCI FIAYKP
Sbjct  147  EEAKKEYPDAFIRVIGFDNVRQVQCISFIAYKP  179



>gb|KEH21530.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   245 bits (625),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A FPVTK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPVTKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E   AYP A+VRI+GFDN RQVQCI FIA+ P
Sbjct  146  DEVVVAYPNAFVRIIGFDNVRQVQCISFIAHTP  178



>gb|AIF75346.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75347.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
 gb|AIF75348.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ASFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAASFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   SEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AIF75359.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75360.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS +SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AEX60842.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41722.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41723.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41730.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41731.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41737.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41745.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41752.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41759.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG00063.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
 gb|KHG20485.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=179

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AFS41733.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
Length=179

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AEX60839.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41738.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41746.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41758.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75349.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75350.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   243 bits (621),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS +SFPVT+K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASSFPVTRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSQEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AFS41753.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75367.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75368.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   243 bits (620),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSVEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPQAWIRIIGFDNVRQV  152



>sp|P08135.1|RBS_RAPSA RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Raphanus sativus]
 emb|CAA29801.1| carboxylase [Raphanus sativus]
 prf||1405335A ribulose bisphosphate carboxylase S
Length=181

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A +RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKKEYPNALIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_006285820.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
 gb|EOA18718.1| hypothetical protein CARUB_v10007296mg [Capsella rubella]
Length=181

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_002888576.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64835.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
lyrata subsp. lyrata]
Length=180

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPVGKKKFETLSYLPDLTDSELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPEAFIRIIGFDNSRQVQCISFIAYKP  175



>ref|XP_010926041.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++FPVT++++ DF+ + +NG RV+CMQVWP  G KKFETLSYLPPLS E LL
Sbjct  26   PFTGLKSTSAFPVTRRASNDFSKLPSNGGRVRCMQVWPIEGKKKFETLSYLPPLSIEALL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            KQ+EYLL  GW+PCLEF  + GFVYRE H SPGYYDGRYWTMWKLPMFGC DA QV  EL
Sbjct  86   KQIEYLLRSGWIPCLEF-CKVGFVYRENHQSPGYYDGRYWTMWKLPMFGCNDAAQVAKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  145  DECKKEYPDVFIRIIGFDNVRQVQCISFIAYKP  177



>gb|KDP20120.1| hypothetical protein JCGZ_05889 [Jatropha curcas]
Length=181

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTA FP  +K+  D TSI++NG RVQCM+VWP  GLKKFETLSYLPPL+ EQL 
Sbjct  27   PFTGLKSTAGFPA-RKTTNDITSIASNGGRVQCMKVWPTQGLKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA QV+ EL
Sbjct  86   KEVEYLLRSGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDAVQVLNEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E  KA+P  +VRI+GFD+ RQVQCI FIAYKP
Sbjct  146  DEAIKAHPNGFVRIIGFDSYRQVQCISFIAYKP  178



>gb|AEX60841.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41728.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41735.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41743.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41750.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41757.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=182

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EECKK YP A++RI+GFDN RQVQCI FIAYKP+
Sbjct  147  EECKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE  180



>ref|XP_008339672.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSSSAFPVTRK-ANDITSIASNGGRVQCMQVWPPIGLKKFETLSYLPPLSPESLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCTD++QV+ E+
Sbjct  87   KEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCTDSSQVLKEV  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE K AYP +++RI+GFDN RQ QCI FIAY+P
Sbjct  147  EEAKTAYPNSFIRIIGFDNVRQTQCISFIAYQP  179



>ref|XP_009140170.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score =   244 bits (623),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD++QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI+FIAYKP
Sbjct  143  QECKTEYPNAFIRIIGFDNNRQVQCIIFIAYKP  175



>gb|AIF75295.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   243 bits (621),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  70

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  131  EECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  163



>gb|KEH21539.1| ribulose bisphosphate carboxylase small chain [Medicago truncatula]
Length=181

 Score =   244 bits (622),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS A FP+TK +  D TSI++NG RV CMQVWPP G KKFETLSYLPPL+ EQL 
Sbjct  27   PFVGLKSMAGFPITKVNK-DITSITSNGGRVNCMQVWPPIGKKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYL+ KGWV CLEFETEKGFVYRE H+SPGYYDGRYWTMWKLP+FG TDA+QV+ EL
Sbjct  86   KEVEYLIRKGWVACLEFETEKGFVYRENHSSPGYYDGRYWTMWKLPLFGATDASQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +E   AYP A+VRI+GFD  RQVQCI FIA+ PD
Sbjct  146  DEVVDAYPNAFVRIIGFDKVRQVQCISFIAHTPD  179



>gb|AIF75351.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75352.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   243 bits (619),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPQAWIRIIGFDNVRQV  152



>ref|XP_008352922.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Malus domestica]
Length=182

