BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN038P20

Length=602
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618592.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    145   3e-63   Nicotiana tomentosiformis
ref|XP_009785468.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    145   5e-63   Nicotiana sylvestris
gb|EYU44192.1|  hypothetical protein MIMGU_mgv1a013253mg                142   3e-62   Erythranthe guttata [common monkey flower]
ref|XP_004252860.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    144   3e-62   
ref|XP_006365808.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    144   5e-62   
gb|KJB80515.1|  hypothetical protein B456_013G101000                    142   3e-61   Gossypium raimondii
ref|XP_011098741.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    139   9e-61   Sesamum indicum [beniseed]
ref|XP_007045631.1|  Ribosomal protein L6 family                        141   2e-60   Theobroma cacao [chocolate]
ref|XP_003548187.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    139   4e-60   Glycine max [soybeans]
gb|ACU23468.1|  unknown                                                 138   6e-60   Glycine max [soybeans]
gb|KHN42547.1|  50S ribosomal protein L6, chloroplastic                 139   7e-60   Glycine soja [wild soybean]
gb|KHG21050.1|  50S ribosomal L6, chloroplastic -like protein           139   1e-59   Gossypium arboreum [tree cotton]
ref|XP_008455431.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    130   3e-59   Cucumis melo [Oriental melon]
ref|XP_003534001.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    137   4e-59   Glycine max [soybeans]
ref|XP_011005106.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    139   5e-59   Populus euphratica
ref|XP_002320459.1|  ribosomal protein L6                               138   7e-59   Populus trichocarpa [western balsam poplar]
ref|XP_002279657.2|  PREDICTED: 50S ribosomal protein L6, chlorop...    138   1e-58   Vitis vinifera
ref|XP_004144493.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    127   2e-58   Cucumis sativus [cucumbers]
ref|XP_004514093.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    131   6e-58   Cicer arietinum [garbanzo]
ref|XP_010522339.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    134   6e-58   Tarenaya hassleriana [spider flower]
gb|AFK43716.1|  unknown                                                 135   1e-57   Medicago truncatula
ref|XP_010557010.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    130   4e-57   Tarenaya hassleriana [spider flower]
ref|XP_008379631.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    132   5e-57   Malus domestica [apple tree]
gb|ACU19091.1|  unknown                                                 135   8e-57   Glycine max [soybeans]
ref|XP_008223584.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    134   1e-56   Prunus mume [ume]
gb|KDP25836.1|  hypothetical protein JCGZ_22866                         131   1e-56   Jatropha curcas
ref|XP_007223925.1|  hypothetical protein PRUPE_ppa011034mg             133   2e-56   Prunus persica
ref|XP_010689735.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    126   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006418054.1|  hypothetical protein EUTSA_v10008693mg             130   5e-56   Eutrema salsugineum [saltwater cress]
ref|XP_009401055.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    123   8e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008342000.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    129   1e-55   
ref|XP_010276744.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    123   2e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010100629.1|  50S ribosomal protein L6                           124   3e-55   Morus notabilis
ref|XP_007152280.1|  hypothetical protein PHAVU_004G116200g             130   3e-55   Phaseolus vulgaris [French bean]
ref|XP_004287942.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    129   5e-55   Fragaria vesca subsp. vesca
ref|XP_010243082.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    120   7e-55   Nelumbo nucifera [Indian lotus]
ref|XP_002892273.1|  EMB2394                                            125   2e-54   
ref|XP_010051031.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    120   4e-54   Eucalyptus grandis [rose gum]
ref|XP_009353272.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    126   5e-54   Pyrus x bretschneideri [bai li]
ref|XP_006304184.1|  hypothetical protein CARUB_v10010237mg             124   5e-54   Capsella rubella
ref|XP_010484767.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    124   7e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010457601.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    123   9e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006447548.1|  hypothetical protein CICLE_v10016578mg             125   1e-53   Citrus clementina [clementine]
emb|CDY46838.1|  BnaA10g03220D                                          124   1e-53   Brassica napus [oilseed rape]
ref|NP_172011.1|  50S ribosomal protein L6                              124   1e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDY70611.1|  BnaAnng34360D                                          124   2e-53   Brassica napus [oilseed rape]
ref|XP_009119188.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    124   2e-53   Brassica rapa
ref|XP_010907839.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    119   2e-53   Elaeis guineensis
ref|XP_010475192.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    121   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_003557902.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    121   3e-53   Brachypodium distachyon [annual false brome]
ref|XP_006650092.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    121   1e-52   Oryza brachyantha
dbj|BAJ92513.1|  predicted protein                                      121   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY49511.1|  BnaC05g03230D                                          120   2e-52   Brassica napus [oilseed rape]
dbj|BAJ84917.1|  predicted protein                                      122   3e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001050139.1|  Os03g0356300                                       121   3e-52   
gb|EAZ26952.1|  hypothetical protein OsJ_10878                          121   4e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051292.1|  Os03g0751400                                       120   4e-52   
dbj|BAJ91776.1|  predicted protein                                      121   5e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG25590.1|  50S ribosomal protein L6                                119   1e-51   Zea mays [maize]
gb|EMT33559.1|  50S ribosomal protein L6, chloroplastic                 120   1e-51   
ref|XP_009118616.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    117   2e-51   Brassica rapa
emb|CDY06163.1|  BnaA09g50400D                                          117   2e-51   
