BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN039M15

Length=494
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796861.1|  PREDICTED: uncharacterized protein LOC104243376    109   8e-27   Nicotiana sylvestris
ref|XP_009617401.1|  PREDICTED: uncharacterized protein LOC104109751    107   1e-25   Nicotiana tomentosiformis
ref|XP_002528742.1|  conserved hypothetical protein                     103   2e-24   Ricinus communis
ref|NP_001239944.1|  uncharacterized protein LOC100792377               103   3e-24   Glycine max [soybeans]
emb|CDP15409.1|  unnamed protein product                                103   3e-24   Coffea canephora [robusta coffee]
ref|XP_008787843.1|  PREDICTED: uncharacterized protein LOC103705767    102   6e-24   
ref|XP_003535631.2|  PREDICTED: uncharacterized protein LOC100815684    102   7e-24   Glycine max [soybeans]
gb|ACU19002.1|  unknown                                                 100   1e-23   Glycine max [soybeans]
ref|XP_007145301.1|  hypothetical protein PHAVU_007G227500g             100   2e-23   Phaseolus vulgaris [French bean]
ref|XP_006341142.1|  PREDICTED: uncharacterized protein LOC102585102  98.2    2e-22   
gb|KHN14999.1|  hypothetical protein glysoja_037126                   98.6    2e-22   Glycine soja [wild soybean]
ref|XP_010036690.1|  PREDICTED: uncharacterized protein LOC104425646  98.2    3e-22   Eucalyptus grandis [rose gum]
ref|XP_010558990.1|  PREDICTED: uncharacterized protein LOC104827509  97.8    4e-22   Tarenaya hassleriana [spider flower]
ref|XP_007027734.1|  Uncharacterized protein TCM_022582               97.8    4e-22   
gb|KDO70391.1|  hypothetical protein CISIN_1g042384mg                 95.1    5e-22   Citrus sinensis [apfelsine]
emb|CAN69280.1|  hypothetical protein VITISV_023275                   97.4    6e-22   Vitis vinifera
ref|XP_010661366.1|  PREDICTED: uncharacterized protein LOC104881801  97.4    6e-22   Vitis vinifera
ref|XP_007202690.1|  hypothetical protein PRUPE_ppa012609mg           97.1    6e-22   
ref|XP_004246546.1|  PREDICTED: uncharacterized protein LOC101264052  96.3    1e-21   
gb|KHN02226.1|  hypothetical protein glysoja_002250                   97.1    1e-21   Glycine soja [wild soybean]
ref|XP_007162900.1|  hypothetical protein PHAVU_001G189900g           97.1    1e-21   Phaseolus vulgaris [French bean]
ref|XP_010912295.1|  PREDICTED: uncharacterized protein LOC105038249  95.9    1e-21   Elaeis guineensis
ref|XP_008241235.1|  PREDICTED: uncharacterized protein LOC103339680  95.9    2e-21   Prunus mume [ume]
ref|XP_011466764.1|  PREDICTED: uncharacterized protein LOC105352154  95.1    4e-21   Fragaria vesca subsp. vesca
ref|XP_006481780.1|  PREDICTED: uncharacterized protein LOC102625741  95.5    5e-21   Citrus sinensis [apfelsine]
ref|XP_006430209.1|  hypothetical protein CICLE_v10012842mg           95.5    5e-21   Citrus clementina [clementine]
gb|KDP42745.1|  hypothetical protein JCGZ_23685                       95.9    7e-21   Jatropha curcas
ref|XP_008784230.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    8e-21   
ref|XP_008389780.1|  PREDICTED: uncharacterized protein LOC103452045  94.0    8e-21   Malus domestica [apple tree]
ref|XP_003625814.1|  hypothetical protein MTR_7g104540                94.7    8e-21   
ref|XP_003554435.1|  PREDICTED: uncharacterized protein LOC100793...  94.7    9e-21   
ref|XP_006604637.1|  PREDICTED: uncharacterized protein LOC100793...  94.7    9e-21   
ref|XP_004494175.1|  PREDICTED: uncharacterized protein LOC101508...  94.7    1e-20   Cicer arietinum [garbanzo]
gb|AFK44733.1|  unknown                                               93.6    1e-20   Lotus japonicus
ref|XP_010426895.1|  PREDICTED: uncharacterized protein LOC104711823  93.6    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010507412.1|  PREDICTED: uncharacterized protein LOC104784033  93.2    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009336972.1|  PREDICTED: uncharacterized protein LOC103929487  93.2    1e-20   Pyrus x bretschneideri [bai li]
ref|NP_001242227.1|  uncharacterized protein LOC100779351             94.4    1e-20   
ref|XP_006293211.1|  hypothetical protein CARUB_v10019532mg           93.2    1e-20   Capsella rubella
ref|XP_006576219.1|  PREDICTED: uncharacterized protein LOC100779...  94.4    1e-20   Glycine max [soybeans]
ref|XP_006604638.1|  PREDICTED: uncharacterized protein LOC100793...  94.4    1e-20   
ref|XP_010515747.1|  PREDICTED: uncharacterized protein LOC104791529  92.8    2e-20   Camelina sativa [gold-of-pleasure]
gb|KCW74171.1|  hypothetical protein EUGRSUZ_E02817                   93.6    2e-20   Eucalyptus grandis [rose gum]
ref|XP_010507411.1|  PREDICTED: uncharacterized protein LOC104784032  90.5    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006576217.1|  PREDICTED: uncharacterized protein LOC100779...  93.2    5e-20   Glycine max [soybeans]
ref|XP_009374766.1|  PREDICTED: uncharacterized protein LOC103963656  92.0    5e-20   Pyrus x bretschneideri [bai li]
gb|KHN18769.1|  hypothetical protein glysoja_021520                   92.8    5e-20   Glycine soja [wild soybean]
ref|XP_010527628.1|  PREDICTED: uncharacterized protein LOC104804934  92.4    5e-20   Tarenaya hassleriana [spider flower]
emb|CAN80332.1|  hypothetical protein VITISV_018276                   92.4    6e-20   Vitis vinifera
gb|EYU35484.1|  hypothetical protein MIMGU_mgv1a024452mg              90.9    7e-20   Erythranthe guttata [common monkey flower]
ref|XP_009366670.1|  PREDICTED: uncharacterized protein LOC103956416  91.7    7e-20   
ref|XP_010101569.1|  hypothetical protein L484_015393                 91.7    8e-20   
ref|NP_566972.1|  uncharacterized protein                             90.9    9e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006576215.1|  PREDICTED: uncharacterized protein LOC100779...  92.4    1e-19   
ref|XP_010271656.1|  PREDICTED: uncharacterized protein LOC104607675  91.3    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_006576216.1|  PREDICTED: uncharacterized protein LOC100779...  92.0    1e-19   Glycine max [soybeans]
ref|XP_002877881.1|  hypothetical protein ARALYDRAFT_485645           90.1    2e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_006403775.1|  hypothetical protein EUTSA_v10010806mg           89.0    5e-19   Eutrema salsugineum [saltwater cress]
emb|CAH67161.1|  H0717B12.8                                           89.0    1e-18   Oryza sativa [red rice]
gb|EAY94030.1|  hypothetical protein OsI_15808                        88.6    2e-18   Oryza sativa Indica Group [Indian rice]
gb|KJB16115.1|  hypothetical protein B456_002G240200                  87.0    2e-18   Gossypium raimondii
gb|KFK34522.1|  hypothetical protein AALP_AA5G156800                  86.7    3e-18   Arabis alpina [alpine rockcress]
gb|EYU38632.1|  hypothetical protein MIMGU_mgv1a026837mg              87.0    3e-18   Erythranthe guttata [common monkey flower]
ref|XP_011077929.1|  PREDICTED: proline-rich transmembrane protei...  87.4    3e-18   Sesamum indicum [beniseed]
ref|XP_009379801.1|  PREDICTED: uncharacterized protein LOC103968354  86.3    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010654082.1|  PREDICTED: uncharacterized protein LOC104880149  87.4    5e-18   
gb|KEH42025.1|  hypothetical protein MTR_1g059990                     84.7    9e-18   Medicago truncatula
ref|XP_010244926.1|  PREDICTED: uncharacterized protein LOC104588614  85.9    1e-17   Nelumbo nucifera [Indian lotus]
ref|XP_009115970.1|  PREDICTED: uncharacterized protein LOC103841203  84.7    2e-17   Brassica rapa
emb|CDX78120.1|  BnaA09g33150D                                        84.7    2e-17   
emb|CDX73609.1|  BnaC08g23940D                                        84.7    2e-17   
gb|KJB62152.1|  hypothetical protein B456_009G403000                  85.1    2e-17   Gossypium raimondii
ref|XP_008442840.1|  PREDICTED: uncharacterized protein LOC103486607  84.7    2e-17   Cucumis melo [Oriental melon]
ref|XP_004494053.1|  PREDICTED: uncharacterized protein LOC101497497  84.0    3e-17   
gb|KJB55629.1|  hypothetical protein B456_009G085900                  84.0    4e-17   Gossypium raimondii
emb|CDY23232.1|  BnaA04g05270D                                        83.6    5e-17   Brassica napus [oilseed rape]
ref|XP_009148738.1|  PREDICTED: uncharacterized protein LOC103872141  83.6    5e-17   Brassica rapa
gb|KGN59130.1|  hypothetical protein Csa_3G776900                     83.6    6e-17   Cucumis sativus [cucumbers]
ref|XP_003581199.1|  PREDICTED: uncharacterized protein LOC100823432  83.6    7e-17   Brachypodium distachyon [annual false brome]
ref|XP_004161241.1|  PREDICTED: uncharacterized protein LOC101223869  81.3    1e-16   
dbj|BAJ89637.1|  predicted protein                                    82.8    1e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006384813.1|  hypothetical protein POPTR_0004s21310g           82.8    1e-16   
gb|ACA35272.1|  unknown protein                                       83.2    2e-16   Cucumis sativus [cucumbers]
ref|XP_006384814.1|  hypothetical protein POPTR_0004s21310g           82.8    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002446410.1|  hypothetical protein SORBIDRAFT_06g015560        82.0    6e-16   
ref|NP_001052737.1|  Os04g0412100                                     82.0    6e-16   
gb|EAZ30668.1|  hypothetical protein OsJ_14724                        81.3    9e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008671321.1|  PREDICTED: uncharacterized protein LOC103648675  80.5    1e-15   Zea mays [maize]
ref|XP_007015821.1|  Uncharacterized protein TCM_041417               80.1    1e-15   
ref|XP_004975560.1|  PREDICTED: uncharacterized protein LOC101762913  80.5    1e-15   Setaria italica
ref|XP_009150271.1|  PREDICTED: uncharacterized protein LOC103873611  79.3    1e-15   Brassica rapa
ref|XP_006826648.1|  hypothetical protein AMTR_s00139p00102470        79.3    2e-15   Amborella trichopoda
tpg|DAA37922.1|  TPA: hypothetical protein ZEAMMB73_953930            80.1    2e-15   
ref|XP_011007089.1|  PREDICTED: uncharacterized protein LOC105112...  79.3    2e-15   Populus euphratica
ref|XP_011007079.1|  PREDICTED: uncharacterized protein LOC105112...  79.3    2e-15   Populus euphratica
ref|XP_006487941.1|  PREDICTED: uncharacterized protein LOC102609694  79.3    3e-15   Citrus sinensis [apfelsine]
emb|CDX95368.1|  BnaC04g27900D                                        78.6    3e-15   
ref|XP_007206836.1|  hypothetical protein PRUPE_ppa027026mg           77.4    3e-15   
ref|NP_001143077.1|  uncharacterized protein LOC100275550             79.3    3e-15   Zea mays [maize]
ref|XP_002523802.1|  conserved hypothetical protein                   78.6    4e-15   
ref|XP_009390031.1|  PREDICTED: uncharacterized protein LOC103976522  78.6    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK33881.1|  hypothetical protein AALP_AA5G072300                  78.2    4e-15   Arabis alpina [alpine rockcress]
ref|XP_002877340.1|  hypothetical protein ARALYDRAFT_484861           77.8    4e-15   Arabidopsis lyrata subsp. lyrata
gb|AFW58185.1|  hypothetical protein ZEAMMB73_804767                  79.3    4e-15   
ref|XP_010425861.1|  PREDICTED: uncharacterized protein LOC104710906  77.4    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006292063.1|  hypothetical protein CARUB_v10018258mg           77.4    7e-15   Capsella rubella
ref|XP_006424244.1|  hypothetical protein CICLE_v10029406mg           78.2    8e-15   Citrus clementina [clementine]
emb|CCH47172.1|  hypothetical protein                                 77.4    8e-15   Lupinus angustifolius
ref|XP_009347784.1|  PREDICTED: uncharacterized protein LOC103939425  77.0    1e-14   
ref|XP_008228608.1|  PREDICTED: uncharacterized protein LOC103327996  77.0    1e-14   Prunus mume [ume]
ref|XP_008351289.1|  PREDICTED: uncharacterized protein LOC103414699  77.0    1e-14   
ref|XP_010503097.1|  PREDICTED: uncharacterized protein LOC104780294  76.6    1e-14   Camelina sativa [gold-of-pleasure]
emb|CDY30933.1|  BnaA06g19800D                                        76.3    2e-14   Brassica napus [oilseed rape]
ref|XP_010535696.1|  PREDICTED: uncharacterized protein LOC104810919  76.6    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_004954965.1|  PREDICTED: uncharacterized protein LOC101759245  75.1    4e-14   Setaria italica
ref|XP_006404461.1|  hypothetical protein EUTSA_v10011075mg           75.5    4e-14   Eutrema salsugineum [saltwater cress]
ref|NP_190031.1|  uncharacterized protein                             75.1    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001047026.1|  Os02g0532800                                     76.6    4e-14   
gb|EAY86148.1|  hypothetical protein OsI_07521                        76.6    4e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002312818.1|  hypothetical protein POPTR_0009s16550g           75.5    4e-14   
ref|XP_011459330.1|  PREDICTED: uncharacterized protein LOC105349931  75.1    6e-14   Fragaria vesca subsp. vesca
ref|XP_011000930.1|  PREDICTED: uncharacterized protein LOC105108346  75.1    6e-14   Populus euphratica
ref|XP_006379365.1|  hypothetical protein POPTR_0009s16550g           75.5    6e-14   
gb|EAZ23308.1|  hypothetical protein OsJ_07004                        75.9    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452201.1|  hypothetical protein SORBIDRAFT_04g021680        75.9    7e-14   Sorghum bicolor [broomcorn]
ref|XP_010514778.1|  PREDICTED: uncharacterized protein LOC104790697  75.9    9e-14   
ref|XP_010907937.1|  PREDICTED: uncharacterized protein LOC105034456  74.3    9e-14   
ref|XP_003575071.1|  PREDICTED: uncharacterized protein LOC100845821  74.3    1e-13   Brachypodium distachyon [annual false brome]
ref|XP_002523801.1|  conserved hypothetical protein                   73.9    2e-13   Ricinus communis
ref|XP_004149256.1|  PREDICTED: uncharacterized protein LOC101217932  72.8    3e-13   
gb|KDP33126.1|  hypothetical protein JCGZ_13573                       73.2    3e-13   Jatropha curcas
ref|XP_002312817.2|  hypothetical protein POPTR_0009s16560g           73.2    4e-13   Populus trichocarpa [western balsam poplar]
ref|XP_002523800.1|  conserved hypothetical protein                   72.4    8e-13   
ref|XP_010045208.1|  PREDICTED: uncharacterized protein LOC104433977  70.9    4e-12   Eucalyptus grandis [rose gum]
ref|XP_008809927.1|  PREDICTED: uncharacterized protein LOC103721474  69.3    5e-12   
ref|XP_010089822.1|  hypothetical protein L484_022338                 70.1    6e-12   Morus notabilis
ref|XP_006384815.1|  hypothetical protein POPTR_0004s21320g           68.9    1e-11   
ref|XP_008458586.1|  PREDICTED: uncharacterized protein LOC103497945  68.2    2e-11   Cucumis melo [Oriental melon]
gb|KGN48263.1|  hypothetical protein Csa_6G452640                     68.2    2e-11   Cucumis sativus [cucumbers]
emb|CDP06927.1|  unnamed protein product                              67.4    2e-11   Coffea canephora [robusta coffee]
ref|NP_001142587.1|  uncharacterized protein LOC100274851             67.4    5e-11   Zea mays [maize]
gb|EPS58384.1|  hypothetical protein M569_16431                       65.1    6e-11   Genlisea aurea
ref|NP_001142972.1|  uncharacterized protein LOC100275425             67.4    6e-11   
ref|XP_004487496.1|  PREDICTED: uncharacterized protein LOC101505815  65.5    2e-10   Cicer arietinum [garbanzo]
ref|XP_008681577.1|  PREDICTED: uncharacterized protein LOC100274...  66.2    2e-10   
ref|NP_001241197.1|  uncharacterized protein LOC100810928             65.1    3e-10   Glycine max [soybeans]
ref|XP_003596820.1|  Soft fertilization envelope protein              66.2    5e-10   
ref|NP_001238535.1|  uncharacterized protein LOC100500466             63.9    6e-10   Glycine max [soybeans]
ref|XP_008809941.1|  PREDICTED: uncharacterized protein LOC103721477  63.2    9e-10   Phoenix dactylifera
ref|XP_002275909.1|  PREDICTED: uncharacterized protein LOC100246831  63.2    1e-09   Vitis vinifera
ref|XP_010313363.1|  PREDICTED: uncharacterized protein LOC104644771  60.8    8e-09   Solanum lycopersicum
gb|ABK22013.1|  unknown                                               60.5    1e-08   Picea sitchensis
emb|CAN67239.1|  hypothetical protein VITISV_004804                   63.5    1e-08   Vitis vinifera
gb|AFG64787.1|  hypothetical protein 0_18838_01                       57.8    6e-08   Pinus taeda
gb|AEW08098.1|  hypothetical protein 0_18838_01                       57.4    8e-08   Pinus radiata
ref|XP_009795844.1|  PREDICTED: uncharacterized protein LOC104242489  57.4    1e-07   Nicotiana sylvestris
ref|XP_007150069.1|  hypothetical protein PHAVU_005G123800g           54.7    9e-07   Phaseolus vulgaris [French bean]
gb|EPS67524.1|  hypothetical protein M569_07255                       52.0    4e-06   Genlisea aurea