 Score =   244 bits (622),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSSSAFPVTRK-ANDITSIASNGGRVQCMQVWPPIGLKKFETLSYLPPLSPESLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCTD++QV+ E 
Sbjct  87   KEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCTDSSQVLKEX  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE K AYP +++RI+GFDN RQ QCI FIAY+P
Sbjct  147  EEAKTAYPNSFIRIIGFDNVRQTQCISFIAYQP  179



>sp|P07689.1|RBS3_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3A, 
chloroplastic; Short=RuBisCO small subunit 3A; Flags: Precursor 
[Pisum sativum]
 emb|CAA27864.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236A carboxylase,ribulose bisphosphate
Length=180

 Score =   244 bits (622),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS   FPV KK   D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLL
Sbjct  26   PFGGLKSMTGFPV-KKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWKLPMFG TDA+QV+ EL
Sbjct  85   KEVEYLLRKGWVPCLEFELEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDD  525
            +E   AYP A+VRI+GFDN RQVQCI FIA+ P+ 
Sbjct  145  DEVVAAYPQAFVRIIGFDNVRQVQCISFIAHTPES  179



>gb|AFS41744.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   244 bits (622),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  147  EECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>ref|XP_002868775.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45034.1| ribulose bisphosphate carboxylase small chain 1B [Arabidopsis 
lyrata subsp. lyrata]
Length=181

 Score =   244 bits (622),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSIS+NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSATFPVTRKANNDITSISSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|ACU13285.1| unknown [Glycine max]
Length=178

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVW P G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWAPVGKKKFETLSYLPDLDDAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>gb|AIF75321.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
Length=177

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD++QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEV  138

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI+FIAYKP
Sbjct  139  QECKTEYPNAFIRIIGFDNNRQVQCIIFIAYKP  171



>sp|P00865.1|RBS1_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 1, 
chloroplastic; Short=RuBisCO small subunit 1; Flags: Precursor 
[Glycine max]
 emb|CAA23736.1| rubpcase [Glycine max]
Length=178

 Score =   243 bits (621),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGW+PCLEFE E GFVYRE + SP YYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPXYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>ref|XP_010103758.1| hypothetical protein L484_014647 [Morus notabilis]
 gb|EXB97036.1| hypothetical protein L484_014647 [Morus notabilis]
Length=182

 Score =   243 bits (621),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF+GLKSTASFP+ +K+  D T++++NG RVQCMQVWPP G  KFETLSYLP L+ EQLL
Sbjct  28   PFSGLKSTASFPINQKTN-DITALASNGGRVQCMQVWPPRGKLKFETLSYLPDLTDEQLL  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YLL   W+PCLEFE  K  +YRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  87   KEIDYLLRSNWIPCLEFEVGKAHIYRENNRSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDDK  528
            +E KKAYP A VRI+GFDN RQVQCI FIAYKP  K
Sbjct  147  QETKKAYPDAHVRIIGFDNNRQVQCISFIAYKPPAK  182



>sp|P00869.1|RBS2_PEA RecName: Full=Ribulose bisphosphate carboxylase small chain 3C, 
chloroplastic; Short=RuBisCO small subunit 3C; AltName: Full=PSS15; 
Flags: Precursor [Pisum sativum]
 emb|CAA27865.1| ribulose 1.5-bisphosphate carboxylase (RBC) [Pisum sativum]
 emb|CAA25390.1| ribulose bisphosphate carboxylase [Pisum sativum]
 prf||1211236B carboxylase,ribulose bisphosphate
Length=180

 Score =   243 bits (621),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 128/155 (83%), Gaps = 1/155 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS   FPV KK   D TSI++NG RV+CMQVWPP G KKFETLSYLPPL+ +QLL
Sbjct  26   PFGGLKSMTGFPV-KKVNTDITSITSNGGRVKCMQVWPPIGKKKFETLSYLPPLTRDQLL  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGWVPCLEFE EKGFVYRE + SPGYYDGRYWTMWKLPMFG TDA+QV+ EL
Sbjct  85   KEVEYLLRKGWVPCLEFELEKGFVYREHNKSPGYYDGRYWTMWKLPMFGTTDASQVLKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPDD  525
            +E   AYP A+VRI+GFDN RQVQCI FIA+ P+ 
Sbjct  145  DEVVAAYPQAFVRIIGFDNVRQVQCISFIAHTPES  179



>sp|Q39746.1|RBS4_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67848.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=178

 Score =   243 bits (620),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FP TKK A DF+++ +NG RVQCM+VWPP G KK+ETLSYLP L+  QL 
Sbjct  24   PFTGLKSNAAFPATKK-ANDFSTLPSNGGRVQCMKVWPPLGKKKYETLSYLPNLTEAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  83   KEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  143  QECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  176



>gb|AFS41724.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB10449.1| hypothetical protein B456_001G201800 [Gossypium raimondii]
Length=182

 Score =   243 bits (621),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PCLEFE E+GFV+R++   P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EECKK YP A++RI+GFDN RQVQCI FIAYKP+
Sbjct  147  EECKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE  180