dbj|BAH20405.1|  AT1G05190                                              116   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002465260.1|  hypothetical protein SORBIDRAFT_01g035090          118   6e-51   Sorghum bicolor [broomcorn]
gb|EMS56589.1|  50S ribosomal protein L6, chloroplastic                 120   6e-51   Triticum urartu
ref|XP_004984341.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    120   1e-50   Setaria italica
ref|NP_001148555.1|  50S ribosomal protein L6                           118   1e-49   Zea mays [maize]
emb|CDP19076.1|  unnamed protein product                                120   5e-49   Coffea canephora [robusta coffee]
ref|NP_001152325.1|  50S ribosomal protein L6                           118   6e-49   Zea mays [maize]
gb|KDO41664.1|  hypothetical protein CISIN_1g027306mg                   111   2e-48   Citrus sinensis [apfelsine]
gb|EPS61113.1|  hypothetical protein M569_13685                         109   5e-48   Genlisea aurea
ref|XP_006858065.1|  hypothetical protein AMTR_s00062p00057610          110   6e-47   Amborella trichopoda
gb|ABK21300.1|  unknown                                                 115   2e-46   Picea sitchensis
ref|XP_008680805.1|  PREDICTED: 50S ribosomal protein L6 isoform X1     107   1e-45   Zea mays [maize]
ref|XP_008802994.1|  PREDICTED: 50S ribosomal protein L6, chlorop...    121   3e-42   
ref|XP_002979598.1|  hypothetical protein SELMODRAFT_110948             105   1e-39   
ref|XP_002977678.1|  hypothetical protein SELMODRAFT_107348             105   1e-38   
gb|KEH16126.1|  50S ribosomal protein L6                                114   4e-37   Medicago truncatula
ref|XP_006376781.1|  hypothetical protein POPTR_0012s06340g             103   6e-37   
emb|CDY41816.1|  BnaC02g12270D                                          108   3e-34   Brassica napus [oilseed rape]
ref|XP_006376783.1|  hypothetical protein POPTR_0012s06360g           87.4    4e-30   
ref|XP_005849229.1|  hypothetical protein CHLNCDRAFT_34831            90.5    9e-30   Chlorella variabilis
gb|KIZ02220.1|  50S ribosomal protein L6                              85.9    1e-27   Monoraphidium neglectum
ref|XP_011399322.1|  50S ribosomal protein L6, chloroplastic          79.3    9e-27   Auxenochlorella protothecoides
ref|XP_001421323.1|  Plastid ribosomal protein L6 large ribosomal...  88.2    9e-26   Ostreococcus lucimarinus CCE9901
ref|WP_015227140.1|  50S ribosomal protein L6                         87.8    3e-25   Halothece sp. PCC 7418
ref|WP_015118729.1|  50S ribosomal protein L6                         90.5    5e-25   Rivularia sp. PCC 7116
ref|WP_015231117.1|  50S ribosomal protein L6                         87.4    8e-25   Dactylococcopsis salina
emb|CEG01824.1|  Ribosomal protein L6, conserved site                 89.4    2e-24   Ostreococcus tauri
tpg|DAA45423.1|  TPA: hypothetical protein ZEAMMB73_235465              103   2e-24   
ref|WP_036002394.1|  50S ribosomal protein L6                         85.1    2e-24   [Leptolyngbya] sp. JSC-1
ref|XP_005643355.1|  ribosomal protein L6                             83.6    2e-24   Coccomyxa subellipsoidea C-169
ref|WP_022605574.1|  50S ribosomal protein L6                         85.1    3e-24   Rubidibacter lacunae
ref|WP_015186046.1|  50S ribosomal protein L6                         86.3    4e-24   Microcoleus sp. PCC 7113
ref|WP_017325553.1|  50S ribosomal protein L6                         79.7    7e-24   Synechococcus sp. PCC 7336
ref|WP_011612508.1|  50S ribosomal protein L6                         79.3    9e-24   Trichodesmium erythraeum
gb|AAP68351.1|  putative ribosomal protein CtrL6e, 5'-partial           101   9e-24   Oryza sativa Japonica Group [Japonica rice]
ref|WP_007472094.1|  50S ribosomal protein L6                         73.2    9e-24   Segniliparus rugosus
ref|WP_008191191.1|  50S ribosomal protein L6                         84.7    1e-23   Moorea producens
gb|ACN31842.1|  unknown                                                 101   1e-23   Zea mays [maize]
ref|WP_007356156.1|  MULTISPECIES: 50S ribosomal protein L6           84.3    1e-23   Kamptonema
ref|WP_010311645.1|  50S ribosomal protein L6                         79.0    1e-23   Synechococcus sp. CB0101
ref|WP_043368788.1|  50S ribosomal protein L6                         82.8    2e-23   Cyanobium sp. PCC 7001
ref|WP_020691491.1|  50S ribosomal protein L6                         73.6    2e-23   Aeromicrobium massiliense
ref|WP_015203286.1|  50S ribosomal protein L6                         83.6    2e-23   Crinalium epipsammum
ref|WP_006621330.1|  MULTISPECIES: 50S ribosomal protein L6           81.3    2e-23   Arthrospira
ref|WP_024125573.1|  50S ribosomal protein L6                         81.3    2e-23   Thermosynechococcus sp. NK55a
ref|XP_002505297.1|  predicted protein                                83.2    3e-23   Micromonas commoda
ref|WP_009782735.1|  50S ribosomal protein L6                         83.2    4e-23   Lyngbya sp. PCC 8106
ref|WP_025781338.1|  50S ribosomal protein L6                         80.1    6e-23   Candidatus Synechococcus spongiarum
ref|WP_023067381.1|  50S ribosomal protein L6                         82.4    6e-23   Lyngbya aestuarii
ref|WP_009767984.1|  50S ribosomal protein L6                         84.3    6e-23   Oscillatoriales cyanobacterium JSC-12
ref|WP_009543883.1|  MULTISPECIES: 50S ribosomal protein L6           82.8    6e-23   Cyanothece
ref|WP_011055950.1|  50S ribosomal protein L6                         81.3    6e-23   Thermosynechococcus
ref|WP_019500654.1|  50S ribosomal protein L6                         79.0    7e-23   Pseudanabaena sp. PCC 6802
ref|WP_030473453.1|  50S ribosomal protein L6                         72.0    8e-23   Lechevalieria
ref|XP_001784938.1|  predicted protein                                  102   8e-23   
ref|WP_012593618.1|  MULTISPECIES: 50S ribosomal protein L6           82.4    8e-23   Cyanothece
ref|WP_008275484.1|  50S ribosomal protein L6                         83.6    1e-22   Cyanothece sp. CCY0110
ref|WP_011628222.1|  50S ribosomal protein L6                         75.1    1e-22   Alkalilimnicola ehrlichii
ref|WP_036532292.1|  50S ribosomal protein L6                         81.3    1e-22   Neosynechococcus sphagnicola
ref|WP_006618086.1|  50S ribosomal protein L6                         81.3    2e-22   Arthrospira platensis
ref|WP_039717296.1|  50S ribosomal protein L6                         82.4    2e-22   
ref|WP_015170862.1|  50S ribosomal protein L6                         80.9    2e-22   Geitlerinema sp. PCC 7407
ref|WP_023071150.1|  50S ribosomal protein L6                         79.7    2e-22   Leptolyngbya sp. Heron Island J
ref|WP_043058732.1|  50S ribosomal protein L6                         79.0    2e-22   Enteractinococcus helveticum
ref|WP_028191074.1|  50S ribosomal protein L6                         78.6    2e-22   Salinispora arenicola
ref|XP_002966651.1|  hypothetical protein SELMODRAFT_6327             79.7    3e-22   
ref|XP_001771522.1|  predicted protein                                  100   3e-22   