>ref|XP_009796861.1| PREDICTED: uncharacterized protein LOC104243376 [Nicotiana sylvestris]
Length=159

 Score =   109 bits (273),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR EVAG VWIP+IWGQEELLKDW+DC  FDA  MN+NI+ ARTAL+E+  
Sbjct  86   DNGRERLKRHRVEVAGHVWIPDIWGQEELLKDWIDCSAFDASLMNSNIVSARTALVEERR  145

Query  357  THSHSNTLRLDNTC  398
              + S  LR++N+C
Sbjct  146  IPNSSCRLRIENSC  159



>ref|XP_009617401.1| PREDICTED: uncharacterized protein LOC104109751 [Nicotiana tomentosiformis]
Length=163

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GR+RLKRHR EVAG VWIP+IWGQEELLKDW+DC  FDA  MN+NI+ AR AL+ED  
Sbjct  90   DNGRDRLKRHRVEVAGHVWIPDIWGQEELLKDWIDCSAFDASLMNSNIMSARAALVEDRR  149

Query  357  THSHSNTLRLDNTC  398
              + S  LR++N+C
Sbjct  150  RANSSCRLRIENSC  163



>ref|XP_002528742.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33654.1| conserved hypothetical protein [Ricinus communis]
Length=172

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            DCGRERLKRHR EVAGRVWIP+IWGQEELLKDW+DC  FDA  +   I+ ARTAL+E+  
Sbjct  100  DCGRERLKRHRVEVAGRVWIPDIWGQEELLKDWIDCSAFDAPLLPNRIMSARTALVEE-G  158

Query  357  THSHSNTLRLDNTC  398
              + S  LR++N C
Sbjct  159  RRATSGRLRIENRC  172



>ref|NP_001239944.1| uncharacterized protein LOC100792377 [Glycine max]
 gb|ACU23865.1| unknown [Glycine max]
Length=179

 Score =   103 bits (257),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR EVAGRVWIP+IWGQEELLKDW+DC  FDA  + + I++ARTAL+E+  
Sbjct  107  DSGRERLKRHRVEVAGRVWIPDIWGQEELLKDWIDCTAFDAPLVPSRIVMARTALVEE-G  165

Query  357  THSHSNTLRLDNTC  398
              + S  LR++N C
Sbjct  166  RRATSGGLRIENRC  179



>emb|CDP15409.1| unnamed protein product [Coffea canephora]
Length=190

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERLKRHR EVAGRVWIP+IWGQEELLKDW+DC  FDA  MN++I+ AR AL+E+    
Sbjct  120  GRERLKRHRIEVAGRVWIPDIWGQEELLKDWIDCSAFDASVMNSSIMSARAALVEE-GRR  178

Query  363  SHSNTLRLDNTC  398
            ++S+ +R++N C
Sbjct  179  ANSSRIRIENRC  190



>ref|XP_008787843.1| PREDICTED: uncharacterized protein LOC103705767 [Phoenix dactylifera]
Length=151

 Score =   102 bits (253),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 76/129 (59%), Gaps = 10/129 (8%)
 Frame = +3

Query  39   LPPAATTNSSCSQEVVGGENQSKRSVR---------ESGDaeaevaaaavavaveDCGRE  191
            LPP+ +     S+E+V  +  SK  V+         ES  +E    A++   +VEDCGRE
Sbjct  24   LPPSESLQVKNSEELVAPDISSKNGVKGKIECYNNPESSQSEIPTEASSKGPSVEDCGRE  83

Query  192  RLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTHSHS  371
            +LKRHR E+AGRVWIPE WGQE LLKDW DC  FD   +   + LAR ALM D     +S
Sbjct  84   KLKRHRMEMAGRVWIPEKWGQESLLKDWADCAAFDRSLVPKGLTLAREALM-DERRRVNS  142

Query  372  NTLRLDNTC  398
              LR++N C
Sbjct  143  GQLRIENQC  151



>ref|XP_003535631.2| PREDICTED: uncharacterized protein LOC100815684 [Glycine max]
 gb|KHN13514.1| hypothetical protein glysoja_038752 [Glycine soja]
Length=180

 Score =   102 bits (255),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRE+LKRHR EVAGRVWIP+IWGQEE+LKDW+DC  FDA  + + I++ARTAL+E+  
Sbjct  108  DSGREKLKRHRVEVAGRVWIPDIWGQEEILKDWIDCTAFDAPLVPSRIVMARTALVEE-G  166

Query  357  THSHSNTLRLDNTC  398
              + S  LR++N C
Sbjct  167  RRATSGGLRIENRC  180



>gb|ACU19002.1| unknown [Glycine max]
Length=140

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRE+LKRHR EVAGRVWIP+IWGQEE+LKDW+DC  FDA  + + I++ARTAL+E+  
Sbjct  68   DSGREKLKRHRVEVAGRVWIPDIWGQEEILKDWIDCTAFDAPLVPSRIVMARTALVEE-G  126

Query  357  THSHSNTLRLDNTC  398
              + S  LR++N C
Sbjct  127  RRATSGGLRIENRC  140



>ref|XP_007145301.1| hypothetical protein PHAVU_007G227500g [Phaseolus vulgaris]
 gb|ESW17295.1| hypothetical protein PHAVU_007G227500g [Phaseolus vulgaris]
Length=154

 Score =   100 bits (249),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERLKRHR EV+GRVWIPEIWGQE+LLKDW+DC  FDA  + + I++ARTAL+E+    
Sbjct  84   GRERLKRHRVEVSGRVWIPEIWGQEDLLKDWIDCTAFDAPLVPSRIVMARTALVEE-GRR  142

Query  363  SHSNTLRLDNTC  398
            + S  LR++N C
Sbjct  143  ATSGGLRVENRC  154



>ref|XP_006341142.1| PREDICTED: uncharacterized protein LOC102585102 [Solanum tuberosum]
Length=154

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIIL-ARTALMEDT  353
            D GRERLKRHR EVAG VWIPEIWGQEELLKDW+DC  FD+  MN N I+ AR AL+E+ 
Sbjct  80   DSGRERLKRHRIEVAGHVWIPEIWGQEELLKDWIDCSAFDSKLMNNNNIMSARAALVEER  139

Query  354  TTHSHSNTLRLDNT  395
               + S  LR++N+
Sbjct  140  RRTNSSCRLRIENS  153



>gb|KHN14999.1| hypothetical protein glysoja_037126, partial [Glycine soja]
Length=174

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            D GRERLKRHR EVAGRVWIP+IWGQEELLKDW+DC  FDA  + + I++ARTAL+E+
Sbjct  113  DSGRERLKRHRVEVAGRVWIPDIWGQEELLKDWIDCTAFDAPLVPSRIVMARTALVEE  170



>ref|XP_010036690.1| PREDICTED: uncharacterized protein LOC104425646 [Eucalyptus grandis]
 gb|KCW48326.1| hypothetical protein EUGRSUZ_K02045 [Eucalyptus grandis]
Length=171

 Score = 98.2 bits (243),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERLKRHR EVAGR WIP+IWGQEELLKDWVDC  F+A ++   I+ A+ AL+E+    
Sbjct  101  GRERLKRHRIEVAGRAWIPDIWGQEELLKDWVDCSAFEASFLPAKIMSAKAALVEE-GRR  159

Query  363  SHSNTLRLDNTC  398
            ++S  LRL+N C
Sbjct  160  ANSGGLRLENRC  171



>ref|XP_010558990.1| PREDICTED: uncharacterized protein LOC104827509 [Tarenaya hassleriana]
Length=172

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR +VAGRVWIPEIWGQEE LKDW+DC  FD+  + T I  AR AL+++  
Sbjct  95   DNGRERLKRHRRKVAGRVWIPEIWGQEEFLKDWIDCSAFDSCLVPTGISSARAALVQEAR  154

Query  357  THSHSNTLRLDNTC  398
                  T RL N C
Sbjct  155  RAPSHGTFRLQNRC  168



>ref|XP_007027734.1| Uncharacterized protein TCM_022582 [Theobroma cacao]
 gb|EOY08236.1| Uncharacterized protein TCM_022582 [Theobroma cacao]
Length=169

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 57/72 (79%), Gaps = 1/72 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERL+RHR EVAGRVWIPEIWGQE+LLKDW+DC  F+A  + + I+ AR AL+E+  T 
Sbjct  99   GRERLRRHRIEVAGRVWIPEIWGQEQLLKDWIDCSAFEASLVPSGIMSARAALIEEGRT-  157