>ref|XP_006285696.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
 gb|EOA18594.1| hypothetical protein CARUB_v10007166mg [Capsella rubella]
Length=181

 Score =   243 bits (620),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF+GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFSGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_010440948.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   243 bits (620),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75364.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75366.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   242 bits (617),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAYSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPQAWIRIIGFDNVRQV  152



>gb|ADB85091.1| ribulose 1,5-bisphosphate carboxylase small subunit [Jatropha 
curcas]
Length=181

 Score =   243 bits (620),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKSTA FP  +K+  D TSI+ NG RVQCM+VWP  GLKKFETLSYLPPL+ EQL 
Sbjct  27   PFTGLKSTAGFPA-RKTTNDITSIAGNGGRVQCMKVWPTQGLKKFETLSYLPPLTREQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL  GWVPCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA QV+ EL
Sbjct  86   KEVEYLLRSGWVPCLEFELEHGFVYRENNRSPGYYDGRYWTMWKLPMFGCTDAVQVLNEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E  KA+P  +VRI+GFD+ RQVQCI FIAYKP
Sbjct  146  DEAIKAHPNGFVRIIGFDSYRQVQCISFIAYKP  178



>ref|NP_176880.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
 sp|P10795.2|RBS1A_ARATH RecName: Full=Ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic; Short=RuBisCO small subunit 1A; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG40363.1|AF325011_1 000C10C11 [Arabidopsis thaliana]
 gb|AAK95277.1|AF410291_1 F1O19.10/F1O19.10 [Arabidopsis thaliana]
 gb|AAD10655.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAK96772.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL06849.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24219.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAL24422.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32690.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL32789.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAL38277.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13379.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM13387.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAM19882.1| At1g67090/F1O19.10 [Arabidopsis thaliana]
 gb|AAN15681.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 gb|AAN72087.1| ribulose bisphosphate carboxylase, small subunit [Arabidopsis 
thaliana]
 dbj|BAE98610.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98685.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98695.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 dbj|BAE98874.1| ribulose bisphosphate carboxylase like protein, small subunit 
[Arabidopsis thaliana]
 gb|AEE34594.1| ribulose bisphosphate carboxylase small chain 1A [Arabidopsis 
thaliana]
Length=180

 Score =   243 bits (620),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YL+   W+PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AIF75355.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana sylvestris]
 gb|AIF75356.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   242 bits (617),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSATSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++V+YLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVDYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPQAWIRIIGFDNVRQV  152



>ref|XP_009356790.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Pyrus x bretschneideri]
Length=182

 Score =   243 bits (620),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K A D TSI++NG RVQCMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  28   PFTGLKSFSAFPVTRK-ANDITSIASNGGRVQCMQVWPPTGLKKFETLSYLPPLSPESLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL K WVP LEFE E+ FVYRE ++SPGYYDGRYWTMWKLP+FGCTD++QV+ EL
Sbjct  87   KEVDYLLRKNWVPTLEFELERPFVYREHNSSPGYYDGRYWTMWKLPLFGCTDSSQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE K AYP +++RI+GFDN RQ QCI FIAY+P
Sbjct  147  EEAKTAYPNSFIRIIGFDNVRQTQCISFIAYQP  179



>ref|NP_001235266.1| ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
 gb|AAG24883.1|AF303940_1 ribulose-1,5-bisphosphate carboxylase small subunit rbcS2 [Glycine 
max]
Length=178

 Score =   243 bits (619),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FP T+K+  D  SI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDTISIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>ref|XP_006284616.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
 gb|EOA17514.1| hypothetical protein CARUB_v10005847mg [Capsella rubella]
Length=181

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG +V CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGKVSCMKVWPPIGKKKFETLSYLPDLSDVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AFS41748.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=179

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPV +K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVIRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>emb|CDP20139.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   242 bits (617),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLK+ +SFP++KKS  D TS++TNG RVQCMQVWPP G  K ET SYLP L+ EQLL
Sbjct  4    PFTGLKAASSFPISKKSV-DITSLATNGGRVQCMQVWPPTGKLKNETFSYLPDLTDEQLL  62

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YL+  GW+PCLEFE EKG VYRE+H SPGYYDGRYWTMWKLPMFGCTDATQV+ E+
Sbjct  63   KEIDYLIRNGWIPCLEFELEKGHVYREYHRSPGYYDGRYWTMWKLPMFGCTDATQVLKEV  122

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
             EC K YP  WVRI+GFDN RQVQCI FIA KP
Sbjct  123  RECLKEYPNCWVRIIGFDNVRQVQCISFIAAKP  155



>ref|XP_010435745.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_010521010.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Tarenaya hassleriana]
Length=180