ref|WP_018908047.1|  50S ribosomal protein L6                         77.0    3e-22   Salinispora arenicola
ref|WP_006100646.1|  50S ribosomal protein L6                         78.2    3e-22   Coleofasciculus chthonoplastes
ref|WP_015152288.1|  50S ribosomal protein L6                         82.8    3e-22   Cyanobacteria [blue-green bacteria]
ref|WP_029639091.1|  50S ribosomal protein L6                         73.2    4e-22   alpha proteobacterium Mf 1.05b.01
ref|WP_040788652.1|  50S ribosomal protein L6                         73.2    4e-22   Nocardia paucivorans
ref|WP_010469303.1|  MULTISPECIES: 50S ribosomal protein L6           85.9    4e-22   Acaryochloris
ref|WP_007073021.1|  50S ribosomal protein L6                         75.9    4e-22   Micromonospora sp. ATCC 39149
ref|WP_013735942.1|  50S ribosomal protein L6                         78.2    5e-22   Verrucosispora
ref|WP_015187428.1|  50S ribosomal protein L6                         84.3    5e-22   Gloeocapsa sp. PCC 7428
ref|WP_035830882.1|  50S ribosomal protein L6                         81.3    5e-22   
ref|WP_018400614.1|  50S ribosomal protein L6                         78.6    5e-22   filamentous cyanobacterium ESFC-1
emb|CCQ60081.1|  LSU ribosomal protein L6p (L9e)                      79.7    5e-22   Crocosphaera watsonii WH 0401
ref|WP_017659044.1|  50S ribosomal protein L6                         73.6    5e-22   Geitlerinema sp. PCC 7105
ref|WP_013139775.1|  50S ribosomal protein L6                         70.5    6e-22   Segniliparus rotundus
ref|WP_018682818.1|  50S ribosomal protein L6                         73.2    6e-22   Actinokineospora enzanensis
ref|WP_007306418.1|  50S ribosomal protein L6                         79.3    6e-22   Crocosphaera watsonii
ref|WP_034304256.1|  50S ribosomal protein L6                         74.7    6e-22   Amycolatopsis lurida
ref|WP_015105249.1|  50S ribosomal protein L6                         72.0    7e-22   Saccharothrix espanaensis
emb|CCQ65151.1|  LSU ribosomal protein L6p (L9e)                      79.3    7e-22   Crocosphaera watsonii WH 0402
ref|WP_012184316.1|  50S ribosomal protein L6                         77.0    7e-22   Salinispora arenicola
ref|XP_001696829.1|  plastid ribosomal protein L6                     81.3    7e-22   Chlamydomonas reinhardtii
ref|XP_003060321.1|  predicted protein                                86.7    8e-22   Micromonas pusilla CCMP1545
ref|WP_015805277.1|  50S ribosomal protein L6                         72.4    8e-22   Actinosynnema
ref|WP_017297633.1|  50S ribosomal protein L6                         74.7    9e-22   Nodosilinea nodulosa
ref|WP_030006185.1|  50S ribosomal protein L6                         80.9    1e-21   Synechococcus
ref|WP_027654160.1|  50S ribosomal protein L6                         79.0    1e-21   Salinispora pacifica
ref|WP_014349107.1|  50S ribosomal protein L6                         70.9    1e-21   Nocardia cyriacigeorgica
ref|WP_002787868.1|  50S ribosomal protein L6                         80.9    1e-21   Microcystis aeruginosa
ref|WP_007031044.1|  50S ribosomal protein L6                         74.7    1e-21   Amycolatopsis decaplanina
ref|WP_010314956.1|  50S ribosomal protein L6                         75.1    1e-21   Synechococcus sp. CB0205
ref|WP_011434166.1|  50S ribosomal protein L6                         88.2    1e-21   Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_012306676.1|  50S ribosomal protein L6                         80.9    1e-21   Synechococcus
ref|WP_035991895.1|  50S ribosomal protein L6                         73.6    1e-21   Leptolyngbya sp. KIOST-1
ref|WP_006515901.1|  50S ribosomal protein L6                         78.2    1e-21   Leptolyngbya sp. PCC 7375
ref|WP_039795552.1|  50S ribosomal protein L6                         72.8    2e-21   Nocardia araoensis
ref|WP_028479346.1|  50S ribosomal protein L6                         72.8    2e-21   Nocardia sp. CNY236
ref|WP_037332683.1|  50S ribosomal protein L6                         74.3    2e-21   Amycolatopsis sp. MJM2582
ref|WP_023358196.1|  50S ribosomal protein L6                         74.7    2e-21   Actinoplanes friuliensis
ref|WP_015109414.1|  50S ribosomal protein L6                         80.1    2e-21   Cyanobium gracile
ref|WP_036533248.1|  50S ribosomal protein L6                         71.6    2e-21   Nocardia cyriacigeorgica
ref|WP_011936544.1|  50S ribosomal protein L6                         83.6    2e-21   Synechococcus sp. RCC307
ref|WP_033081910.1|  50S ribosomal protein L6                         75.5    2e-21   Colwellia psychrerythraea
ref|WP_015136283.1|  50S ribosomal protein L6                         79.3    2e-21   Leptolyngbya sp. PCC 7376
ref|WP_012196215.1|  50S ribosomal protein L6                         78.2    2e-21   Prochlorococcus marinus
ref|WP_012111673.1|  50S ribosomal protein L6                         71.6    2e-21   Parvibaculum lavamentivorans
ref|WP_015218384.1|  50S ribosomal protein L6                         84.3    2e-21   Cyanobacterium aponinum
ref|WP_006634987.1|  50S ribosomal protein L6                         80.9    2e-21   Microcoleus vaginatus
ref|WP_015178716.1|  50S ribosomal protein L6                         80.9    2e-21   Oscillatoria nigro-viridis
ref|WP_030478310.1|  50S ribosomal protein L6                         70.5    2e-21   Lentzea albidocapillata
ref|WP_042104150.1|  50S ribosomal protein L6                         86.3    2e-21   Parachlamydiaceae bacterium HS-T3
ref|WP_010244377.1|  50S ribosomal protein L6                         75.9    2e-21   Peptoniphilus
ref|WP_015164363.1|  50S ribosomal protein L6                         81.3    2e-21   Pseudanabaena sp. PCC 7367
ref|WP_015141077.1|  50S ribosomal protein L6                         85.5    3e-21   Nostoc sp. PCC 7524
ref|WP_020633320.1|  50S ribosomal protein L6                         74.7    3e-21   Amycolatopsis alba
ref|WP_040864897.1|  50S ribosomal protein L6                         72.0    3e-21   Nocardia exalbida
ref|WP_039688659.1|  50S ribosomal protein L6                         82.4    3e-21   Coriobacteriaceae bacterium 68-1-3
ref|WP_043694887.1|  50S ribosomal protein L6                         77.4    3e-21   Synechococcus sp. KORDI-49
ref|WP_006512304.1|  50S ribosomal protein L6                         82.8    3e-21   Xenococcus sp. PCC 7305
ref|WP_043687380.1|  50S ribosomal protein L6                         72.8    3e-21   Nocardia abscessus
ref|WP_012799441.1|  50S ribosomal protein L6                         73.2    3e-21   Slackia heliotrinireducens
ref|WP_002780093.1|  50S ribosomal protein L6                         78.6    4e-21   Microcystis
ref|WP_020178178.1|  50S ribosomal protein L6                         79.0    4e-21   Methylopila sp. M107
ref|WP_010595601.1|  50S ribosomal protein L6                         71.2    4e-21   Rhodococcus
ref|WP_018720668.1|  50S ribosomal protein L6                         77.0    4e-21   Salinispora pacifica
ref|WP_002794624.1|  50S ribosomal protein L6                         78.6    4e-21   Microcystis aeruginosa