Query  363  SHSNTLRLDNTC  398
            ++S   R++N+C
Sbjct  158  ANSGRFRIENSC  169



>gb|KDO70391.1| hypothetical protein CISIN_1g042384mg, partial [Citrus sinensis]
Length=78

 Score = 95.1 bits (235),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR +VAGRVWIP+IWGQEE+LKDW+DC  FDA  + + I+ AR AL ++  
Sbjct  6    DNGRERLKRHRIDVAGRVWIPDIWGQEEMLKDWIDCSAFDALLVPSGIMSARAALAQE-G  64

Query  357  THSHSNTLRLDNTC  398
              +HS  LR++N C
Sbjct  65   RRAHSGGLRVENRC  78



>emb|CAN69280.1| hypothetical protein VITISV_023275 [Vitis vinifera]
Length=164

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GR+RLKRHR EVAGRVWIP+IWGQEEL+KDW DC  FDA  +++ I+ AR ALM +  
Sbjct  92   DSGRDRLKRHRVEVAGRVWIPDIWGQEELMKDWTDCSVFDASLVSSRIMSARAALMAE-G  150

Query  357  THSHSNTLRLDNTC  398
               +S+ LR++N C
Sbjct  151  RRPNSSRLRIENRC  164



>ref|XP_010661366.1| PREDICTED: uncharacterized protein LOC104881801 [Vitis vinifera]
Length=172

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GR+RLKRHR EVAGRVWIP+IWGQEEL+KDW DC  FDA  +++ I+ AR ALM +  
Sbjct  100  DSGRDRLKRHRVEVAGRVWIPDIWGQEELMKDWTDCSVFDASLVSSRIMSARAALMAE-G  158

Query  357  THSHSNTLRLDNTC  398
               +S+ LR++N C
Sbjct  159  RRPNSSRLRIENRC  172



>ref|XP_007202690.1| hypothetical protein PRUPE_ppa012609mg [Prunus persica]
 gb|EMJ03889.1| hypothetical protein PRUPE_ppa012609mg [Prunus persica]
Length=161

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLK+HR EVAG+VWIP+IWGQEELLKDW+DC  FDA    + I+ AR+AL+E+  
Sbjct  89   DSGRERLKKHRVEVAGQVWIPDIWGQEELLKDWMDCSAFDASLFPSGIMSARSALIEEGR  148

Query  357  THSHSNTLRLDNTC  398
               +S  +R++N C
Sbjct  149  RQ-NSARIRIENRC  161



>ref|XP_004246546.1| PREDICTED: uncharacterized protein LOC101264052 [Solanum lycopersicum]
Length=154

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIIL-ARTALMEDT  353
            D GRERLKRHR EVAG VWIPEIWGQEELLKDW+DC  FD+   N N I+ AR AL+E+ 
Sbjct  80   DSGRERLKRHRIEVAGHVWIPEIWGQEELLKDWIDCSAFDSKLNNNNNIMSARAALVEER  139

Query  354  TTHSHSNTLRLDNT  395
              ++ S  LR++N+
Sbjct  140  RRNNSSCRLRIENS  153



>gb|KHN02226.1| hypothetical protein glysoja_002250 [Glycine soja]
Length=179

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL RHR EVAGRVWIP+IWGQEELLKDW+DC  FDA  + + I  AR AL+++  
Sbjct  107  DSGRERLNRHRVEVAGRVWIPDIWGQEELLKDWIDCTAFDATLVPSRISTAREALVQE-C  165

Query  357  THSHSNTLRLDNTC  398
            T ++S  LR++N C
Sbjct  166  TRANSAGLRIENRC  179



>ref|XP_007162900.1| hypothetical protein PHAVU_001G189900g [Phaseolus vulgaris]
 gb|ESW34894.1| hypothetical protein PHAVU_001G189900g [Phaseolus vulgaris]
Length=203

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR EVAGRVWIP++WGQEELLKDW+DC  FDA  + + I  AR AL+E+  
Sbjct  101  DSGRERLKRHRVEVAGRVWIPDMWGQEELLKDWIDCSAFDAPLVPSRIATAREALVEE-C  159

Query  357  THSHSNTLRLDN  392
            T +++  LR++N
Sbjct  160  TRANAAGLRIEN  171



>ref|XP_010912295.1| PREDICTED: uncharacterized protein LOC105038249 [Elaeis guineensis]
Length=150

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERLKRHR E+AGRVWIPEIWGQE LLKDW+DC  FD + +   ++LAR ALMED    
Sbjct  80   GRERLKRHRMEMAGRVWIPEIWGQESLLKDWIDCEAFDRFLVPKGLMLAREALMED-CRR  138

Query  363  SHSNTLRLDNTC  398
            ++S  L ++N C
Sbjct  139  ANSGPLGIENRC  150



>ref|XP_008241235.1| PREDICTED: uncharacterized protein LOC103339680 [Prunus mume]
Length=171

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLK+HR EVAGRVWIP+IWGQEELL+DW+DC  FDA    + I+ AR+AL+E+  
Sbjct  89   DSGRERLKKHRVEVAGRVWIPDIWGQEELLQDWIDCSAFDASLFPSGIMSARSALIEEGR  148

Query  357  THSHSNTLRLDN  392
               +S  +R++N
Sbjct  149  RQ-NSARIRIEN  159



>ref|XP_011466764.1| PREDICTED: uncharacterized protein LOC105352154 [Fragaria vesca 
subsp. vesca]
Length=171

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            + GRERLKRHR EVAGRVWIP+IWGQEE LKDWVDC  FD     T I+ AR+AL+E+  
Sbjct  99   ESGRERLKRHRIEVAGRVWIPDIWGQEEFLKDWVDCTTFDDTLFPTGIMSARSALVEE-G  157

Query  357  THSHSNTLRLDNTC  398
                S+ LR++N C
Sbjct  158  RRGTSSRLRIENRC  171



>ref|XP_006481780.1| PREDICTED: uncharacterized protein LOC102625741 [Citrus sinensis]
Length=190

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR +VAGRVWIP+IWGQEE+LKDW+DC  FDA  + + I+ AR AL ++  
Sbjct  116  DNGRERLKRHRIDVAGRVWIPDIWGQEEMLKDWIDCSAFDALLVPSGIMSARAALAQE-G  174

Query  357  THSHSNTLRLDN  392
              +HS  LR++N
Sbjct  175  RRAHSGGLRVEN  186



>ref|XP_006430209.1| hypothetical protein CICLE_v10012842mg [Citrus clementina]
 gb|ESR43449.1| hypothetical protein CICLE_v10012842mg [Citrus clementina]
Length=194

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR +VAGRVWIP+IWGQEE+LKDW+DC  FDA  + + I+ AR AL ++  
Sbjct  118  DNGRERLKRHRIDVAGRVWIPDIWGQEEMLKDWIDCSAFDALLVPSGIMSARAALAQE-G  176

Query  357  THSHSNTLRLDN  392
              +HS  LR++N
Sbjct  177  RRAHSGGLRVEN  188



>gb|KDP42745.1| hypothetical protein JCGZ_23685 [Jatropha curcas]
Length=227

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D G ERL+RHR EVAGRVWIP+IWGQEELLKDW+DC  FDA  M  +I+ AR AL+E+  
Sbjct  155  DSGCERLRRHRIEVAGRVWIPDIWGQEELLKDWIDCSAFDAPLMPNSIMSARAALVEE-G  213

Query  357  THSHSNTLRLDNTC  398
              + S  LR++N C
Sbjct  214  RRATSGRLRIENRC  227



>ref|XP_008784230.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 
[Phoenix dactylifera]
Length=926

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 65/96 (68%), Gaps = 5/96 (5%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            DCGRERLKRHR E+ GRVWIPEIWGQE LLKDW+DC  FD + ++  ++LAR AL+E+  
Sbjct  78   DCGRERLKRHRMEMEGRVWIPEIWGQESLLKDWIDCAAFDRFLVSKGLMLAREALVEE-C  136

Query  357  THSHSNTLRLDNTC*LHFFTFSICLSFLSLSNISVF  464
              ++S+ L ++N C    F      S+  LS I+ F
Sbjct  137  RRANSSPLGIENRCWDALFL----PSYRPLSTITSF  168



>ref|XP_008389780.1| PREDICTED: uncharacterized protein LOC103452045 [Malus domestica]
Length=160

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERL++HR EVAG+VWIPEIWGQEELL+DW+DC  FDA    + I+ AR+AL+E+    
Sbjct  90   GRERLQKHRMEVAGQVWIPEIWGQEELLQDWIDCSAFDASLFPSGIMTARSALVEE-GRR  148

Query  363  SHSNTLRLDNTC  398
             ++  LR++N C
Sbjct  149  ENTGRLRIENRC  160



>ref|XP_003625814.1| hypothetical protein MTR_7g104540 [Medicago truncatula]
 gb|AES82032.1| plant/F3C22-140 protein, putative [Medicago truncatula]
Length=180

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D  RERLKRHR EVAGRVWIPEIWGQE+LLKDW+DC  FDA  + + I +AR AL+E+ T
Sbjct  101  DSERERLKRHRVEVAGRVWIPEIWGQEDLLKDWIDCTAFDAPLVPSKITMARAALVEEGT  160



>ref|XP_003554435.1| PREDICTED: uncharacterized protein LOC100793911 isoform X1 [Glycine 
max]
 ref|XP_006604639.1| PREDICTED: uncharacterized protein LOC100793911 isoform X4 [Glycine 
max]
 ref|XP_006604640.1| PREDICTED: uncharacterized protein LOC100793911 isoform X5 [Glycine 
max]
Length=187

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL RHR EVAGRVWIP+IWGQEELLKDW+DC  FDA  + + I  AR AL+++  
Sbjct  107  DSGRERLNRHRVEVAGRVWIPDIWGQEELLKDWIDCTAFDATLVPSRISTAREALVQE-C  165

Query  357  THSHSNTLRLDN  392
            T ++S  LR++N
Sbjct  166  TRANSAGLRIEN  177



>ref|XP_006604637.1| PREDICTED: uncharacterized protein LOC100793911 isoform X2 [Glycine 
max]
Length=200

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 6/92 (7%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL RHR EVAGRVWIP+IWGQEELLKDW+DC  FDA  + + I  AR AL+++  
Sbjct  107  DSGRERLNRHRVEVAGRVWIPDIWGQEELLKDWIDCTAFDATLVPSRISTAREALVQE-C  165

Query  357  THSHSNTLRLDNTC-----*LHFFTFSICLSF  437
            T ++S  LR++N+       L       C+ F
Sbjct  166  TRANSAGLRIENSVVSGKRQLRIIRIKRCIVF  197



>ref|XP_004494175.1| PREDICTED: uncharacterized protein LOC101508117 isoform X1 [Cicer 
arietinum]
Length=204

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 52/67 (78%), Gaps = 1/67 (1%)
 Frame = +3

Query  192  RLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTHSHS  371
            RLKRHR EVAGRVWIPEIWGQEELLKDW+DC  FDA  + + I +AR AL+ED  T +++
Sbjct  100  RLKRHRVEVAGRVWIPEIWGQEELLKDWIDCSAFDAPLVPSKITMARAALVED-GTRANA  158

Query  372  NTLRLDN  392
              L +DN
Sbjct  159  AALSIDN  165



>gb|AFK44733.1| unknown [Lotus japonicus]
Length=156

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRE+LKRHR EVAGRVWIP++WGQE+LLKDW+DC  FDA  + + I +AR AL+ +  
Sbjct  84   DSGREKLKRHRVEVAGRVWIPDMWGQEDLLKDWIDCSAFDAPLVPSKITMAREALVGE-G  142

Query  357  THSHSNTLRLDNTC  398
              +++  LR++N C
Sbjct  143  RRANAAGLRIENRC  156



>ref|XP_010426895.1| PREDICTED: uncharacterized protein LOC104711823 [Camelina sativa]
Length=146

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLK+HR E+AGRVWIPEIWGQEELLKDW+DC  FD   +   I  AR AL+E+  
Sbjct  67   DSGRERLKKHRKEIAGRVWIPEIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVEEAR  126

Query  357  THSHSN--TLRLDNTC  398
              + ++    RLD+ C
Sbjct  127  RAATASRGLQRLDSRC  142



>ref|XP_010507412.1| PREDICTED: uncharacterized protein LOC104784033, partial [Camelina 
sativa]
Length=144

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLK+HR E+AGRVWIPEIWGQEELLKDW+DC  FD   +   I  AR AL+E+  
Sbjct  67   DSGRERLKKHRKEIAGRVWIPEIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVEEAR  126

Query  357  THSHSN--TLRLDNTC  398
              + ++    RLD+ C
Sbjct  127  RAATASRGLQRLDSRC  142



>ref|XP_009336972.1| PREDICTED: uncharacterized protein LOC103929487 [Pyrus x bretschneideri]
Length=137

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            G ERLK+HR EVAG+VWIPEIWGQEELL+DW+DC  FDA    + I+ AR+AL+E+    
Sbjct  67   GLERLKKHRMEVAGQVWIPEIWGQEELLQDWIDCSAFDASLFPSGIMTARSALVEE-GRR  125