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FPVT+K+ AD TS+++NGS+V CMQVWP  GL+KFETLSYLP LS  +L 
Sbjct  25   PFTGLKSAAAFPVTRKNNADLTSLASNGSKVNCMQVWPTTGLRKFETLSYLPDLSDTELA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PCLEFE    FVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  85   KEVDYLLRNNWIPCLEFELGNAFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K  +P A +RI+GFDN RQVQCI FIAYKP
Sbjct  145  QEAKTTHPDAHIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_010435743.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X1 [Camelina sativa]
 ref|XP_010435744.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like isoform X2 [Camelina sativa]
Length=181

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AFS41732.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41740.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41761.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   243 bits (619),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75322.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD++QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSSQVLKEV  138

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  139  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|AAA82069.1| ribulose 1,5-bisphosphate carboxylase small subunit precursor 
[Glycine soja]
Length=178

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FP T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGW+PCLEFE E GFVYRE + SPGYYDGR WTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRCWTMWKLPMFGCTDASQVLKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>emb|CDY52468.1| BnaA04g27920D [Brassica napus]
Length=181

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75296.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75297.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   241 bits (616),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+ASFP T+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSASFPATRKANNDITSITSNGGRVNCMKVWPPVGKKKFETLSYLPDLTDSELA  70

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  131  EECKKEYPEAFIRIIGFDNNRQVQCISFIAYKP  163



>gb|AFS41754.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=179

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEDGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75283.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis thaliana]
 gb|AIF75284.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   241 bits (616),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELA  70

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YL+   W+PC+EFE E GFVYRE   SPGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  131  EECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  163



>ref|XP_010450911.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>sp|Q39749.1|RBS7_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 7, 
chloroplastic; Short=RuBisCO small subunit 7; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67851.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FPVTKK   DF+++++NG RVQCM+VWPP G K++ETLSYLP L+  QL 
Sbjct  19   PFTGLKSNAAFPVTKK-VNDFSTLASNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLA  77

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  78   KEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  137

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  138  QECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>gb|AFS41729.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41736.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41751.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
Length=182

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            E CKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  147  ENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>gb|AIF75323.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  138

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  139  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|AFS41727.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41734.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41742.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
Length=182

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            E CKK YP A++RI+GFDN RQVQCI FIAYKP+
Sbjct  147  ENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKPE  180



>ref|XP_010450912.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic [Camelina sativa]
Length=181

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AAF06098.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
 gb|AAF06101.1| ribulose 1,5-bisphosphate carboxylase small chain precursor [Manihot 
esculenta]
Length=184

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++FP T K++AD TS+++NG RVQCMQVWP  G KKFETLSYLPPLS EQL 
Sbjct  27   PFTGLKSTSAFPATTKTSADITSLASNGGRVQCMQVWPTRGKKKFETLSYLPPLSREQLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
             +++YLL  GW+PCLEFE E GFVYR   + PGYYDGRYWTMWKLPMFGCTD++QV+ EL
Sbjct  87   SEIDYLLRSGWIPCLEFELEHGFVYRAHGSLPGYYDGRYWTMWKLPMFGCTDSSQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E  KA+P  + RI+GFDN RQVQCI FIAYKP
Sbjct  147  DELIKAHPDGFARIIGFDNVRQVQCISFIAYKP  179



>ref|XP_010450913.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>sp|Q39745.1|RBS3_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 3, 
chloroplastic; Short=RuBisCO small subunit 3; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67847.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   241 bits (616),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FPVTKK   DF+++ +NG RVQCM+VWPP G K++ETLSYLP L+  QL 
Sbjct  19   PFTGLKSNAAFPVTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKRYETLSYLPNLTESQLA  77

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  78   KEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  137

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  138  QECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>ref|XP_009403968.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=181

 Score =   242 bits (617),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++FPVT+K+ AD + + +NG RVQCM+VWP  G KKFETLSYLP L  E LL
Sbjct  27   PFTGLKSTSAFPVTRKANADLSHLPSNGGRVQCMKVWPIEGKKKFETLSYLPTLVDEVLL  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            KQ+EYLL   W+PCLEF  E GFV+RE H SPGYYDGRYWTMWKLPMFGCTDATQV  EL
Sbjct  87   KQIEYLLRSKWIPCLEFSHE-GFVWRENHRSPGYYDGRYWTMWKLPMFGCTDATQVAKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EECKK YP A+VRI+GFDN RQVQCI FIA+KPD
Sbjct  146  EECKKEYPRAFVRIIGFDNNRQVQCISFIAHKPD  179



>ref|XP_010440945.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440946.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
 ref|XP_010440947.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Camelina sativa]
Length=181

 Score =   242 bits (617),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFNGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>sp|Q42822.1|RBS_GLYTO RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Glycine tomentella]
 gb|AAA82070.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit 
precursor [Glycine tomentella]
Length=178