ref|WP_028322671.1|  50S ribosomal protein L6                         82.8    4e-21   Desulfatiglans anilini
ref|WP_002746609.1|  50S ribosomal protein L6                         79.0    4e-21   Microcystis aeruginosa
ref|WP_037270096.1|  50S ribosomal protein L6                         71.2    4e-21   Kibdelosporangium aridum
ref|WP_033436726.1|  50S ribosomal protein L6                         72.8    4e-21   Saccharothrix sp. NRRL B-16314
ref|WP_018729116.1|  50S ribosomal protein L6                         77.0    4e-21   Salinispora pacifica
ref|WP_015148984.1|  50S ribosomal protein L6                         81.3    4e-21   Oscillatoria acuminata
ref|WP_027649217.1|  50S ribosomal protein L6                         77.0    5e-21   Salinispora pacifica
ref|WP_002753903.1|  50S ribosomal protein L6                         78.6    5e-21   Microcystis aeruginosa
ref|WP_044565307.1|  50S ribosomal protein L6                         77.0    5e-21   Anaerococcus provencensis
ref|WP_035279546.1|  50S ribosomal protein L6                         74.3    5e-21   Actinokineospora
ref|WP_022871372.1|  50S ribosomal protein L6                         75.5    5e-21   Yaniella halotolerans
ref|WP_029254913.1|  50S ribosomal protein L6                         71.6    5e-21   Rhodococcus erythropolis
ref|WP_030532876.1|  MULTISPECIES: 50S ribosomal protein L6           72.0    5e-21   Prauserella rugosa
ref|WP_018801042.1|  50S ribosomal protein L6                         77.0    5e-21   Salinispora arenicola
ref|WP_002771057.1|  50S ribosomal protein L6                         78.6    5e-21   Microcystis aeruginosa
ref|WP_037314677.1|  50S ribosomal protein L6                         74.3    6e-21   Actinobacteria
ref|WP_020643212.1|  50S ribosomal protein L6                         72.8    6e-21   Amycolatopsis balhimycina
ref|WP_003940970.1|  MULTISPECIES: 50S ribosomal protein L6           71.6    6e-21   Rhodococcus
ref|WP_013127985.1|  50S ribosomal protein L6                         74.3    6e-21   Tsukamurella paurometabola
ref|WP_043965528.1|  50S ribosomal protein L6                         75.5    6e-21   Micromonospora carbonacea
ref|WP_011041466.1|  50S ribosomal protein L6                         75.9    6e-21   Colwellia
ref|WP_040833621.1|  50S ribosomal protein L6                         73.2    6e-21   Nocardia brevicatena
ref|WP_033428587.1|  50S ribosomal protein L6                         72.4    7e-21   Saccharothrix syringae
ref|WP_002796422.1|  50S ribosomal protein L6                         79.0    7e-21   Microcystis aeruginosa
ref|WP_018726241.1|  50S ribosomal protein L6                         76.6    7e-21   Salinispora pacifica
ref|WP_039727917.1|  MULTISPECIES: 50S ribosomal protein L6           73.9    7e-21   Lyngbya confervoides
ref|WP_026137931.1|  50S ribosomal protein L6                         70.5    7e-21   
ref|XP_009763796.1|  PREDICTED: 50S ribosomal protein L6, chlorop...  94.0    7e-21   Nicotiana sylvestris
ref|WP_006554596.1|  MULTISPECIES: 50S ribosomal protein L6           70.5    7e-21   Rhodococcus
ref|WP_026086027.1|  50S ribosomal protein L6                         86.7    7e-21   Fischerella muscicola
ref|WP_033094748.1|  50S ribosomal protein L6                         76.6    7e-21   Colwellia psychrerythraea
ref|YP_003734607.1|  ribosomal protein L6                             86.3    7e-21   Kryptoperidinium foliaceum
ref|WP_019107908.1|  50S ribosomal protein L6                         76.3    7e-21   Peptoniphilus senegalensis
ref|WP_018217052.1|  50S ribosomal protein L6                         76.6    7e-21   Salinispora pacifica
ref|WP_025616601.1|  50S ribosomal protein L6                         76.6    7e-21   Salinispora pacifica
ref|WP_027940987.1|  50S ribosomal protein L6                         72.8    7e-21   Amycolatopsis taiwanensis
ref|WP_040272340.1|  50S ribosomal protein L6                         70.5    7e-21   Rhodococcus ruber
ref|WP_002733352.1|  50S ribosomal protein L6                         78.6    7e-21   Microcystis aeruginosa
ref|WP_041054717.1|  50S ribosomal protein L6                         76.3    8e-21   Jeotgalibacillus campisalis
ref|WP_002757583.1|  50S ribosomal protein L6                         78.6    8e-21   Microcystis aeruginosa
ref|WP_020185777.1|  50S ribosomal protein L6                         76.3    8e-21   Methylopila sp. 73B
ref|WP_026099472.1|  50S ribosomal protein L6                         82.0    8e-21   Prochlorothrix hollandica
ref|WP_027844107.1|  50S ribosomal protein L6                         82.0    8e-21   Mastigocoleus testarum
ref|WP_015200868.1|  50S ribosomal protein L6                         83.2    8e-21   Calothrix parietina
ref|WP_014847225.1|  50S ribosomal protein L6                         69.7    8e-21   Pseudopropionibacterium propionicum
ref|WP_019174650.1|  50S ribosomal protein L6                         77.4    8e-21   Brevibacterium
ref|WP_008375943.1|  50S ribosomal protein L6                         70.9    9e-21   Gordonia malaquae
ref|WP_018784558.1|  50S ribosomal protein L6                         77.4    9e-21   Micromonospora
ref|WP_037816261.1|  MULTISPECIES: 50S ribosomal protein L6           73.9    9e-21   Actinobacteria
ref|WP_003938077.1|  50S ribosomal protein L6                         71.2    9e-21   Rhodococcus
ref|WP_018222588.1|  50S ribosomal protein L6                         77.0    9e-21   Salinispora pacifica
ref|WP_031712151.1|  50S ribosomal protein L6                         65.1    9e-21   Mycobacterium tuberculosis
ref|WP_005166793.1|  MULTISPECIES: 50S ribosomal protein L6           74.7    1e-20   Amycolatopsis
ref|WP_016331093.1|  50S ribosomal protein L6                         74.7    1e-20   Amycolatopsis
ref|WP_008312941.1|  50S ribosomal protein L6                         74.3    1e-20   Leptolyngbya sp. PCC 6406
ref|WP_012015113.1|  MULTISPECIES: 50S ribosomal protein L6           77.0    1e-20   Salinispora tropica
ref|YP_009092968.1|  ribosomal protein L6                             86.7    1e-20   Chaetoceros simplex
ref|WP_019124981.1|  50S ribosomal protein L6                         74.3    1e-20   Peptoniphilus
ref|WP_016694616.1|  50S ribosomal protein L6                         70.5    1e-20   Rhodococcus
ref|WP_031711030.1|  50S ribosomal protein L6                         65.1    1e-20   Mycobacterium tuberculosis
ref|WP_031586324.1|  50S ribosomal protein L6                         83.6    1e-20   Lachnospiraceae bacterium P6A3
ref|YP_009029516.1|  ribosomal protein L6                             85.1    1e-20   Lithodesmium undulatum
ref|WP_029127897.1|  50S ribosomal protein L6                         77.0    1e-20   Salinispora pacifica
ref|WP_043719879.1|  50S ribosomal protein L6                         72.0    1e-20   Nocardia asiatica
gb|AFE12033.1|  50S ribosomal protein L6                              65.1    1e-20   Mycobacterium tuberculosis RGTB423
ref|WP_022874123.1|  50S ribosomal protein L6                         75.9    1e-20   Arthrobacter sp. PAO19