Query  363  SHSNTLRLDNTC  398
             +S  LR++N C
Sbjct  126  ENSGRLRIENRC  137



>ref|NP_001242227.1| uncharacterized protein LOC100779351 [Glycine max]
 gb|ACU22758.1| unknown [Glycine max]
Length=187

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL RHR EVAGRVWIPEIWGQEELLKDW+DC  FDA  + + I  AR AL+E+ T
Sbjct  107  DSGRERLNRHRVEVAGRVWIPEIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166



>ref|XP_006293211.1| hypothetical protein CARUB_v10019532mg [Capsella rubella]
 gb|EOA26109.1| hypothetical protein CARUB_v10019532mg [Capsella rubella]
Length=151

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT-  353
            D GRERLK+HR E+AGRVWIPEIWGQEELLKDW+DC  FD   +   I  AR AL+E+  
Sbjct  72   DSGRERLKKHRREIAGRVWIPEIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVEEAR  131

Query  354  TTHSHSNTL-RLDNTC  398
               S S  L RLD+ C
Sbjct  132  RAASASRGLQRLDSRC  147



>ref|XP_006576219.1| PREDICTED: uncharacterized protein LOC100779351 isoform X5 [Glycine 
max]
Length=187

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL RHR EVAGRVWIPEIWGQEELLKDW+DC  FDA  + + I  AR AL+E+ T
Sbjct  107  DSGRERLNRHRVEVAGRVWIPEIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166



>ref|XP_006604638.1| PREDICTED: uncharacterized protein LOC100793911 isoform X3 [Glycine 
max]
Length=195

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL RHR EVAGRVWIP+IWGQEELLKDW+DC  FDA  + + I  AR AL+++  
Sbjct  107  DSGRERLNRHRVEVAGRVWIPDIWGQEELLKDWIDCTAFDATLVPSRISTAREALVQE-C  165

Query  357  THSHSNTLRLDN  392
            T ++S  LR++N
Sbjct  166  TRANSAGLRIEN  177



>ref|XP_010515747.1| PREDICTED: uncharacterized protein LOC104791529 [Camelina sativa]
Length=146

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLK+HR E+AGRVWIPEIWGQEELLKDW+DC  FD   +   I  AR AL+E+  
Sbjct  67   DSGRERLKKHRKEIAGRVWIPEIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVEEAR  126

Query  357  THSHSN--TLRLDNTC  398
              + ++    RLD+ C
Sbjct  127  RAATASRGLQRLDSRC  142



>gb|KCW74171.1| hypothetical protein EUGRSUZ_E02817 [Eucalyptus grandis]
Length=192

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRE L+RHR EVAG+VWIPEIWGQEELLKDWVDC  F+A    T I  A+ AL E+    
Sbjct  122  GREMLQRHRVEVAGQVWIPEIWGQEELLKDWVDCSAFEASMAPTKIYSAKAALTEE-GKK  180

Query  363  SHSNTLRLDNTC  398
            + S  LR+D +C
Sbjct  181  AKSGGLRIDKSC  192



>ref|XP_010507411.1| PREDICTED: uncharacterized protein LOC104784032, partial [Camelina 
sativa]
Length=95

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLK+HR E+AGRVWIPEIWGQEELLKDW+DC  FD   +   I  AR AL+E+  
Sbjct  16   DSGRERLKKHRKEIAGRVWIPEIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVEEAR  75

Query  357  THSHSN--TLRLDNTC  398
              + ++    RLD+ C
Sbjct  76   RAATASRGLQRLDSRC  91



>ref|XP_006576217.1| PREDICTED: uncharacterized protein LOC100779351 isoform X3 [Glycine 
max]
 ref|XP_006576218.1| PREDICTED: uncharacterized protein LOC100779351 isoform X4 [Glycine 
max]
Length=208

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL RHR EVAGRVWIPEIWGQEELLKDW+DC  FDA  + + I  AR AL+E+ T
Sbjct  107  DSGRERLNRHRVEVAGRVWIPEIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166



>ref|XP_009374766.1| PREDICTED: uncharacterized protein LOC103963656 [Pyrus x bretschneideri]
Length=160

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            + G E LK+HR EVAG+VWIPEIWGQEELL+DW+DC  FDA    + I+ AR+AL+E+  
Sbjct  88   ESGLEGLKKHRMEVAGQVWIPEIWGQEELLQDWIDCSAFDASLFPSGIMTARSALVEE-G  146

Query  357  THSHSNTLRLDNTC  398
               +S  LR++N C
Sbjct  147  RRENSGRLRIENRC  160



>gb|KHN18769.1| hypothetical protein glysoja_021520 [Glycine soja]
Length=200

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL RHR EVAGRVWIPEIWGQEELLKDW+DC  FDA  + + I  AR AL+E+ T
Sbjct  107  DSGRERLNRHRVEVAGRVWIPEIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166



>ref|XP_010527628.1| PREDICTED: uncharacterized protein LOC104804934 [Tarenaya hassleriana]
Length=172

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRE+L RHR +VAGRVWIPEIWGQEE LKDW+DC  FD+  + T I  AR+AL+E+    
Sbjct  97   GREKLNRHRRQVAGRVWIPEIWGQEEFLKDWIDCSTFDSCLVPTGISSARSALVEEARRA  156

Query  363  SHSNTLRLDNTC  398
            S +  L L N C
Sbjct  157  SSNGGLPLQNRC  168



>emb|CAN80332.1| hypothetical protein VITISV_018276 [Vitis vinifera]
Length=196

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +3

Query  126  GDaeaevaaaavavaveDCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYW  305
            GD   E        + ED GRERLKRHR EVAG V IP++WGQEEL+KDWVDC  FDA  
Sbjct  78   GDVSKEPIKTEALASSEDSGRERLKRHRVEVAGSVGIPDMWGQEELMKDWVDCSVFDASL  137

Query  306  MNTNIILARTALMEDTTTHSHSNTLRLDNTC*LHFFT  416
            + + I+ AR AL+ +    S S  LR++N C +  F+
Sbjct  138  VTSRIMSARAALVAEGRRPSPSG-LRIENRCNIDNFS  173



>gb|EYU35484.1| hypothetical protein MIMGU_mgv1a024452mg [Erythranthe guttata]
Length=133

 Score = 90.9 bits (224),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 52/69 (75%), Gaps = 1/69 (1%)
 Frame = +3

Query  180  CGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTT  359
             GRERLKRHR EVAGRVWIP++WGQE  LKDW+DC  FDA  +N++I  AR +L+E+   
Sbjct  62   AGRERLKRHRVEVAGRVWIPDMWGQENFLKDWIDCTAFDASLVNSSITSARDSLVEE-AR  120

Query  360  HSHSNTLRL  386
             ++S  LR+
Sbjct  121  RANSARLRI  129



>ref|XP_009366670.1| PREDICTED: uncharacterized protein LOC103956416 [Pyrus x bretschneideri]
Length=164

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERLK+HR EVAG+VWIP+IWGQEELL+DW+DC  FDA    + I+ AR+AL+E+    
Sbjct  94   GRERLKKHRMEVAGQVWIPDIWGQEELLQDWIDCSAFDASLFPSGIMTARSALVEE-GRR  152

Query  363  SHSNTLRLDNTC  398
             +S  LR++  C
Sbjct  153  ENSGRLRIEYRC  164



>ref|XP_010101569.1| hypothetical protein L484_015393 [Morus notabilis]
 gb|EXB88708.1| hypothetical protein L484_015393 [Morus notabilis]
Length=164

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D  RERLKRHR EVAGRVWIP+IWGQE+LLKDW+DC  FDA  +   I+ AR AL+E+  
Sbjct  92   DNERERLKRHRIEVAGRVWIPDIWGQEDLLKDWIDCSAFDACLVPKEIMSAREALVEE-G  150

Query  357  THSHSNTLRLDNTC  398
              + S  LR++N C
Sbjct  151  RRATSGRLRIENRC  164



>ref|NP_566972.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL38610.1|AF446877_1 AT3g52740/F3C22_140 [Arabidopsis thaliana]
 emb|CAB89235.1| putative protein [Arabidopsis thaliana]
 gb|AAK96599.1| AT3g52740/F3C22_140 [Arabidopsis thaliana]
 gb|AEE78988.1| uncharacterized protein AT3G52740 [Arabidopsis thaliana]
Length=140

 Score = 90.9 bits (224),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            D GRERLK+HR E+AGRVWIPEIWGQEELLKDW+DC  FD   +   I  ARTAL+E+
Sbjct  64   DTGRERLKKHRREIAGRVWIPEIWGQEELLKDWIDCSTFDTCLVPAGISSARTALVEE  121



>ref|XP_006576215.1| PREDICTED: uncharacterized protein LOC100779351 isoform X1 [Glycine 
max]
Length=243

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL RHR EVAGRVWIPEIWGQEELLKDW+DC  FDA  + + I  AR AL+E+ T
Sbjct  107  DSGRERLNRHRVEVAGRVWIPEIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166



>ref|XP_010271656.1| PREDICTED: uncharacterized protein LOC104607675 [Nelumbo nucifera]
Length=177

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 54/72 (75%), Gaps = 1/72 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERLKRHR EVAG VW+P+IWGQE+LLKDW+DC  F++  +   ++ AR AL+E+    
Sbjct  107  GRERLKRHRTEVAGHVWVPDIWGQEDLLKDWIDCSAFNSSLVPNGLMSARAALIEE-NRR  165

Query  363  SHSNTLRLDNTC  398
            ++S  LR++N C
Sbjct  166  ANSGRLRIENRC  177



>ref|XP_006576216.1| PREDICTED: uncharacterized protein LOC100779351 isoform X2 [Glycine 
max]
Length=217

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL RHR EVAGRVWIPEIWGQEELLKDW+DC  FDA  + + I  AR AL+E+ T
Sbjct  107  DSGRERLNRHRVEVAGRVWIPEIWGQEELLKDWIDCSAFDAPLVPSRISTARKALVEECT  166



>ref|XP_002877881.1| hypothetical protein ARALYDRAFT_485645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54140.1| hypothetical protein ARALYDRAFT_485645 [Arabidopsis lyrata subsp. 
lyrata]
Length=138

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 8/77 (10%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLK+HR E+AGRVWIPEIWGQEELLKDW+DC  FD   +   I  AR AL+E+  
Sbjct  62   DTGRERLKKHRREIAGRVWIPEIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVEEAR  121

Query  357  --------THSHSNTLR  383
                     HSH   LR
Sbjct  122  RAASASGGLHSHCLILR  138



>ref|XP_006403775.1| hypothetical protein EUTSA_v10010806mg [Eutrema salsugineum]
 gb|ESQ45228.1| hypothetical protein EUTSA_v10010806mg [Eutrema salsugineum]
Length=141

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 66/129 (51%), Gaps = 3/129 (2%)
 Frame = +3

Query  21   TSMKHQLPPAATTNSSCSQEVVGGENQSKRSVRESGDaeaevaaaavavaveDC---GRE  191
            + M H + P+   +    QE     +    SV +  D              E     GRE
Sbjct  9    SPMPHPIGPSKPPSDQTQQEDPSLPDDEASSVSDKKDEALPEEKPKQNQEEERVDTTGRE  68

Query  192  RLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTHSHS  371
            +LK+HR E+AGRVWIPEIWG+EELLKDW+DC  FD   +  +I  AR AL+E+    + +
Sbjct  69   KLKKHRREIAGRVWIPEIWGKEELLKDWIDCSTFDTRLVPADISSARDALVEEARRAASA  128

Query  372  NTLRLDNTC  398
            +   L N C
Sbjct  129  SGGTLHNRC  137



>emb|CAH67161.1| H0717B12.8 [Oryza sativa Indica Group]
Length=203

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 56/83 (67%), Gaps = 9/83 (11%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED--  350
            +  RERLKRHR E+AGRVW+P++WGQE+LLKDWVDC  FD   +  +++ AR AL+ +  
Sbjct  120  ESARERLKRHRREMAGRVWVPDMWGQEKLLKDWVDCAAFDRPLVPPDLLTARRALVAECC  179

Query  351  -------TTTHSHSNTLRLDNTC  398
                   TT  + S++LR+  +C
Sbjct  180  AHRPDRTTTPPARSSSLRVQKSC  202



>gb|EAY94030.1| hypothetical protein OsI_15808 [Oryza sativa Indica Group]
Length=203

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 55/83 (66%), Gaps = 9/83 (11%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED--  350
            +  RERLKRHR E+AGRVW+P++WGQE+LLKDWVDC  FD   +  +++ AR AL+ +  
Sbjct  120  ESARERLKRHRREMAGRVWVPDMWGQEKLLKDWVDCAAFDRPLVPPDLLTARRALVAECC  179

Query  351  -------TTTHSHSNTLRLDNTC  398
                   TT  + S+ LR+  +C
Sbjct  180  ARRPDRTTTPPARSSPLRVQKSC  202



>gb|KJB16115.1| hypothetical protein B456_002G240200 [Gossypium raimondii]
Length=134

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 3/75 (4%)
 Frame = +3

Query  177  DCGRERLKRHRGEVA-GRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT  353
            D GRERLK+HR E+   +VWIP+IWGQEELLKDW+DC GFD   + + I+LAR AL+E+ 
Sbjct  62   DNGRERLKKHRIEMGKSKVWIPDIWGQEELLKDWIDCSGFDDCLVPSGIMLAREALVEEV  121