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A FP T+K+  D  SI++NG RVQCMQVWP  G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGFP-TRKTNNDIASIASNGGRVQCMQVWPTTGKKKFETLSYLPDLDDAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGW+PCLEFE E GFVYRE H SPGYYDGRYWTMWKLP+FGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPVFGCTDASQVLKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>gb|AFS41725.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium raimondii]
 gb|KJB43047.1| hypothetical protein B456_007G181300 [Gossypium raimondii]
 gb|KJB43048.1| hypothetical protein B456_007G181400 [Gossypium raimondii]
Length=179

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E+GFV+R++   P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSNLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AIF75361.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tomentosiformis]
 gb|AIF75362.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   241 bits (614),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS + FPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPQAWIRIIGFDNVRQV  152



>gb|AIF75363.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   241 bits (614),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS + FPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSASFFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTMWKLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPRAWIRIIGFDNVRQV  152



>gb|KHG18747.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYL  L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLTDLTPVQLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKKAYP A++RI+GFDN RQVQCI FIAYKP
Sbjct  147  EECKKAYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>sp|P31333.2|RBS_GOSHI RecName: Full=Ribulose bisphosphate carboxylase small chain, 
chloroplastic; Short=RuBisCO small subunit; Flags: Precursor 
[Gossypium hirsutum]
 emb|CAA38026.1| ribulose bisphosphate carboxylase [Gossypium hirsutum]
 gb|AEX60834.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41721.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium arboreum]
 gb|AFS41726.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41741.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41749.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium mustelinum]
 gb|AFS41755.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
 gb|KHG14838.1| Ribulose bisphosphate carboxylase small chain, chloroplastic 
[Gossypium arboreum]
Length=182

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  27   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  87   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLEEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            E CKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  147  ENCKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  179



>gb|AIF75340.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75341.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+KS  D TSI+ NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  138

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  139  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|ACO35888.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
[Ageratina adenophora]
Length=178

 Score =   241 bits (616),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FP TKK A DF+++  NG RVQCM+VWPP GLKK+ETLSYLP L+  QL 
Sbjct  24   PFTGLKSNAAFPATKK-ANDFSTLPNNGGRVQCMKVWPPLGLKKYETLSYLPTLTETQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGR+WTMWKLPMFGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWVPCLEFELEHGFVYREHARSPGYYDGRHWTMWKLPMFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
             ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  143  GECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  176



>gb|AIF75291.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
 gb|AIF75293.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis arenosa]
Length=163

 Score =   241 bits (614),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  70

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  131  QECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  163



>ref|XP_008807113.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Phoenix dactylifera]
Length=180

 Score =   241 bits (616),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 127/153 (83%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++FP T++++ DF+ + +NG RVQCM+VWP  G+KKFETLSYLPPL  E LL
Sbjct  26   PFTGLKSTSAFPATRRASNDFSKLPSNGGRVQCMKVWPIEGVKKFETLSYLPPLPIEALL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            KQ+EYLL   W+PCLEF  + GFVYRE H SPGYYDGRYWTMWKLPMFGC DA QV  EL
Sbjct  86   KQIEYLLRSRWIPCLEF-CKIGFVYRENHRSPGYYDGRYWTMWKLPMFGCNDAAQVAKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  145  EECKKEYPDAFIRIIGFDNVRQVQCISFIAYKP  177



>ref|XP_002868776.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45035.1| ribulose bisphosphate carboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   241 bits (616),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF+GLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFSGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75344.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75345.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   241 bits (615),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKTDTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELS  78

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  138

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  139  QECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|ACQ90230.1| virus-resistance protein [Brassica rapa subsp. chinensis]
Length=249

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+KS  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  91   PFTGLKSSAAFPVTRKSNTDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  150

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  151  KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  210

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  211  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  243



>gb|AIF75294.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   240 bits (613),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  70

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  131  QECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  163



>ref|NP_001119331.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
 gb|AED94313.1| ribulose bisphosphate carboxylase small chain 3B [Arabidopsis 
thaliana]
Length=186

 Score =   241 bits (615),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 130/158 (82%), Gaps = 5/158 (3%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP LS  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNKDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLSDVELA  82

Query  241  KQVEYLLNKGWVPCLEFE-----TEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQ  405
            K+V+YLL   W+PC+EFE     T+ GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ Q
Sbjct  83   KEVDYLLRNKWIPCVEFELEVINTKHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQ  142

Query  406  VVAELEECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            V+ E+EECKK YPGA++RI+GFDN RQVQCI FIAYKP
Sbjct  143  VLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKP  180



>sp|P12468.1|RBS4_SOYBN RecName: Full=Ribulose bisphosphate carboxylase small chain 4, 
chloroplastic; Short=RuBisCO small subunit 4; Flags: Precursor 
[Glycine max]
 gb|AAA34008.1| ribulose 1,5-bisphosphate carboxylase [Glycine max]
 prf||1306410A ribulose bisphosphate carboxylase S
Length=178