ref|WP_028852098.1|  50S ribosomal protein L6                         72.8    1e-20   Thermocrispum municipale
ref|WP_015626848.1|  50S ribosomal protein L6                         65.1    1e-20   
ref|WP_008385401.1|  50S ribosomal protein L6                         73.6    1e-20   Rhodovulum sp. PH10
ref|WP_035156543.1|  50S ribosomal protein L6                         80.1    1e-20   Calothrix sp. 336/3
ref|WP_018252463.1|  50S ribosomal protein L6                         75.5    1e-20   Salinispora pacifica
ref|WP_003403673.1|  MULTISPECIES: 50S ribosomal protein L6           65.1    1e-20   Mycobacterium
ref|WP_006237995.1|  50S ribosomal protein L6                         70.1    1e-20   Saccharomonospora xinjiangensis
ref|WP_007465267.1|  50S ribosomal protein L6                         72.8    1e-20   Micromonospora lupini
ref|WP_024547142.1|  50S ribosomal protein L6                         78.2    1e-20   Synechococcus
ref|WP_028187530.1|  50S ribosomal protein L6                         76.6    1e-20   Salinispora pacifica
ref|WP_040774335.1|  50S ribosomal protein L6                         72.8    1e-20   Nocardia pneumoniae
ref|WP_031715051.1|  50S ribosomal protein L6                         64.7    1e-20   Mycobacterium tuberculosis
ref|WP_026424131.1|  50S ribosomal protein L6                         68.9    1e-20   Actinokineospora inagensis
ref|WP_042182741.1|  50S ribosomal protein L6                         71.6    1e-20   Kibdelosporangium sp. MJ126-NF4
ref|WP_024286973.1|  50S ribosomal protein L6                         75.1    1e-20   Cellulomonas sp. KRMCY2
ref|WP_019202351.1|  50S ribosomal protein L6                         73.6    2e-20   Tsukamurella sp. 1534
ref|WP_039806306.1|  MULTISPECIES: 50S ribosomal protein L6           74.3    2e-20   Jeotgalibacillus
ref|WP_009072324.1|  MULTISPECIES: 50S ribosomal protein L6           74.3    2e-20   Actinobacteria
ref|WP_026922777.1|  50S ribosomal protein L6                         69.3    2e-20   Glycomyces arizonensis
ref|WP_011932338.1|  50S ribosomal protein L6                         80.5    2e-20   
ref|WP_015195219.1|  50S ribosomal protein L6                         85.9    2e-20   
ref|WP_026929011.1|  50S ribosomal protein L6                         69.3    2e-20   
ref|WP_011244189.1|  MULTISPECIES: 50S ribosomal protein L6           76.6    2e-20   
ref|WP_007100630.1|  50S ribosomal protein L6                         77.8    2e-20   
ref|WP_009634242.1|  50S ribosomal protein L6                         82.0    2e-20   
ref|WP_010840030.1|  50S ribosomal protein L6                         66.6    2e-20   
ref|WP_006854814.1|  50S ribosomal protein L6                         80.5    2e-20   
ref|WP_013222612.1|  50S ribosomal protein L6                         72.8    2e-20   
ref|WP_032376650.1|  50S ribosomal protein L6                         67.8    2e-20   
gb|AHF62773.1|  50S ribosomal protein L6                              76.6    2e-20   
ref|WP_025777917.1|  50S ribosomal protein L6                         69.7    2e-20   
ref|WP_035015258.1|  50S ribosomal protein L6                         82.8    2e-20   
ref|WP_017286247.1|  50S ribosomal protein L6                         80.9    2e-20   
ref|WP_012410711.1|  50S ribosomal protein L6                         80.1    2e-20   
ref|WP_033291192.1|  50S ribosomal protein L6                         75.1    2e-20   
ref|WP_017986620.1|  50S ribosomal protein L6                         70.5    2e-20   
ref|WP_034243832.1|  50S ribosomal protein L6                         73.2    2e-20   
ref|WP_015113417.1|  50S ribosomal protein L6                         82.4    2e-20   
ref|WP_031333108.1|  50S ribosomal protein L6                         71.6    2e-20   
ref|WP_028026217.1|  50S ribosomal protein L6                         79.7    2e-20   
ref|WP_017314774.1|  50S ribosomal protein L6                         83.6    2e-20   
ref|WP_020417565.1|  MULTISPECIES: 50S ribosomal protein L6           70.5    2e-20   
ref|WP_013362395.1|  50S ribosomal protein L6 [                       89.4    2e-20   
ref|WP_019026711.1|  50S ribosomal protein L6                         73.2    2e-20   
ref|WP_026928237.1|  50S ribosomal protein L6                         75.5    2e-20   
ref|WP_013288623.1|  MULTISPECIES: 50S ribosomal protein L6           76.3    2e-20   
ref|WP_044096020.1|  50S ribosomal protein L6                         65.1    2e-20   
ref|WP_013420568.1|  MULTISPECIES: 50S ribosomal protein L6           68.6    3e-20   
ref|WP_029340048.1|  50S ribosomal protein L6                         73.2    3e-20   
ref|WP_039206324.1|  50S ribosomal protein L6                         69.7    3e-20   
ref|WP_019138783.1|  50S ribosomal protein L6                         78.6    3e-20   
ref|WP_009625476.1|  50S ribosomal protein L6                         73.9    3e-20   
ref|WP_006947161.1|  MULTISPECIES: 50S ribosomal protein L6           68.6    3e-20   
ref|WP_033231370.1|  50S ribosomal protein L6                         71.2    3e-20   
ref|WP_018347778.1|  50S ribosomal protein L6                         73.9    3e-20   
ref|WP_020662788.1|  50S ribosomal protein L6                         73.9    3e-20   
ref|WP_030427406.1|  50S ribosomal protein L6                         77.8    3e-20   
ref|WP_015144997.1|  50S ribosomal protein L6                         77.4    3e-20   
ref|WP_005453260.1|  50S ribosomal protein L6                         70.1    3e-20   
ref|WP_012785173.1|  50S ribosomal protein L6                         72.8    3e-20   
ref|WP_034266925.1|  50S ribosomal protein L6                         73.9    3e-20   
ref|WP_006895593.1|  50S ribosomal protein L6                         70.9    3e-20   
ref|WP_011363381.1|  50S ribosomal protein L6                         76.6    3e-20   
ref|WP_044841769.1|  50S ribosomal protein L6                         72.4    3e-20   
ref|WP_040716840.1|  50S ribosomal protein L6                         71.6    4e-20   
ref|WP_011952181.1|  MULTISPECIES: 50S ribosomal protein L6           72.4    4e-20   
ref|WP_041775860.1|  50S ribosomal protein L6                         70.1    4e-20   
ref|NP_043602.1|  ribosomal protein L6                                80.9    4e-20   
ref|WP_006173342.1|  50S ribosomal protein L6                         78.2    4e-20   
ref|WP_026844847.1|  50S ribosomal protein L6                         75.1    4e-20   
ref|WP_030329899.1|  50S ribosomal protein L6                         72.8    4e-20   
ref|WP_011826918.1|  50S ribosomal protein L6                         78.2    4e-20   
ref|WP_015619007.1|  50S ribosomal protein L6                         75.1    4e-20   
ref|WP_017310480.1|  MULTISPECIES: 50S ribosomal protein L6           84.7    4e-20   
ref|WP_026857028.1|  50S ribosomal protein L6                         71.6    4e-20   
ref|WP_031447972.1|  50S ribosomal protein L6                         74.3    4e-20   
ref|WP_042432900.1|  50S ribosomal protein L6                         81.6    4e-20   