Query  354  TTHSHSNTLRLDNTC  398
             T S    +R++N C
Sbjct  122  RTGSGG--VRIENRC  134



>gb|KFK34522.1| hypothetical protein AALP_AA5G156800 [Arabis alpina]
Length=139

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            GRERLK+HR E+AGRVWIPEIWGQEELLKDW+DC  FD   +   I  AR AL+E+
Sbjct  65   GRERLKKHRREIAGRVWIPEIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVEE  120



>gb|EYU38632.1| hypothetical protein MIMGU_mgv1a026837mg [Erythranthe guttata]
Length=147

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 1/73 (1%)
 Frame = +3

Query  180  CGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTT  359
             GRE+L++HR EVAGRVWIPE+WGQE  LKDW+D   FD+   N++I+ AR +L+E+   
Sbjct  76   SGREKLRKHRVEVAGRVWIPEMWGQEAFLKDWIDSTVFDSKLANSSIMSARVSLVEE-GR  134

Query  360  HSHSNTLRLDNTC  398
              +S    ++N+C
Sbjct  135  RPNSTAFTIENSC  147



>ref|XP_011077929.1| PREDICTED: proline-rich transmembrane protein 2-like [Sesamum 
indicum]
Length=171

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNT  314
            GRERLKRHR EVAGRVWIPE+WGQEELLKDW+DC  FDA  MN+
Sbjct  101  GRERLKRHRVEVAGRVWIPEMWGQEELLKDWIDCTAFDATLMNS  144



>ref|XP_009379801.1| PREDICTED: uncharacterized protein LOC103968354 [Musa acuminata 
subsp. malaccensis]
Length=133

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            + GRERLKRHR E+AGRVWIPEIWGQE LLKDW+D   FD   +   ++ AR AL+E+  
Sbjct  61   ESGRERLKRHRTEMAGRVWIPEIWGQESLLKDWIDSSVFDRPLVPKGLVSAREALVEECR  120

Query  357  THSHSNTLRLDNTC  398
              S S + R+ N C
Sbjct  121  RTS-SGSRRIKNPC  133



>ref|XP_010654082.1| PREDICTED: uncharacterized protein LOC104880149 [Vitis vinifera]
Length=194

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 57/89 (64%), Gaps = 1/89 (1%)
 Frame = +3

Query  126  GDaeaevaaaavavaveDCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYW  305
            GD   E        + ED GRERLKRHR EVAG V IP++WGQEEL+KDWVDC  FDA  
Sbjct  78   GDVSKEPIKTEALASSEDSGRERLKRHRVEVAGSVGIPDMWGQEELMKDWVDCSVFDASL  137

Query  306  MNTNIILARTALMEDTTTHSHSNTLRLDN  392
            + + I+ AR AL+ +    S S  LR++N
Sbjct  138  VTSRIMSARAALVAEGRRPSPSG-LRIEN  165



>gb|KEH42025.1| hypothetical protein MTR_1g059990 [Medicago truncatula]
Length=117

 Score = 84.7 bits (208),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 48/61 (79%), Gaps = 1/61 (2%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWM-NTNIILARTALMEDT  353
            + GRERLKRHR E+ GRVWIP++WGQEE LKDW+DC  FD   + N+ I+ ARTAL+++ 
Sbjct  51   ESGRERLKRHRVEMGGRVWIPDMWGQEEYLKDWIDCTTFDPPLISNSKIVTARTALVQEA  110

Query  354  T  356
            T
Sbjct  111  T  111



>ref|XP_010244926.1| PREDICTED: uncharacterized protein LOC104588614 [Nelumbo nucifera]
Length=160

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERLKRHR E+AGRVWIPEIWGQE+ LKDW+D   F++  +   ++ AR AL+E++   
Sbjct  63   GRERLKRHRIEMAGRVWIPEIWGQEDFLKDWIDSSAFNSSLVPNGLMSARAALIEESHRA  122

Query  363  SHSNTLR  383
            +   TLR
Sbjct  123  NSGKTLR  129



>ref|XP_009115970.1| PREDICTED: uncharacterized protein LOC103841203 [Brassica rapa]
Length=138

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            D GRE+LK+HR +VAGRVWIP+IWGQEELLKDW+DC  FD   +   I  AR AL+++
Sbjct  62   DTGREKLKKHRRDVAGRVWIPDIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVDE  119



>emb|CDX78120.1| BnaA09g33150D [Brassica napus]
Length=138

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            D GRE+LK+HR +VAGRVWIP+IWGQEELLKDW+DC  FD   +   I  AR AL+++
Sbjct  62   DTGREKLKKHRRDVAGRVWIPDIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVDE  119



>emb|CDX73609.1| BnaC08g23940D [Brassica napus]
Length=138

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            D GRE+LK+HR +VAGRVWIP+IWGQEELLKDW+DC  FD   +   I  AR AL+++
Sbjct  62   DTGREKLKKHRRDVAGRVWIPDIWGQEELLKDWIDCSTFDTCLVPAGISSARAALVDE  119



>gb|KJB62152.1| hypothetical protein B456_009G403000 [Gossypium raimondii]
Length=174

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 1/72 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRE+LKRHR EVAG VWIP+IWGQEELLKDW+DC  F+   +   I+ AR AL+E+  
Sbjct  72   DNGREKLKRHRIEVAGNVWIPDIWGQEELLKDWIDCSAFNDSLVPHGIMSARAALVEEGR  131

Query  357  THSHSNTLRLDN  392
              ++S   R++N
Sbjct  132  R-ANSGGFRIEN  142



>ref|XP_008442840.1| PREDICTED: uncharacterized protein LOC103486607 [Cucumis melo]
Length=156

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  195  LKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTHSHSN  374
            LKRHR E+AGRVWIPEIWGQEELLKDW+DC  FDA    T I  AR AL+E+    +++ 
Sbjct  90   LKRHRREMAGRVWIPEIWGQEELLKDWIDCSAFDACLFPTGIGSARAALVEE-RRRANNG  148

Query  375  TLRLDNTC  398
             L L+N C
Sbjct  149  GLTLENRC  156



>ref|XP_004494053.1| PREDICTED: uncharacterized protein LOC101497497 [Cicer arietinum]
Length=131

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIIL-ARTALMED  350
            GRERLKRHR E+ GRVWIP+IWGQEE LKDW+DC  FD   +  N IL ARTAL+E+
Sbjct  67   GRERLKRHRVEMGGRVWIPDIWGQEEFLKDWIDCTVFDPPLLPANKILTARTALVEE  123



>gb|KJB55629.1| hypothetical protein B456_009G085900 [Gossypium raimondii]
Length=143

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR EVAGRV +P+ WG+EELLKDW+D   FD+    T +  AR ALM +  
Sbjct  70   DSGRERLKRHREEVAGRVLVPDKWGKEELLKDWMDYSSFDSLLAPTGLASARKALMTEGR  129

Query  357  THSHSNTLRLDNTC  398
              S    +R+ + C
Sbjct  130  RSSSQRLMRIQSMC  143



>emb|CDY23232.1| BnaA04g05270D [Brassica napus]
Length=137

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            GRE+LK HR E+AGRVWIPEIWGQEELLKDW+DC  FD   +   I  AR AL+E+
Sbjct  63   GREKLKHHRREMAGRVWIPEIWGQEELLKDWIDCSTFDTCLVPNGISSARAALVEE  118



>ref|XP_009148738.1| PREDICTED: uncharacterized protein LOC103872141 [Brassica rapa]
Length=137

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            GRE+LK HR E+AGRVWIPEIWGQEELLKDW+DC  FD   +   I  AR AL+E+
Sbjct  63   GREKLKHHRREMAGRVWIPEIWGQEELLKDWIDCSTFDTCLVPNGISSARAALVEE  118



>gb|KGN59130.1| hypothetical protein Csa_3G776900 [Cucumis sativus]
Length=157

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  195  LKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTHSHSN  374
            LKRHR E+AGRVWIP+IWGQEELLKDW+DC  FDA    T I  AR AL+E+    +++ 
Sbjct  91   LKRHRREMAGRVWIPDIWGQEELLKDWIDCSAFDACLFPTGIGSARAALVEE-RRRANNG  149

Query  375  TLRLDNTC  398
             L L+N C
Sbjct  150  GLTLENRC  157



>ref|XP_003581199.1| PREDICTED: uncharacterized protein LOC100823432 [Brachypodium 
distachyon]
Length=151

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 11/82 (13%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH-  362
            RERLKRHR E+AG+VW+PE+WGQE+LLKDW+DC  FD   +   ++ AR AL+ ++    
Sbjct  69   RERLKRHRREMAGKVWVPELWGQEKLLKDWMDCSAFDRPLVPAGLLTARRALVAESCARR  128

Query  363  ----------SHSNTLRLDNTC  398
                      S S  LR+ N C
Sbjct  129  RPAPTPRASCSASPPLRVQNGC  150



>ref|XP_004161241.1| PREDICTED: uncharacterized protein LOC101223869 [Cucumis sativus]
Length=91

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  195  LKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTHSHSN  374
            LKRHR E+AGRVWIP+IWGQEELLKDW+DC  FDA    T I  AR AL+E+    +++ 
Sbjct  25   LKRHRREMAGRVWIPDIWGQEELLKDWIDCSAFDACLFPTGIGSARAALVEE-RRRANNG  83

Query  375  TLRLDNTC  398
             L L+N C
Sbjct  84   GLTLENRC  91



>dbj|BAJ89637.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 67/127 (53%), Gaps = 8/127 (6%)
 Frame = +3

Query  42   PPAATTNSSCSQEVVGGENQSKR-SVRESGDaeaevaaaavavaveDCGRERLKRHRGEV  218
            P AA   SS     V  + Q+ R S  +      ++   A      +  RERLKRHR E+
Sbjct  32   PVAANATSSDHHAAVAAQEQAGRMSTSKEKREAGKLLQPADKEEEGESARERLKRHRREM  91

Query  219  AGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT-------TTHSHSNT  377
            AGRVW+PE+WGQE+LLKDW+DC  FD   +   ++ AR AL+ ++          + S  
Sbjct  92   AGRVWVPEMWGQEKLLKDWMDCSAFDRPLVPAGLLTARRALVAESCARRPAPAPRASSGP  151

Query  378  LRLDNTC  398
            LR+ + C
Sbjct  152  LRVQDGC  158



>ref|XP_006384813.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa]
 gb|ERP62610.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa]
Length=147

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            DCGRERLKRHR EVAGRV IP+ WGQE LLKDW+DC  FD       I  AR AL+
Sbjct  77   DCGRERLKRHREEVAGRVMIPDTWGQENLLKDWIDCSTFDELLAPKEISSAREALV  132



>gb|ACA35272.1| unknown protein [Cucumis sativus]
Length=222

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 49/67 (73%), Gaps = 1/67 (1%)
 Frame = +3

Query  192  RLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTHSHS  371
            RLKRHR E+AGRVWIP+IWGQEELLKDW+DC  FDA    T I  AR AL+E+    +++
Sbjct  91   RLKRHRREMAGRVWIPDIWGQEELLKDWIDCSAFDACLFPTGIGSARAALVEE-RRRANN  149

Query  372  NTLRLDN  392
              L L+N
Sbjct  150  GGLTLEN  156



>ref|XP_006384814.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa]
 gb|ERP62611.1| hypothetical protein POPTR_0004s21310g [Populus trichocarpa]
Length=190

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            DCGRERLKRHR EVAGRV IP+ WGQE LLKDW+DC  FD       I  AR AL+ +
Sbjct  118  DCGRERLKRHREEVAGRVMIPDTWGQENLLKDWIDCSTFDELLAPKEISSAREALVAE  175



>ref|XP_002446410.1| hypothetical protein SORBIDRAFT_06g015560 [Sorghum bicolor]
 gb|EES10738.1| hypothetical protein SORBIDRAFT_06g015560 [Sorghum bicolor]
Length=209

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            RERLKRHR E+AGRVW+PE+WGQE+LLKDWVDC  FD   + T ++ AR AL+
Sbjct  120  RERLKRHRREMAGRVWVPEMWGQEKLLKDWVDCAVFDRPMVPTGLLTARRALI  172



>ref|NP_001052737.1| Os04g0412100 [Oryza sativa Japonica Group]
 emb|CAD40657.2| OSJNBa0073L04.6 [Oryza sativa Japonica Group]
 dbj|BAF14651.1| Os04g0412100 [Oryza sativa Japonica Group]
 dbj|BAG98331.1| unnamed protein product [Oryza sativa Japonica Group]
Length=217

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            +  RERLKRHR E+AGRVW+P++WGQE+LLKDWVDC  FD   +  +++ AR AL+
Sbjct  120  ESARERLKRHRREMAGRVWVPDMWGQEKLLKDWVDCAAFDRPLVPPDLLTARRALV  175



>gb|EAZ30668.1| hypothetical protein OsJ_14724 [Oryza sativa Japonica Group]
Length=193

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            +  RERLKRHR E+AGRVW+P++WGQE+LLKDWVDC  FD   +  +++ AR AL+
Sbjct  96   ESARERLKRHRREMAGRVWVPDMWGQEKLLKDWVDCAAFDRPLVPPDLLTARRALV  151



>ref|XP_008671321.1| PREDICTED: uncharacterized protein LOC103648675 [Zea mays]
Length=177