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A  P T+K+  D TSI++NG RVQCMQVWPP G KKFETLSYLP L   QL 
Sbjct  24   PFTGLKSMAGLP-TRKTNNDITSIASNGGRVQCMQVWPPVGKKKFETLSYLPDLDDAQLA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL KGW+PCLEFE E GFVYRE + S GYYDGRYWTMWKLPMFGCTDA+QV+ EL
Sbjct  83   KEVEYLLRKGWIPCLEFELEHGFVYREHNRSLGYYDGRYWTMWKLPMFGCTDASQVLKEL  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E K AYP  ++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKP  175



>sp|P19310.1|RBS4_LEMGI RecName: Full=Ribulose bisphosphate carboxylase small chain SSU40B, 
chloroplastic; Short=RuBisCO small subunit SSU40B; Flags: 
Precursor [Lemna gibba]
 emb|CAA35103.1| ribulose bisphosphate carboxylase [Lemna gibba]
Length=177

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF   +S+  FP T+K+  D +++ +NG RV CMQVWPP GLKKFETLSYLPPLS E L 
Sbjct  25   PFNACRSSVPFPATRKANNDLSTLPSNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLA  84

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPC+EF  E GFVYRE HASPGYYDGRYWTMWKLPMFGCTDA+QV+AE+
Sbjct  85   KEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEV  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EE KKAYP  +VRI+GFDNKRQVQCI FIAYKP
Sbjct  144  EEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP  176



>gb|KDP29409.1| hypothetical protein JCGZ_18330 [Jatropha curcas]
Length=153

 Score =   240 bits (612),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++F VT+K+  D TSIS+ G RVQCMQVWPP G K FETLSYLPPLS +QL 
Sbjct  4    PFTGLKSTSAFSVTRKNNTDITSISSKGGRVQCMQVWPPVGKKFFETLSYLPPLSQDQLA  63

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V YLL    VPCLEFE E GFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  64   KEVHYLLRMDRVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  123

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIA  510
            EE K AYP +++RI+GFDNKRQVQCI FIA
Sbjct  124  EEAKTAYPNSFIRIIGFDNKRQVQCISFIA  153



>ref|XP_007033270.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 2 [Theobroma cacao]
 gb|EOY04196.1| Ribulose bisphosphate carboxylase (small chain) family protein 
isoform 2 [Theobroma cacao]
Length=184

 Score =   241 bits (615),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++ PV +K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+ E+L 
Sbjct  27   PFTGLKSTSALPVARKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTRERLF  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+VEYLL   WVPCLEFE E GFVYRE    PGYYDGR W MWKLPMFGCTDA+QV+ EL
Sbjct  87   KEVEYLLRNKWVPCLEFELEHGFVYRENLRIPGYYDGRCWIMWKLPMFGCTDASQVLKEL  146

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +E KK YP A++RI+GFDN+RQVQCI FIAYKP
Sbjct  147  DEAKKTYPTAFIRIIGFDNRRQVQCISFIAYKP  179



>ref|XP_006391472.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
 gb|ESQ28758.1| hypothetical protein EUTSA_v10019202mg [Eutrema salsugineum]
Length=181

 Score =   241 bits (615),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVNCMQVWPPIGKKKFETLSYLPDLTEVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E  FV+RE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELENAFVHREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKKEYPQAFIRIIGFDNTRQVQCISFIAYKP  175



>sp|Q39747.1|RBS5_FLAPR RecName: Full=Ribulose bisphosphate carboxylase small chain 5, 
chloroplastic; Short=RuBisCO small subunit 5; Flags: Precursor 
[Flaveria pringlei]
 gb|AAB67849.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
protein [Flaveria pringlei]
Length=173

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS A+FPVTKK   DF+++ +NG RVQCM+VWPP G K++ETLSYLP L+  QL 
Sbjct  19   PFTGLKSNAAFPVTKK-VNDFSTLPSNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLA  77

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E GFVYRE   SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  78   KEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKEL  137

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            +ECKK YP AW+RI+GFDN RQVQCI FIA KPD
Sbjct  138  QECKKEYPQAWIRIIGFDNVRQVQCISFIASKPD  171



>emb|CDX99682.1| BnaC04g34390D [Brassica napus]
Length=189

 Score =   241 bits (615),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+KS  D TSI+ NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKSNTDITSIANNGGRVSCMKVWPPVGKKKFETLSYLPDLTDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_006405770.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
 gb|ESQ47223.1| hypothetical protein EUTSA_v10027955mg [Eutrema salsugineum]
Length=181

 Score =   241 bits (614),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVSCMKVWPPIGKKKFETLSYLPDLTEVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFV+RE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELENGFVHREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKKEYPQAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|ABA46901.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit [Musa acuminata AAA Group]
Length=181

 Score =   241 bits (614),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 127/154 (82%), Gaps = 1/154 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++FPVT+K+ AD + + +NG RVQCM+VWP  G KKFETLSYLP L  E LL
Sbjct  27   PFTGLKSTSAFPVTRKANADLSHLPSNGGRVQCMKVWPIEGKKKFETLSYLPTLVDEVLL  86