ref|WP_038992188.1|  50S ribosomal protein L6                         76.3    4e-20   
ref|WP_006310548.1|  50S ribosomal protein L6                         83.6    4e-20   
ref|WP_003912916.1|  50S ribosomal protein L6                         63.2    4e-20   
gb|ACN31089.1|  unknown                                               92.0    4e-20   
ref|WP_011618388.1|  50S ribosomal protein L6                         79.0    4e-20   
ref|WP_011131113.1|  50S ribosomal protein L6                         77.8    4e-20   
ref|WP_029136109.1|  50S ribosomal protein L6                         71.6    5e-20   
ref|WP_026732530.1|  50S ribosomal protein L6                         87.8    5e-20   
ref|WP_038284745.1|  50S ribosomal protein L6                         76.6    5e-20   
ref|WP_036912668.1|  MULTISPECIES: 50S ribosomal protein L6           78.2    5e-20   
ref|WP_007167853.1|  50S ribosomal protein L6                         65.1    5e-20   
ref|WP_009679180.1|  50S ribosomal protein L6                         68.9    5e-20   
ref|WP_008547719.1|  MULTISPECIES: 50S ribosomal protein L6           71.6    5e-20   
ref|WP_026722080.1|  50S ribosomal protein L6                         84.0    5e-20   
ref|WP_013252444.1|  50S ribosomal protein L6                         79.0    5e-20   
ref|WP_018708745.1|  50S ribosomal protein L6                         77.8    5e-20   
ref|WP_016877819.1|  50S ribosomal protein L6                         80.9    5e-20   
ref|YP_009093384.1|  ribosomal protein L6                             83.2    5e-20   
ref|WP_026534034.1|  50S ribosomal protein L6                         73.2    5e-20   
ref|WP_043781945.1|  50S ribosomal protein L6                         72.8    5e-20   
ref|WP_019807076.1|  50S ribosomal protein L6                         70.5    5e-20   
ref|WP_030155107.1|  50S ribosomal protein L6                         69.3    5e-20   
ref|WP_025729639.1|  50S ribosomal protein L6                         79.3    5e-20   
ref|WP_006583247.1|  50S ribosomal protein L6                         80.1    5e-20   
ref|WP_031581248.1|  50S ribosomal protein L6                         65.1    6e-20   
ref|WP_008900997.1|  MULTISPECIES: 50S ribosomal protein L6           75.5    6e-20   
ref|WP_004558872.1|  50S ribosomal protein L6                         72.4    6e-20   
ref|WP_009233265.1|  MULTISPECIES: 50S ribosomal protein L6           72.0    6e-20   
ref|WP_041071978.1|  50S ribosomal protein L6                         81.6    6e-20   
ref|WP_040338539.1|  50S ribosomal protein L6                         71.6    6e-20   
emb|CDZ75245.1|  50S ribosomal protein L6                             77.8    6e-20   
ref|WP_011345176.1|  50S ribosomal protein L6                         80.5    6e-20   
ref|WP_011295459.1|  50S ribosomal protein L6                         77.8    6e-20   
ref|WP_011824506.1|  50S ribosomal protein L6                         77.8    6e-20   
ref|WP_024059752.1|  50S ribosomal protein L6                         75.1    7e-20   
ref|WP_020668412.1|  50S ribosomal protein L6                         73.2    7e-20   
ref|WP_016426362.1|  50S ribosomal protein L6                         79.0    7e-20   
ref|WP_015125765.1|  50S ribosomal protein L6                         72.8    7e-20   
ref|WP_038543126.1|  50S ribosomal protein L6                         75.5    7e-20   
ref|WP_016698502.1|  50S ribosomal protein L6                         74.7    7e-20   
ref|WP_003789306.1|  MULTISPECIES: 50S ribosomal protein L6           71.6    7e-20   
ref|WP_024800413.1|  50S ribosomal protein L6                         69.3    7e-20   
ref|WP_012835383.1|  50S ribosomal protein L6                         68.6    7e-20   
ref|WP_007023275.1|  MULTISPECIES: 50S ribosomal protein L6           70.1    7e-20   
ref|WP_031581709.1|  50S ribosomal protein L6                         82.0    7e-20   
ref|WP_016859434.1|  50S ribosomal protein L6                         84.0    8e-20   
ref|WP_012626776.1|  50S ribosomal protein L6                         72.0    8e-20   
ref|WP_006946061.1|  MULTISPECIES: 50S ribosomal protein L6           67.4    8e-20   
ref|WP_005957448.1|  50S ribosomal protein L6                         74.3    8e-20   
ref|WP_011128939.1|  50S ribosomal protein L6                         74.7    8e-20   
ref|WP_019737211.1|  50S ribosomal protein L6                         66.6    8e-20   
ref|WP_023463845.1|  50S ribosomal protein L6                         70.9    8e-20   
ref|WP_039754636.1|  50S ribosomal protein L6                         80.9    8e-20   
ref|WP_003920617.1|  50S ribosomal protein L6                         64.7    8e-20   
ref|WP_008197245.1|  50S ribosomal protein L6                         75.1    8e-20   
ref|WP_030489593.1|  50S ribosomal protein L6                         73.2    8e-20   
gb|KIJ83485.1|  50S ribosomal protein L6                              78.6    8e-20   
ref|WP_039708578.1|  50S ribosomal protein L6                         75.5    8e-20   
ref|WP_013504992.1|  50S ribosomal protein L6                         80.5    9e-20   
ref|WP_002563174.1|  MULTISPECIES: 50S ribosomal protein L6           80.9    9e-20   
ref|WP_036993698.1|  50S ribosomal protein L6                         76.6    9e-20   
ref|WP_023606974.1|  50S ribosomal protein L6                         82.0    9e-20   
ref|YP_009029385.1|  ribosomal protein L6                             79.0    9e-20   
ref|WP_027718581.1|  50S ribosomal protein L6                         76.6    9e-20   
ref|WP_006042218.1|  50S ribosomal protein L6                         77.4    1e-19   
ref|WP_041795568.1|  50S ribosomal protein L6                         73.9    1e-19   
ref|WP_036922402.1|  50S ribosomal protein L6                         77.0    1e-19   
ref|WP_038654337.1|  50S ribosomal protein L6                         75.5    1e-19   
ref|WP_033357653.1|  50S ribosomal protein L6                         71.2    1e-19   
ref|WP_029006292.1|  50S ribosomal protein L6                         77.4    1e-19   
ref|WP_003170020.1|  50S ribosomal protein L6                         77.0    1e-19   
ref|WP_040157837.1|  50S ribosomal protein L6                         67.8    1e-19   
ref|WP_005461363.1|  50S ribosomal protein L6                         69.3    1e-19   
ref|WP_005987248.1|  50S ribosomal protein L6                         73.9    1e-19   
ref|WP_006899636.1|  50S ribosomal protein L6                         69.3    1e-19   
ref|WP_028263476.1|  50S ribosomal protein L6                         80.9    1e-19   
ref|WP_006304521.1|  50S ribosomal protein L6                         84.3    1e-19   
gb|AHY04335.1|  50S ribosomal protein L6                              86.7    1e-19   
ref|WP_012869914.1|  50S ribosomal protein L6                         80.1    1e-19   
ref|WP_026419518.1|  50S ribosomal protein L6                         74.7    1e-19   
ref|WP_011314653.1|  50S ribosomal protein L6                         71.6    1e-19   