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 11/82 (13%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH-  362
            RERLKRHR E+AGRVW+PE+WGQE+LLKDWVD   FD   + T ++ AR AL+ +  T  
Sbjct  95   RERLKRHRREMAGRVWVPEMWGQEKLLKDWVDYAVFDRPLVATGLLTARRALIAECCTRR  154

Query  363  ----------SHSNTLRLDNTC  398
                      + SN LR+ N C
Sbjct  155  PDRAAAASSSTSSNPLRVRNGC  176



>ref|XP_007015821.1| Uncharacterized protein TCM_041417 [Theobroma cacao]
 gb|EOY33440.1| Uncharacterized protein TCM_041417 [Theobroma cacao]
Length=155

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR EVAGRV IP+ WG+EELLKDW+D   FD+      +  AR ALM +  
Sbjct  83   DSGRERLKRHREEVAGRVLIPDKWGKEELLKDWIDYPSFDSLLAPNGLASARKALMMEGR  142

Query  357  THSHSNTLRLDNTC  398
             +  S  LR+ + C
Sbjct  143  RNG-SQRLRIQSMC  155



>ref|XP_004975560.1| PREDICTED: uncharacterized protein LOC101762913 [Setaria italica]
Length=184

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            RERLKRHR E+AGRVW+PE+WGQE+LLKDWVDC  FD   +   +  AR AL+
Sbjct  102  RERLKRHRREMAGRVWVPELWGQEKLLKDWVDCAVFDRPLVPAGLPTARRALI  154



>ref|XP_009150271.1| PREDICTED: uncharacterized protein LOC103873611 [Brassica rapa]
Length=132

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT---  353
            GRERLKRHR EVAG+V IPE WG+E LL  W+D   FDA + ++ I+ AR ALM D    
Sbjct  56   GRERLKRHREEVAGKVPIPESWGKEGLLVGWMDFSTFDASFTSSQIVSARAALMADAGDD  115

Query  354  --TTHSHSNTLRLDNTC  398
                 S +  LR++++C
Sbjct  116  PGARESRAQRLRVESSC  132



>ref|XP_006826648.1| hypothetical protein AMTR_s00139p00102470 [Amborella trichopoda]
 gb|ERM93885.1| hypothetical protein AMTR_s00139p00102470 [Amborella trichopoda]
Length=137

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERL++HR  VAG+VWIPE WGQEELLK+WVDC   D   M   ++ AR AL+E+    
Sbjct  66   GRERLQKHRMMVAGKVWIPETWGQEELLKEWVDCGAIDRSLMPNGLVSARNALVEE-CRR  124

Query  363  SHSNTLRLDNT  395
            + S++L +D T
Sbjct  125  AGSSSLEIDLT  135



>tpg|DAA37922.1| TPA: hypothetical protein ZEAMMB73_953930 [Zea mays]
Length=182

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 11/82 (13%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH-  362
            RERLKRHR E+AGRVW+PE+WGQE+LLKDWVD   FD   + T ++ AR AL+ +  T  
Sbjct  100  RERLKRHRREMAGRVWVPEMWGQEKLLKDWVDYAVFDRPLVATGLLTARRALIAECCTRR  159

Query  363  ----------SHSNTLRLDNTC  398
                      + SN LR+ N C
Sbjct  160  PDRAAAASSSTSSNPLRVRNGC  181



>ref|XP_011007089.1| PREDICTED: uncharacterized protein LOC105112884 isoform X2 [Populus 
euphratica]
Length=148

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            DCGRERLKRHR EVAG V IP+ WGQE LLKDW+DC  FD       I  AR AL+
Sbjct  78   DCGRERLKRHREEVAGGVMIPDTWGQENLLKDWIDCSTFDELLAPKEISSAREALV  133



>ref|XP_011007079.1| PREDICTED: uncharacterized protein LOC105112884 isoform X1 [Populus 
euphratica]
Length=150

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            DCGRERLKRHR EVAG V IP+ WGQE LLKDW+DC  FD       I  AR AL+
Sbjct  78   DCGRERLKRHREEVAGGVMIPDTWGQENLLKDWIDCSTFDELLAPKEISSAREALV  133



>ref|XP_006487941.1| PREDICTED: uncharacterized protein LOC102609694 [Citrus sinensis]
Length=162

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            GRERLKRHR EVAGRV IP+ WGQE LLK+W+DC  F+A  +   I  AR AL+ D
Sbjct  84   GRERLKRHREEVAGRVLIPDTWGQEGLLKNWIDCSAFEALMVPNKIASARKALVAD  139



>emb|CDX95368.1| BnaC04g27900D [Brassica napus]
Length=134

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT  353
            GR++LK+HR E+AGRVWIPE WGQE+LLKDW+DC  FD   +   I  AR+AL+E+ 
Sbjct  60   GRDKLKQHRREMAGRVWIPERWGQEDLLKDWIDCSKFDTCLVPNGISSARSALVEEA  116



>ref|XP_007206836.1| hypothetical protein PRUPE_ppa027026mg [Prunus persica]
 gb|EMJ08035.1| hypothetical protein PRUPE_ppa027026mg [Prunus persica]
Length=91

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  180  CGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTAL-MEDTT  356
             GRERLKRH+ EVAGRV IP+ W QEELLKDW+D   FDA  +   +  AR AL ME   
Sbjct  18   SGRERLKRHQEEVAGRVTIPDSWDQEELLKDWIDYSPFDALLVPKGLTSAREALAMEGRR  77

Query  357  THSHSNTLRLDNTC  398
              S    LR+++ C
Sbjct  78   ASSSQGVLRIESRC  91



>ref|NP_001143077.1| uncharacterized protein LOC100275550 [Zea mays]
 gb|ACG28806.1| hypothetical protein [Zea mays]
 gb|ACG30288.1| hypothetical protein [Zea mays]
Length=173

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 12/83 (14%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH-  362
            R+RLKRHR E+AGRVW+PE WGQE+LLKDWVDC  FD   +   ++ AR AL+ +  T  
Sbjct  90   RDRLKRHRREMAGRVWVPETWGQEKLLKDWVDCAVFDRPMVPMGLLTARRALIAECCTRR  149

Query  363  -----------SHSNTLRLDNTC  398
                       S SN LR+ N C
Sbjct  150  PDRAASSSSSTSSSNPLRVRNGC  172



>ref|XP_002523802.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38528.1| conserved hypothetical protein [Ricinus communis]
Length=140

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            DCGRERLK+HR EVAG+V IP+ WGQE+LLKDW+DC  FD       I  AR AL+
Sbjct  64   DCGRERLKKHREEVAGQVLIPDTWGQEDLLKDWIDCSSFDKSLAPDGIASARQALV  119



>ref|XP_009390031.1| PREDICTED: uncharacterized protein LOC103976522 [Musa acuminata 
subsp. malaccensis]
Length=145

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            + GRERLKRHR E+AGRVWIPE WGQE  LKDW+D   FD   +   ++ AR AL+E   
Sbjct  73   ESGRERLKRHRMEMAGRVWIPETWGQENRLKDWIDSSVFDRPLVPKGLVSAREALVE-AC  131

Query  357  THSHSNTLRLDNTC  398
              + S + ++ N C
Sbjct  132  RRTSSRSRQIRNPC  145



>gb|KFK33881.1| hypothetical protein AALP_AA5G072300 [Arabis alpina]
Length=125

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERLKRHR EVAG+V IPE WG+E LL  W+D   FDA + +  I+ AR ALM D    
Sbjct  51   GRERLKRHREEVAGKVPIPESWGKEGLLMGWMDFSAFDAAFTSNQIVSARAALMADAGDD  110

Query  363  S---HSNTLRLDNTC  398
            +    S  LR++ +C
Sbjct  111  AGARGSQRLRVETSC  125



>ref|XP_002877340.1| hypothetical protein ARALYDRAFT_484861 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53599.1| hypothetical protein ARALYDRAFT_484861 [Arabidopsis lyrata subsp. 
lyrata]
Length=116

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT---  353
            GRERLKRHR EVAG+V IP+ WG+E LL  W+D   FDA + ++ I+ AR ALM D    
Sbjct  40   GRERLKRHREEVAGKVPIPDSWGKEGLLMGWMDFSTFDAAFTSSQIVSARAALMADAGDD  99

Query  354  --TTHSHSNTLRLDNTC  398
              T  S    LR++++C
Sbjct  100  AGTRGSRPQRLRVESSC  116



>gb|AFW58185.1| hypothetical protein ZEAMMB73_804767 [Zea mays]
Length=183

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 12/83 (14%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH-  362
            R+RLKRHR E+AGRVW+PE WGQE+LLKDWVDC  FD   +   ++ AR AL+ +  T  
Sbjct  100  RDRLKRHRREMAGRVWVPETWGQEKLLKDWVDCAVFDRPMVPMGLLTARRALIAECCTRR  159

Query  363  -----------SHSNTLRLDNTC  398
                       S SN LR+ N C
Sbjct  160  PDRAASSSSSTSSSNPLRVRNGC  182



>ref|XP_010425861.1| PREDICTED: uncharacterized protein LOC104710906 [Camelina sativa]
Length=122

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT---  353
            GRERLKRHR EVAG+V IP+ WG+E LL  W+D   FDA + ++ I+ AR ALM D    
Sbjct  46   GRERLKRHRDEVAGKVPIPDSWGKEGLLMGWMDFSAFDAAFTSSQIVSARAALMADAGDD  105

Query  354  --TTHSHSNTLRLDNTC  398
                 S    LR++++C
Sbjct  106  AGARGSRPQRLRVESSC  122



>ref|XP_006292063.1| hypothetical protein CARUB_v10018258mg [Capsella rubella]
 gb|EOA24961.1| hypothetical protein CARUB_v10018258mg [Capsella rubella]
Length=118

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT---  353
            GRERLKRHR EVAG+V IP+ WG+E LL  W+D   FDA + ++ I+ AR ALM D    
Sbjct  42   GRERLKRHREEVAGKVPIPDSWGKEGLLMGWMDFSAFDASFTSSQIVSARAALMADAGDD  101

Query  354  --TTHSHSNTLRLDNTC  398
                 S    LR++++C
Sbjct  102  AGARGSRPQRLRVESSC  118



>ref|XP_006424244.1| hypothetical protein CICLE_v10029406mg [Citrus clementina]
 gb|ESR37484.1| hypothetical protein CICLE_v10029406mg [Citrus clementina]
 gb|KDO58077.1| hypothetical protein CISIN_1g030990mg [Citrus sinensis]
Length=168

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 49/78 (63%), Gaps = 7/78 (9%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED-----  350
            RERLKRHR EVAGRV IP+ WGQE LLK+W+DC  F+A  +   I  AR AL+ D     
Sbjct  91   RERLKRHREEVAGRVLIPDTWGQEGLLKNWIDCSAFEALMVPNKIASARKALVADNRGSP  150

Query  351  --TTTHSHSNTLRLDNTC  398
              + T +    LR+++ C
Sbjct  151  RASNTTTSLQQLRIESRC  168



>emb|CCH47172.1| hypothetical protein [Lupinus angustifolius]
Length=139

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDC-CGFDAYWMNTNIILARTALMEDT  353
            D  RERLK+HR EVAGRVWIPEIWGQE  L DW+DC   F  + + + I  A+ AL+E+ 
Sbjct  66   DSERERLKKHRVEVAGRVWIPEIWGQENFLMDWIDCTTAFHVHLVPSKITTAQEALVEEG  125

Query  354  TTHSHSNTLRLDNTC  398
               + S  L ++N C
Sbjct  126  KKVNASG-LSIENRC  139



>ref|XP_009347784.1| PREDICTED: uncharacterized protein LOC103939425 [Pyrus x bretschneideri]
Length=137

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTAL-MEDT  353
            + GRERLKRH+ EVAG V IP+ WGQEELLKDW+D   FDA  +   +  AR AL ME  
Sbjct  63   NSGRERLKRHQEEVAGHVVIPDSWGQEELLKDWIDYSPFDALLVPKGLTSAREALAMEGR  122

Query  354  TTHSHSNTLRLDNTC  398
               +    LR+++ C
Sbjct  123  RATTSQEVLRIESRC  137



>ref|XP_008228608.1| PREDICTED: uncharacterized protein LOC103327996 [Prunus mume]
Length=138

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  180  CGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTAL-MEDTT  356
             GRERLK+H+ EVAGRV IP+ W QEELLKDW+D   FDA  +   +  AR AL ME   
Sbjct  65   SGRERLKKHQEEVAGRVAIPDSWDQEELLKDWIDYSPFDALLVPKGLTSAREALAMEGRR  124

Query  357  THSHSNTLRLDNTC  398
              S    LR+++ C
Sbjct  125  ASSSQGVLRIESRC  138



>ref|XP_008351289.1| PREDICTED: uncharacterized protein LOC103414699 [Malus domestica]
Length=137

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTAL-MEDT  353
            + GRERLKRH+ EVAG V IP+ WGQEELLKDW+D   FDA  +   +  AR AL ME  
Sbjct  63   NSGRERLKRHQEEVAGHVVIPDSWGQEELLKDWIDYSPFDALLVPKGLTSAREALAMEGR  122

Query  354  TTHSHSNTLRLDNTC  398
               +    LR+++ C
Sbjct  123  RATTSQGVLRIESRC  137



>ref|XP_010503097.1| PREDICTED: uncharacterized protein LOC104780294 [Camelina sativa]
Length=122