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            KQ+EYLL   W+PCLEF  E GFV+RE H SPGYYDGRYWTMWKLPMFGCTDATQV  EL
Sbjct  87   KQIEYLLRSKWIPCLEFSHE-GFVWRENHRSPGYYDGRYWTMWKLPMFGCTDATQVAKEL  145

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKPD  522
            EECKK YP A+V I+GFDN RQVQCI FIA+KPD
Sbjct  146  EECKKEYPRAFVGIIGFDNNRQVQCISFIAHKPD  179



>gb|AEX60843.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium hirsutum]
 gb|AFS41739.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium barbadense]
 gb|AFS41747.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium tomentosum]
 gb|AFS41760.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
(chloroplast) [Gossypium darwinii]
Length=179

 Score =   241 bits (614),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPV +K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  24   PFTGLKSASAFPVIRKANNDITSLASNGGRVQCMQVWPPTGKKKFETLSYLPDLTPVQLA  83

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   WVPCLEFE E+GFV+R++ + P YYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  84   KEVDYLLRSKWVPCLEFELEEGFVHRKYSSLPTYYDGRYWTMWKLPMFGCTDSAQVLKEL  143

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  144  EECKKEYPNAFIRIIGFDNVRQVQCISFIAYKP  176



>gb|AIR75139.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia turkestanica]
Length=165

 Score =   240 bits (613),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNEL  136

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFI  507
            EECKK YP A++RI+GFD+ RQVQC+ FI
Sbjct  137  EECKKEYPNAFIRIIGFDSNRQVQCVSFI  165



>emb|CDY67657.1| BnaCnng55860D [Brassica napus]
Length=181

 Score =   241 bits (614),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TS+++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTDTDITSMASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELS  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>emb|CDX67402.1| BnaA07g14420D [Brassica napus]
Length=181

 Score =   241 bits (614),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIL82451.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   240 bits (612),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNEL  136

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFI  507
            EECKK YP A++RI+GFD+ RQVQC+ FI
Sbjct  137  EECKKEYPNAFIRIIGFDSNRQVQCVSFI  165



>gb|AIR75136.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
 gb|AIR75137.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Spinacia oleracea]
Length=165

 Score =   240 bits (612),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST  FP TKK+  D TS+++NG RVQCM+VWP   +K++ETLSYLPPL+T+QL 
Sbjct  18   PFTGLKSTVGFPATKKND-DITSLASNGGRVQCMKVWPTQNMKRYETLSYLPPLTTDQLA  76

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            +QV+YLLN  WVPCLEFET+ GFVYRE H SPGYYDGRYWTMWKLPMFGCTD  QV+ EL
Sbjct  77   RQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDPAQVLNEL  136

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFI  507
            EECKK YP A++RI+GFD+ RQVQC+ FI
Sbjct  137  EECKKEYPNAFIRIIGFDSNRQVQCVSFI  165



>ref|XP_010916368.1| PREDICTED: ribulose bisphosphate carboxylase small chain, chloroplastic-like 
[Elaeis guineensis]
Length=180

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKST++FP T++++  F+ + +NG RVQCM+VWP  GLKKFETLSYLPPLS E LL
Sbjct  26   PFTGLKSTSAFPATRRASNGFSKLPSNGGRVQCMKVWPIEGLKKFETLSYLPPLSIEALL  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            KQ+EYLL  GW+PCLEF  + GFV R+ + SPGYYDGRYWTMWKLPMFGC DATQV  EL
Sbjct  86   KQIEYLLRSGWIPCLEF-CKVGFVSRDNNRSPGYYDGRYWTMWKLPMFGCNDATQVAKEL  144

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  145  EECKKEYPDAFIRIIGFDNVRQVQCISFIAYKP  177



>gb|AIF75324.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica rapa]
 gb|AIF75325.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELA  78

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  138

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  139  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|AIF75342.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica oleracea]
 gb|AIF75343.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Brassica napus]
Length=177

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TS+++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  19   PFTGLKSSAAFPVTRKTDTDITSMASNGGRVNCMKVWPPVGKKKFETLSYLPDLTDVELS  78

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  79   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  138

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  139  QECKKEYPNAFIRIIGFDNNRQVQCISFIAYKP  171



>gb|AAG40356.1|AF325004_1 At1g67090 [Arabidopsis thaliana]
Length=180

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PF GLKS+A+FP T+K+  D TSI++NG RV CMQVWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWPPIGKKKFETLSYLPDLTDSELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YL+   W+PC+EFE E GFVYRE   SP YYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLIRNKWIPCVEFELEHGFVYREHGNSPRYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPNAFIRIIGFDNTRQVQCISFIAYKP  175



>gb|AFS41770.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit, 
partial (chloroplast) [Gossypium gossypioides]
Length=168

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+K+  D TS+++NG RVQCMQVWPP G KKFETLSYLP L+  QL 
Sbjct  19   PFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQVWPPLGKKKFETLSYLPDLTPVQLA  78