ref|WP_021127556.1|  50S ribosomal protein L6 [                       89.0    1e-19   
ref|WP_044304315.1|  50S ribosomal protein L6                         82.4    1e-19   
ref|WP_022740325.1|  50S ribosomal protein L6                         77.4    1e-19   
ref|WP_005007686.1|  50S ribosomal protein L6                         79.0    1e-19   
ref|WP_005518391.1|  50S ribosomal protein L6                         68.2    1e-19   
ref|WP_029635498.1|  50S ribosomal protein L6 [                       79.3    1e-19   
dbj|BAL55081.1|  50S ribosomal protein L6                             79.7    1e-19   
ref|WP_038551213.1|  50S ribosomal protein L6                         73.6    1e-19   
ref|WP_020401293.1|  50S ribosomal protein L6                         63.9    1e-19   
ref|WP_025361368.1|  50S ribosomal protein L6                         72.8    1e-19   
emb|CEK31218.1|  50S ribosomal protein L6 [ [                         89.0    1e-19   
ref|WP_035758067.1|  50S ribosomal protein L6                         73.2    1e-19   
ref|WP_019116572.1|  50S ribosomal protein L6                         79.3    1e-19   
ref|WP_022864706.1|  50S ribosomal protein L6                         75.1    1e-19   
ref|WP_004838115.1|  MULTISPECIES: 50S ribosomal protein L6           79.3    1e-19   
ref|WP_025783849.1|  50S ribosomal protein L6                         74.7    1e-19   
ref|WP_003781878.1|  MULTISPECIES: 50S ribosomal protein L6           70.5    1e-19   
ref|WP_036072870.1|  50S ribosomal protein L6                         77.8    1e-19   
ref|WP_019935865.1|  50S ribosomal protein L6                         87.4    1e-19   
ref|WP_025906786.1|  MULTISPECIES: 50S ribosomal protein L6           80.1    1e-19   
ref|WP_034877917.1|  50S ribosomal protein L6                         81.6    1e-19   
ref|WP_040485101.1|  50S ribosomal protein L6                         68.6    1e-19   
ref|WP_042002501.1|  50S ribosomal protein L6                         70.9    2e-19   
ref|WP_019707835.1|  50S ribosomal protein L6                         69.7    2e-19   
ref|WP_020176144.1|  50S ribosomal protein L6                         75.1    2e-19   
ref|WP_036466729.1|  50S ribosomal protein L6                         66.2    2e-19   
ref|WP_038604442.1|  50S ribosomal protein L6                         68.6    2e-19   
ref|WP_007540789.1|  50S ribosomal protein L6                         67.8    2e-19   
ref|WP_040284668.1|  50S ribosomal protein L6                         72.4    2e-19   
ref|WP_003886886.1|  50S ribosomal protein L6                         65.5    2e-19   
ref|WP_043503332.1|  50S ribosomal protein L6                         67.8    2e-19   
ref|WP_010185508.1|  50S ribosomal protein L6                         68.2    2e-19   
ref|WP_004273659.1|  50S ribosomal protein L6                         67.4    2e-19   
ref|WP_018084563.1|  50S ribosomal protein L6                         78.2    2e-19   
ref|WP_027503162.1|  50S ribosomal protein L6                         68.6    2e-19   
ref|WP_012589607.1|  50S ribosomal protein L6                         77.4    2e-19   
ref|WP_007773556.1|  MULTISPECIES: 50S ribosomal protein L6           66.6    2e-19   
ref|WP_022363031.1|  50S ribosomal protein L6                         79.3    2e-19   
ref|WP_005509895.1|  MULTISPECIES: 50S ribosomal protein L6           68.9    2e-19   
ref|WP_008859816.1|  50S ribosomal protein L6                         78.2    2e-19   
ref|WP_043466731.1|  50S ribosomal protein L6                         69.7    2e-19   
ref|WP_028953623.1|  50S ribosomal protein L6                         73.6    2e-19   
ref|WP_031937773.1|  50S ribosomal protein L6                         72.0    2e-19   
ref|WP_019191186.1|  50S ribosomal protein L6                         75.1    2e-19   
ref|WP_024353168.1|  50S ribosomal protein L6                         76.3    2e-19   
ref|WP_027496323.1|  MULTISPECIES: 50S ribosomal protein L6           67.8    2e-19   
ref|WP_015223447.1|  50S ribosomal protein L6                         81.6    2e-19   
ref|WP_005239658.1|  MULTISPECIES: 50S ribosomal protein L6           67.8    2e-19   
ref|WP_030436516.1|  50S ribosomal protein L6                         73.2    2e-19   
ref|WP_033244267.1|  MULTISPECIES: 50S ribosomal protein L6           73.9    2e-19   
ref|WP_018390615.1|  50S ribosomal protein L6                         78.6    2e-19   
ref|WP_039043307.1|  50S ribosomal protein L6                         73.9    2e-19   
ref|WP_015539823.1|  50S ribosomal protein L6                         77.0    2e-19   
gb|ELP44194.1|  50S ribosomal protein L6                              66.2    2e-19   
ref|WP_008410873.1|  50S ribosomal protein L6                         75.5    2e-19   
ref|WP_015780004.1|  50S ribosomal protein L6                         65.9    2e-19   
ref|WP_041085456.1|  50S ribosomal protein L6                         73.9    2e-19   
ref|WP_008945174.1|  50S ribosomal protein L6                         83.6    2e-19   
ref|WP_036748420.1|  50S ribosomal protein L6                         76.6    2e-19   
ref|WP_013324975.1|  50S ribosomal protein L6                         73.9    2e-19   
ref|WP_009300583.1|  50S ribosomal protein L6                         68.6    2e-19   
ref|WP_010871965.1|  50S ribosomal protein L6                         78.2    2e-19   
ref|WP_016998814.1|  50S ribosomal protein L6                         78.6    2e-19   
ref|WP_021431511.1|  MULTISPECIES: 50S ribosomal protein L6           87.8    2e-19   
ref|WP_022913997.1|  50S ribosomal protein L6                         72.0    2e-19   
ref|WP_039345443.1|  50S ribosomal protein L6                         72.4    2e-19   
ref|WP_011510068.1|  50S ribosomal protein L6                         73.2    2e-19   
ref|WP_004809043.1|  MULTISPECIES: 50S ribosomal protein L6           72.4    2e-19   
ref|WP_004685699.1|  50S ribosomal protein L6                         72.0    2e-19   
ref|WP_032397535.1|  50S ribosomal protein L6                         67.4    2e-19   
ref|WP_013830244.1|  50S ribosomal protein L6                         67.0    2e-19   
ref|WP_011133172.1|  50S ribosomal protein L6                         81.6    2e-19   
ref|WP_007531933.1|  50S ribosomal protein L6                         68.2    2e-19   
ref|WP_039965685.1|  50S ribosomal protein L6 [                       87.8    2e-19   
ref|WP_017296429.1|  50S ribosomal protein L6                         80.5    2e-19   
ref|WP_012954403.1|  50S ribosomal protein L6                         75.9    2e-19   
ref|WP_021798532.1|  50S ribosomal protein L6                         67.4    3e-19   
ref|WP_038036396.1|  50S ribosomal protein L6                         76.3    3e-19   
ref|WP_016309208.1|  50S ribosomal protein L6                         75.9    3e-19   
ref|WP_009076110.1|  50S ribosomal protein L6                         72.8    3e-19   
ref|WP_002844197.1|  MULTISPECIES: 50S ribosomal protein L6           85.1    3e-19   
ref|WP_028052639.1|  50S ribosomal protein L6                         78.6    3e-19   