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT---  353
            GRERLKRHR EVAG+V IP+ WG+E LL  W+D   FDA + ++ I+ AR ALM D    
Sbjct  46   GRERLKRHRDEVAGKVPIPDSWGKEGLLMGWMDFSAFDAAFTSSQIVSARAALMVDAGDD  105

Query  354  --TTHSHSNTLRLDNTC  398
                 S    LR++++C
Sbjct  106  AGARGSRPQRLRVESSC  122



>emb|CDY30933.1| BnaA06g19800D [Brassica napus]
Length=132

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT---  353
            GRERLKRHR EVAG+V IPE W +E LL  W+D   FDA + ++ I+ AR ALM D    
Sbjct  56   GRERLKRHREEVAGKVPIPESWDKEGLLVGWMDFSTFDASFTSSQIVSARAALMADAGDD  115

Query  354  --TTHSHSNTLRLDNTC  398
                 S +  LR++++C
Sbjct  116  PGARESRAQRLRVESSC  132



>ref|XP_010535696.1| PREDICTED: uncharacterized protein LOC104810919 [Tarenaya hassleriana]
Length=154

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            GRERLKRHR E+AG+V IPE WG+E LLK+W+D   FD+ + +  +  AR +LM D+T
Sbjct  74   GRERLKRHREEIAGKVSIPEKWGKEGLLKNWMDFSVFDSAFTSNQVFSARASLMADST  131



>ref|XP_004954965.1| PREDICTED: uncharacterized protein LOC101759245, partial [Setaria 
italica]
Length=109

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 50/83 (60%), Gaps = 9/83 (11%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNT-NIILARTALMEDT  353
            +  RERLKRHR E+AGRV IPE+WGQE LLKDWVDC  FD     T  ++ AR AL+ + 
Sbjct  26   ESARERLKRHRTEMAGRVRIPEMWGQERLLKDWVDCAVFDRPLAATAGLLTARDALVAEC  85

Query  354  TTH-----SHSNT---LRLDNTC  398
                    SH  T   LR+ N C
Sbjct  86   AAARRPAVSHGPTGRPLRVQNGC  108



>ref|XP_006404461.1| hypothetical protein EUTSA_v10011075mg [Eutrema salsugineum]
 gb|ESQ45914.1| hypothetical protein EUTSA_v10011075mg [Eutrema salsugineum]
Length=135

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 5/77 (6%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTH  362
            GRERLKRHR EVAG+V IPE WG+E LL  W+D   FDA + ++ I+ AR AL+ D    
Sbjct  59   GRERLKRHREEVAGKVPIPESWGKEGLLMGWMDFSAFDAAFTSSQIVSARAALIADAVDD  118

Query  363  S-----HSNTLRLDNTC  398
            +         LR++ +C
Sbjct  119  AGDRGRRPQRLRVETSC  135



>ref|NP_190031.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB86923.1| putative protein [Arabidopsis thaliana]
 gb|AAS99657.1| At3g44450 [Arabidopsis thaliana]
 gb|AAT41797.1| At3g44450 [Arabidopsis thaliana]
 gb|AEE77904.1| uncharacterized protein AT3G44450 [Arabidopsis thaliana]
Length=116

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT---  353
            GR+RLKRHR EVAG+V IP+ WG+E LL  W+D   FDA + ++ I+ AR ALM D+   
Sbjct  40   GRDRLKRHREEVAGKVPIPDSWGKEGLLMGWMDFSTFDAAFTSSQIVSARAALMADSGDD  99

Query  354  --TTHSHSNTLRLDNTC  398
                 S    LR++++C
Sbjct  100  AGARGSRPQRLRVESSC  116



>ref|NP_001047026.1| Os02g0532800 [Oryza sativa Japonica Group]
 dbj|BAD28423.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08940.1| Os02g0532800 [Oryza sativa Japonica Group]
Length=195

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 48/80 (60%), Gaps = 8/80 (10%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIIL-ARTALMEDTTT  359
             RERLKRHR E+AGRV IPE+WGQE LLKDWVDC  FD     T  +L AR AL+ +   
Sbjct  115  ARERLKRHRTEMAGRVRIPEMWGQERLLKDWVDCAVFDRPLAATRGLLTARDALVAECAA  174

Query  360  HSH-------SNTLRLDNTC  398
             +        +  LR+ N C
Sbjct  175  PARRPPHGPTARPLRVQNGC  194



>gb|EAY86148.1| hypothetical protein OsI_07521 [Oryza sativa Indica Group]
Length=195

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 48/80 (60%), Gaps = 8/80 (10%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIIL-ARTALMEDTTT  359
             RERLKRHR E+AGRV IPE+WGQE LLKDWVDC  FD     T  +L AR AL+ +   
Sbjct  115  ARERLKRHRTEMAGRVRIPEMWGQERLLKDWVDCAVFDRPLAATRGLLTARDALVAECAA  174

Query  360  HSH-------SNTLRLDNTC  398
             +        +  LR+ N C
Sbjct  175  PARRPPHGPTARPLRVQNGC  194



>ref|XP_002312818.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa]
 gb|ABK95162.1| unknown [Populus trichocarpa]
 gb|EEE86773.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa]
Length=139

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            D GRERLK+HR EVAGRV IP+ WGQE+ LKDW+DC  FD       I  AR +L+
Sbjct  67   DSGRERLKKHREEVAGRVMIPDTWGQEDSLKDWIDCSAFDELLAPNGISSARESLV  122



>ref|XP_011459330.1| PREDICTED: uncharacterized protein LOC105349931 [Fragaria vesca 
subsp. vesca]
Length=128

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTAL-MEDTTT  359
            GRERLKRH+ EVAG V IP+ WGQEELLKDW+D   FDA  + T +  AR AL ME    
Sbjct  53   GRERLKRHQEEVAGHVTIPDSWGQEELLKDWIDYSPFDALLVPTGLSSAREALAMEGRRR  112

Query  360  HSHSN---TLRLDNTC  398
             S++N    +R+++ C
Sbjct  113  ASNNNAQGVMRIESRC  128



>ref|XP_011000930.1| PREDICTED: uncharacterized protein LOC105108346 [Populus euphratica]
Length=140

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            D GRERLK+HR EVAGRV IP+ WGQE+ LKDW+DC  FD       I  AR +L+
Sbjct  68   DSGRERLKKHREEVAGRVMIPDTWGQEDSLKDWIDCSAFDELLAPNGISSARESLV  123



>ref|XP_006379365.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa]
 gb|ERP57162.1| hypothetical protein POPTR_0009s16550g [Populus trichocarpa]
Length=156

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            D GRERLK+HR EVAGRV IP+ WGQE+ LKDW+DC  FD       I  AR +L+
Sbjct  67   DSGRERLKKHREEVAGRVMIPDTWGQEDSLKDWIDCSAFDELLAPNGISSARESLV  122



>gb|EAZ23308.1| hypothetical protein OsJ_07004 [Oryza sativa Japonica Group]
Length=196

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 48/80 (60%), Gaps = 8/80 (10%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIIL-ARTALMEDTTT  359
             RERLKRHR E+AGRV IPE+WGQE LLKDWVDC  FD     T  +L AR AL+ +   
Sbjct  116  ARERLKRHRTEMAGRVRIPEMWGQERLLKDWVDCAVFDRPLAATRGLLTARDALVAECAA  175

Query  360  HSH-------SNTLRLDNTC  398
             +        +  LR+ N C
Sbjct  176  PARRPPHGPTARPLRVQNGC  195



>ref|XP_002452201.1| hypothetical protein SORBIDRAFT_04g021680 [Sorghum bicolor]
 gb|EES05177.1| hypothetical protein SORBIDRAFT_04g021680 [Sorghum bicolor]
Length=184

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 52/83 (63%), Gaps = 11/83 (13%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFD-AYWMNTNIILARTALMEDTTT  359
             RERLKRHR E+AGRV IP++WGQE LLKDWVDC  FD      T ++ AR AL+ +  T
Sbjct  101  ARERLKRHRTEMAGRVRIPDMWGQERLLKDWVDCAVFDRPLAATTGLLNARDALVAECAT  160

Query  360  H-------SHSNT---LRLDNTC  398
                    SH++T   LR+ N C
Sbjct  161  ARRPGPAVSHASTGRPLRVHNGC  183



>ref|XP_010514778.1| PREDICTED: uncharacterized protein LOC104790697 [Camelina sativa]
Length=202

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT---  353
            GRERLKRHR EVAG+V IP+ WG+E LL  W+D   FDA + ++ I+ AR ALM D    
Sbjct  126  GRERLKRHRDEVAGKVPIPDSWGKEGLLMGWMDFSAFDAAFTSSQIVSARAALMADAGDD  185

Query  354  --TTHSHSNTLRLDNTC  398
                 S    LR++++C
Sbjct  186  AGARGSRPQRLRVESSC  202



>ref|XP_010907937.1| PREDICTED: uncharacterized protein LOC105034456 [Elaeis guineensis]
Length=123

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            DCGR+RL+RH  E A  + IP+ WGQ  LLKDW DC  F  Y++   I  AR AL+E+  
Sbjct  51   DCGRQRLRRHSFETARSICIPDTWGQAGLLKDWKDCSAFSTYFIPKGIATAREALVEE-F  109

Query  357  THSHSNTLRLDNTC  398
              + S  L+++N C
Sbjct  110  RRADSARLKVENRC  123



>ref|XP_003575071.1| PREDICTED: uncharacterized protein LOC100845821 [Brachypodium 
distachyon]
Length=142

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIIL-ARTALMEDTTT  359
             RERLKRHR E+AGRV IP++WGQE LLKDWVDC  FD     T  +L AR AL+ +   
Sbjct  66   ARERLKRHRTEMAGRVRIPDMWGQERLLKDWVDCAVFDRPLAATRGLLTARDALVAERAA  125

Query  360  HSHSNTLR  383
               + T R
Sbjct  126  QRRTTTAR  133



>ref|XP_002523801.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38527.1| conserved hypothetical protein [Ricinus communis]
Length=168

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR EVAG V IP+ W QE LL+DW+D   FD       + LAR AL+ +  
Sbjct  88   DNGRERLKRHREEVAGEVRIPDKWSQESLLRDWMDYSSFDKLLAPEGLGLAREALITEAR  147

Query  357  T--HSHSNTLRLDNTC*LHFF  413
                S S  LR+ + C L  F
Sbjct  148  RGGGSSSQRLRIGSRCFLMNF  168



>ref|XP_004149256.1| PREDICTED: uncharacterized protein LOC101217932 [Cucumis sativus]
 ref|XP_004165127.1| PREDICTED: uncharacterized LOC101217932 [Cucumis sativus]
 gb|KGN46948.1| hypothetical protein Csa_6G152340 [Cucumis sativus]
Length=123

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTHS  365
            RERLKRHR EVAG+V +PE WG+EELLKDW+D   FD       I  AR +L  +   +S
Sbjct  53   RERLKRHREEVAGKVMVPEKWGKEELLKDWIDYSAFDRILAAGRIASARASLAAEGQRNS  112

Query  366  HSNTLRLDNTC  398
              +  R+++ C
Sbjct  113  RRSWRRVESRC  123



>gb|KDP33126.1| hypothetical protein JCGZ_13573 [Jatropha curcas]
Length=141

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +3

Query  180  CGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
             GRERLKRHR EVAG+V IPE W QE  LKDWVD   FD       I  AR ALM +
Sbjct  79   VGRERLKRHREEVAGQVSIPETWSQENFLKDWVDYSSFDNLLAPNGIASARQALMAE  135



>ref|XP_002312817.2| hypothetical protein POPTR_0009s16560g [Populus trichocarpa]
 gb|EEE86772.2| hypothetical protein POPTR_0009s16560g [Populus trichocarpa]
Length=159

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  180  CGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
             GRERLKRHR EV+G+V IPE WGQE+LL DW+D   FD       I  AR AL+
Sbjct  90   TGRERLKRHREEVSGKVMIPETWGQEDLLTDWIDYSSFDKLLAPDGITSAREALI  144



>ref|XP_002523800.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38526.1| conserved hypothetical protein [Ricinus communis]
Length=166

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERLKRHR EVAG V IP+ W QE LL+DW+D   FD       + LAR AL+ +  
Sbjct  90   DNGRERLKRHREEVAGEVRIPDKWSQESLLRDWMDYSSFDKLLAPKGLSLAREALIAEAH  149

Query  357  THSHSNTLRL  386
                S++ RL
Sbjct  150  RGGSSSSQRL  159



>ref|XP_010045208.1| PREDICTED: uncharacterized protein LOC104433977 [Eucalyptus grandis]
 gb|KCW87372.1| hypothetical protein EUGRSUZ_B03851 [Eucalyptus grandis]
Length=176

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            GRE+LKRHR EVAGRV IP+ WGQE  LKDW+D   FD       I  AR ALM +
Sbjct  101  GREKLKRHRDEVAGRVPIPDSWGQESFLKDWMDYSAFDTLLAPRGIAPAREALMAE  156



>ref|XP_008809927.1| PREDICTED: uncharacterized protein LOC103721474 [Phoenix dactylifera]
Length=123

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D GRERL+RHR E+A  + I + WGQE LLKDW DC  F   ++   I  AR AL+ +  
Sbjct  51   DSGRERLRRHRFEMARSICISDTWGQESLLKDWTDCSAFSTSFIPKGIASAREALVAEFR  110