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PCLEFE E+GFV+R++ + PGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  79   KEVDYLLRSKWIPCLEFELEEGFVHRKYSSLPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  138

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIA  510
            EECKK YP A++RI+GFDN RQVQCI FIA
Sbjct  139  EECKKEYPNAFIRIIGFDNVRQVQCISFIA  168



>ref|XP_010511625.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic [Camelina sativa]
 ref|XP_010415258.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic [Camelina sativa]
 ref|XP_010470602.1| PREDICTED: ribulose bisphosphate carboxylase small chain 1A, 
chloroplastic isoform X1 [Camelina sativa]
Length=181

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FP T+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPATRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLTESELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YL+   W+PC+EFE E GFV+RE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLIRNKWIPCVEFELENGFVHREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            EECKK YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  EECKKEYPEAFIRIIGFDNTRQVQCISFIAYKP  175



>ref|XP_009139778.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic isoform X1 [Brassica rapa]
 sp|P27985.1|RBS2_BRANA RecName: Full=Ribulose bisphosphate carboxylase small chain F1, 
chloroplastic; Short=RuBisCO small subunit F1; Flags: Precursor 
[Brassica napus]
 emb|CAA39402.1| ribulose bisphosphate carboxylase /oxygenase small subunit [Brassica 
napus]
 emb|CDY71122.1| BnaAnng36210D [Brassica napus]
Length=181

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTEVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>ref|XP_009125072.1| PREDICTED: ribulose bisphosphate carboxylase small chain F1, 
chloroplastic-like [Brassica rapa]
Length=181

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP ++  +L 
Sbjct  23   PFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWPPVGKKKFETLSYLPDVTDVELA  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75292.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Arabidopsis suecica]
Length=163

 Score =   239 bits (609),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSIS+NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  11   PFTGLKSSAAFPVTRKANNDITSISSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELA  70

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE   +PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  71   KEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  130

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECKK YP A++RI+ FDN RQVQCI FIAYKP
Sbjct  131  QECKKEYPNAFIRIIRFDNNRQVQCISFIAYKP  163



>gb|KCW52064.1| hypothetical protein EUGRSUZ_J01502 [Eucalyptus grandis]
Length=192

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 1/140 (1%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS ++FPVT+KS  D TS+ +NG RVQCMQVWPP GLKKFETLSYLPPL+  QL 
Sbjct  27   PFTGLKSASAFPVTRKSN-DITSLPSNGGRVQCMQVWPPVGLKKFETLSYLPPLTPTQLA  85

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+++YLL  GWVPCLEFETEKGFVYRE H SPGYYDGRYWTMWKLPMFGCTD+ QV+ EL
Sbjct  86   KEIDYLLRSGWVPCLEFETEKGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVLKEL  145

Query  421  EECKKAYPGAWVRILGFDNK  480
            EECKKAYP A+VRI+GFDN 
Sbjct  146  EECKKAYPTAFVRIIGFDNN  165



>gb|ABB51649.1| chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit precursor [Brassica napus]
Length=181

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS+A+FPVT+K+  D TSI++NG RV CM+VWPP G KKFETLSYLP L+  +L 
Sbjct  23   PFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWPPVGKKKFETLSYLPDLTEVELG  82

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            K+V+YLL   W+PC+EFE E GFVYRE  ++PGYYDGRYWTMWKLP+FGCTD+ QV+ E+
Sbjct  83   KEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGRYWTMWKLPLFGCTDSAQVLKEV  142

Query  421  EECKKAYPGAWVRILGFDNKRQVQCIMFIAYKP  519
            +ECK  YP A++RI+GFDN RQVQCI FIAYKP
Sbjct  143  QECKTEYPNAFIRIIGFDNNRQVQCISFIAYKP  175



>gb|AIF75365.1| chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small 
subunit, partial [Nicotiana tabacum]
Length=152

 Score =   238 bits (608),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +1

Query  61   PFTGLKSTASFPVTKKSAADFTSISTNGSRVQCMQVWPPFGLKKFETLSYLPPLSTEQLL  240
            PFTGLKS  SFPV++K   D TSI++NG RVQCMQVWPP   KK+ETLSYLP LS EQLL
Sbjct  10   PFTGLKSAYSFPVSRKQNLDITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLL  69

Query  241  KQVEYLLNKGWVPCLEFETEKGFVYREWHASPGYYDGRYWTMWKLPMFGCTDATQVVAEL  420
            ++VEYLL  GWVPCLEFETE GFVYRE + SPGYYDGRYWTM KLPMFGCTDATQV+AE+
Sbjct  70   REVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMRKLPMFGCTDATQVLAEV  129

Query  421  EECKKAYPGAWVRILGFDNKRQV  489
            EE KKAYP AW+RI+GFDN RQV
Sbjct  130  EEAKKAYPQAWIRIIGFDNVRQV  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250