Query  357  THSHSNTLRLDNTC  398
              S S  L+++N C
Sbjct  111  RAS-SKGLKVENRC  123



>ref|XP_010089822.1| hypothetical protein L484_022338 [Morus notabilis]
 gb|EXB38438.1| hypothetical protein L484_022338 [Morus notabilis]
Length=155

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 7/80 (9%)
 Frame = +3

Query  180  CGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT--  353
             G +R+KRHR EVAGRV +P+ WG+EEL+KDW+D   FD   + + +  AR AL+ +   
Sbjct  75   SGGDRMKRHREEVAGRVVVPDRWGKEELMKDWIDYSSFDKVLVPSGVRSAREALVMEAPR  134

Query  354  -----TTHSHSNTLRLDNTC  398
                 ++   S  LR++  C
Sbjct  135  RQATGSSSPASQRLRMERRC  154



>ref|XP_006384815.1| hypothetical protein POPTR_0004s21320g [Populus trichocarpa]
 gb|ERP62612.1| hypothetical protein POPTR_0004s21320g [Populus trichocarpa]
Length=159

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM-EDTTT  359
            GRERLKRHR EV+G+V IP+ WGQE LL DW+D   FD       I  AR AL+ E    
Sbjct  87   GRERLKRHREEVSGKVMIPDTWGQENLLTDWIDYSSFDKLLAPKGITSAREALVAEGRRA  146

Query  360  HSHSNTLRLDNTC  398
             +    L ++++C
Sbjct  147  RTSHQRLGVESSC  159



>ref|XP_008458586.1| PREDICTED: uncharacterized protein LOC103497945 [Cucumis melo]
Length=118

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +3

Query  180  CG-RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            CG RERLKRHR EVAG+V +P+ WG+EELLKDW+D   FD       I  AR +L  +
Sbjct  47   CGVRERLKRHREEVAGKVTVPDKWGKEELLKDWIDYSAFDRILAAGRIASARASLAAE  104



>gb|KGN48263.1| hypothetical protein Csa_6G452640 [Cucumis sativus]
Length=130

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  195  LKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTTHSHSN  374
            LKRHR  VAG VWIP+ WG+EE LKDW+D   F+A   ++ I+ AR AL  D    S +N
Sbjct  47   LKRHRMAVAGHVWIPDKWGKEEFLKDWIDGSAFEASLFHSGIVSARCALARDAKRLSPNN  106



>emb|CDP06927.1| unnamed protein product [Coffea canephora]
Length=108

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            + GRE+L RH  EVAGRV IPEIWGQE  L DW+DC  FD+       + AR AL+ +  
Sbjct  10   ESGREKLFRHWNEVAGRVCIPEIWGQEASLNDWMDCSLFDSLLAPKGAVSAREALIAERK  69

Query  357  THSHSNTLRLD  389
              S  + ++++
Sbjct  70   RDSTRHLMKME  80



>ref|NP_001142587.1| uncharacterized protein LOC100274851 [Zea mays]
 gb|ACG25294.1| hypothetical protein [Zea mays]
 gb|ACN29091.1| unknown [Zea mays]
Length=180

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 44/77 (57%), Gaps = 9/77 (12%)
 Frame = +3

Query  195  LKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNT-NIILARTALMEDTTTH---  362
            LKRHR E+AGRV IPE+WGQE LLKDWVDC  FD     T  ++ AR AL+ +       
Sbjct  103  LKRHRTEMAGRVRIPEMWGQERLLKDWVDCAVFDRPLAATAGLLTARDALVAECAAARRP  162

Query  363  -----SHSNTLRLDNTC  398
                 S    LR+ N C
Sbjct  163  AVSHGSAGRPLRVHNGC  179



>gb|EPS58384.1| hypothetical protein M569_16431, partial [Genlisea aurea]
Length=63

 Score = 65.1 bits (157),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT  353
            G E+L+ HR  VAGR+ +P+ WGQEE LKDW+DC  FDA  +++ +  A+  L+ D 
Sbjct  1    GLEKLEMHRSAVAGRISVPDAWGQEEFLKDWIDCTVFDAPIVSSRVSTAKALLIGDV  57



>ref|NP_001142972.1| uncharacterized protein LOC100275425 [Zea mays]
 gb|ACG27990.1| hypothetical protein [Zea mays]
Length=174

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 44/78 (56%), Gaps = 10/78 (13%)
 Frame = +3

Query  195  LKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNT-NIILARTALMEDTTTH---  362
            LKRHR E+AGRV IPE+WGQE LLKDWVDC  FD     T  ++ AR AL+ +       
Sbjct  96   LKRHRTEMAGRVRIPEMWGQERLLKDWVDCAVFDRPLAATAGLLTARDALVAECVAARRR  155

Query  363  ------SHSNTLRLDNTC  398
                  S    LR+ N C
Sbjct  156  PAVSHGSAGRPLRVHNGC  173



>ref|XP_004487496.1| PREDICTED: uncharacterized protein LOC101505815 [Cicer arietinum]
Length=138

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDA-YWMNTNIILARTALMEDTTT  359
            GRE+LKRHR EV G++ +P+ W +E++LK+WVD   FDA +  +  I++AR AL+ED   
Sbjct  69   GREKLKRHREEVKGKIELPKNWEKEKMLKEWVDYTTFDASFAPHKLIVIARDALIEDARK  128

Query  360  HSHSNTLRL  386
             + S  LR+
Sbjct  129  -ARSQRLRI  136



>ref|XP_008681577.1| PREDICTED: uncharacterized protein LOC100274851 isoform X1 [Zea 
mays]
 gb|AFW71675.1| hypothetical protein ZEAMMB73_625537 [Zea mays]
Length=231

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 44/77 (57%), Gaps = 9/77 (12%)
 Frame = +3

Query  195  LKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNT-NIILARTALMEDTTTH---  362
            LKRHR E+AGRV IPE+WGQE LLKDWVDC  FD     T  ++ AR AL+ +       
Sbjct  154  LKRHRTEMAGRVRIPEMWGQERLLKDWVDCAVFDRPLAATAGLLTARDALVAECAAARRP  213

Query  363  -----SHSNTLRLDNTC  398
                 S    LR+ N C
Sbjct  214  AVSHGSAGRPLRVHNGC  230



>ref|NP_001241197.1| uncharacterized protein LOC100810928 [Glycine max]
 gb|ACU24021.1| unknown [Glycine max]
 gb|KHN27647.1| hypothetical protein glysoja_026214 [Glycine soja]
Length=139

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 1/60 (2%)
 Frame = +3

Query  177  DCGRERLKRHRGEVA-GRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDT  353
            + GRERLKR R EV   +V IPE WGQE  LKDW+D   FDA++ ++ I+ AR AL+ +T
Sbjct  71   ETGRERLKRLREEVTMEKVNIPENWGQEPKLKDWMDYTMFDAFFPHSLIVTARDALIANT  130



>ref|XP_003596820.1| Soft fertilization envelope protein [Medicago truncatula]
 gb|AES67071.1| hypothetical protein MTR_2g086480 [Medicago truncatula]
Length=305

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 56/103 (54%), Gaps = 14/103 (14%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDA--YWMNTNIILARTALMEDTT  356
            GRERLKRHR E+ G+V +PE W +E+ LK+WVD   FDA  +  +  I+ AR AL+ D  
Sbjct  75   GRERLKRHREEMKGKVKVPENWEKEQKLKEWVDYTTFDALIFAPHALIVTARDALIAD--  132

Query  357  THSHSNTLRLDNTC*LHFFTFSICLSFLSLSNISVFSITTNAK  485
                   +R      LH  +      F  LS+   FS+T +A+
Sbjct  133  -------VRKSRPRELHLIS---ARPFSVLSSAQPFSMTRSAR  165



>ref|NP_001238535.1| uncharacterized protein LOC100500466 [Glycine max]
 gb|ACU15554.1| unknown [Glycine max]
 gb|KHN32875.1| hypothetical protein glysoja_038804 [Glycine soja]
Length=141

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +3

Query  180  CGRERLKRHRGEVA-GRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
             GRERLKR R EV   +V IPE WGQE  LKDW+D   FDA++ +T I+ AR AL+
Sbjct  74   TGRERLKRLREEVTMDKVNIPENWGQEPKLKDWMDYTMFDAFFPHTLIVTARDALI  129



>ref|XP_008809941.1| PREDICTED: uncharacterized protein LOC103721477 [Phoenix dactylifera]
Length=119

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            D GRERL+RHR E+A  + +P+ W QE LLKDW D   F   +++  I  AR AL+E+
Sbjct  51   DSGRERLRRHRFEMARSICMPDTWEQEGLLKDWTDSSAFSTSFVSKGIASAREALVEE  108



>ref|XP_002275909.1| PREDICTED: uncharacterized protein LOC100246831 [Vitis vinifera]
Length=127

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTT  356
            D  R+RL+RH  EV G+V IP+ WG+E+LLK+W+D   FDA      I +AR AL+    
Sbjct  55   DSVRQRLRRHWSEVGGKVLIPDKWGKEDLLKEWIDYSSFDALLAPNGIGVAREALVA-AG  113

Query  357  THSHSNTLRLDNTC  398
              + +  LR+ + C
Sbjct  114  RGASTQGLRISSRC  127



>ref|XP_010313363.1| PREDICTED: uncharacterized protein LOC104644771 [Solanum lycopersicum]
Length=168

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = +3

Query  180  CGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMEDTTT  359
             GRE+LKRH  EV GRV++P+ WG E  L++W+DC  FD       +  AR ALM     
Sbjct  94   SGREKLKRHWREVGGRVFVPDRWGHEGSLREWMDCSSFDNILAPKGLKSAREALMSQGKR  153

Query  360  HSHSNTLRL  386
                +T R+
Sbjct  154  ARSGSTSRM  162



>gb|ABK22013.1| unknown [Picea sitchensis]
Length=157

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
             RERL+ +R +VAG VWIP+ WG E+ LKDW D   FD +     +  ARTAL+ED
Sbjct  89   ARERLQNYRLQVAGNVWIPDTWGYEDRLKDWADPNDFDIHSNGLVMQSARTALIED  144



>emb|CAN67239.1| hypothetical protein VITISV_004804 [Vitis vinifera]
Length=920

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/56 (50%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +3

Query  177  DCGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
            D  R+RL+RH  EV G+V IP+ WG+E+LLK+W+D   FDA      I +AR AL+
Sbjct  716  DSVRQRLRRHWSEVGGKVLIPDKWGKEDLLKEWIDYSSFDALLAPNGIGVAREALV  771



>gb|AFG64787.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64788.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64789.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64790.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64791.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64792.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64793.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64794.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64795.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64796.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64797.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64798.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64799.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64800.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64801.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
 gb|AFG64802.1| hypothetical protein 0_18838_01, partial [Pinus taeda]
Length=112

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +3

Query  183  GRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
             RERL+ +R +VAG VWIP+ WG E+ LKDW D   FD +     +  ARTAL+E+
Sbjct  43   ARERLQNYRLQVAGNVWIPDTWGYEDRLKDWADPKVFDLHSNGLVMQSARTALIEE  98



>gb|AEW08098.1| hypothetical protein 0_18838_01, partial [Pinus radiata]
Length=112

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALMED  350
            RERL+ +R +VAG VWIP+ WG E+ LKDW D   FD +     +  ARTAL+E+
Sbjct  44   RERLQNYRLQVAGNVWIPDTWGYEDRLKDWADPKVFDHHSNGLVMQSARTALIEE  98



>ref|XP_009795844.1| PREDICTED: uncharacterized protein LOC104242489 [Nicotiana sylvestris]
Length=138

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  180  CGRERLKRHRGEVAGRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIILARTALM  344
             GRE+LKRH  +V GRV++PE WGQE  L++W+D   FD       +  AR AL+
Sbjct  62   SGREKLKRHWTKVGGRVFVPEKWGQEGNLREWMDYSSFDTLLAPKGLNSAREALI  116



>ref|XP_007150069.1| hypothetical protein PHAVU_005G123800g [Phaseolus vulgaris]
 gb|ESW22063.1| hypothetical protein PHAVU_005G123800g [Phaseolus vulgaris]
Length=131

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +3

Query  183  GRERLKRHRGEVA-GRVWIPEIWGQEELLKDWVDCCGFDAYWMNTNIIL-ARTAL  341
            GRE+LKR R EV   ++ IPE WGQE+ LKDW+D   FDA+    ++I+ AR AL
Sbjct  67   GREKLKRLREEVMMEKISIPEDWGQEQKLKDWIDYTVFDAFLAPHSLIVSARDAL  121



>gb|EPS67524.1| hypothetical protein M569_07255, partial [Genlisea aurea]
Length=74

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 39/73 (53%), Gaps = 9/73 (12%)
 Frame = +3

Query  186  RERLKRHRGEVAGRVWIPEIWG-QEELLKDWVD-------CCGFDAYWMNTNIIL-ARTA  338
            RER+ RHR EV+GR  IPE WG +EEL KDW+D                NT II+ AR A
Sbjct  1    RERMTRHRSEVSGRSRIPEAWGKEEELFKDWLDDPSSSSSAAAAFMSSSNTRIIMSARAA  60

Query  339  LMEDTTTHSHSNT  377
            L E+ T      T
Sbjct  61   LAEEQTNGRRRRT  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555143417780