>ref|XP_009618592.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Nicotiana 
tomentosiformis]
Length=227

 Score =   145 bits (367),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +  TSNLR  F+G  +G     + + R  FVRK VECKESRIGKQPI VPSNVT+ MEGQ
Sbjct  9    SLHTSNLRYPFVGSLNGFHVSSVAVRRVGFVRKVVECKESRIGKQPITVPSNVTLTMEGQ  68

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGE+ ITYPREVKLE+EE GVLRVRKAMETRR+
Sbjct  69   DLKVKGPLGEMAITYPREVKLEREEEGVLRVRKAMETRRA  108


 Score =   123 bits (309),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQLVGVGYRA VEGKDIVLNLGFSHPV+M IPDG
Sbjct  108  ANQMHGLFRTLTDNMVVGVSKGFEKKLQLVGVGYRATVEGKDIVLNLGFSHPVKMEIPDG  167

Query  593  LQV  601
            LQV
Sbjct  168  LQV  170



>ref|XP_009785468.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Nicotiana 
sylvestris]
Length=228

 Score =   145 bits (365),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +1

Query  124  TSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  303
            TSNLRS F+G  +G     + + R  FVRK VECKESRIGKQPI VPSNVT+ MEGQD K
Sbjct  13   TSNLRSPFVGSLNGFHVSSVAVRRVGFVRKVVECKESRIGKQPITVPSNVTLTMEGQDLK  72

Query  304  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            VKGPLGE+ ITYPREVKLE+EE G+LRVRKA+ETRR+
Sbjct  73   VKGPLGEMAITYPREVKLEREEEGILRVRKAVETRRA  109


 Score =   123 bits (309),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQLVGVGYRA VEGKDIVLNLGFSHPV+M IPDG
Sbjct  109  ANQMHGLFRTLTDNMVVGVSKGFEKKLQLVGVGYRATVEGKDIVLNLGFSHPVKMEIPDG  168

Query  593  LQV  601
            LQV
Sbjct  169  LQV  171



>gb|EYU44192.1| hypothetical protein MIMGU_mgv1a013253mg [Erythranthe guttata]
Length=226

 Score =   142 bits (359),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = +1

Query  124  TSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  303
            +S LRS F+G+ +GIR   ++  R   VRKTVECKESRIGKQPIPVPSNVT+ M+GQD K
Sbjct  11   SSYLRSAFLGETNGIRVSGISAPRLAVVRKTVECKESRIGKQPIPVPSNVTLVMDGQDLK  70

Query  304  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            VKGPLGEL ITYPRE+ L+K++SG+LRVRKA+ETRR+
Sbjct  71   VKGPLGELAITYPREILLDKDDSGILRVRKAVETRRA  107


 Score =   123 bits (308),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQLVG GYRA VEGKDIVLNLGFSHPVRM IPDG
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKKLQLVGTGYRATVEGKDIVLNLGFSHPVRMTIPDG  166

Query  593  LQV  601
            LQV
Sbjct  167  LQV  169



>ref|XP_004252860.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Solanum lycopersicum]
Length=257

 Score =   144 bits (362),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +   S LRS F+G  +G     + + R  FV KTVECKESRIGKQPI VPSNVT+ MEGQ
Sbjct  39   SLHASTLRSPFVGSLNGFHVSSVAVRRVGFVSKTVECKESRIGKQPISVPSNVTLTMEGQ  98

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGE+ ITYPREVKLEKE+ G+LRVRKAMETRR+
Sbjct  99   DLKVKGPLGEMAITYPREVKLEKEDGGILRVRKAMETRRA  138


 Score =   121 bits (304),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQLVGVGYRA +EGKDIVLNLGFSHPVRM +P G
Sbjct  138  ANQMHGLFRTLTDNMVVGVSKGFEKKLQLVGVGYRATIEGKDIVLNLGFSHPVRMEVPAG  197

Query  593  LQV  601
            LQV
Sbjct  198  LQV  200



>ref|XP_006365808.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Solanum 
tuberosum]
Length=227

 Score =   144 bits (362),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +  TS LRS F+G+ +G R   + + R  FVRK +ECKESRIGKQPI VPSNVT+ MEGQ
Sbjct  9    SLHTSTLRSPFVGNLNGFRVSSVAVRRVGFVRKMIECKESRIGKQPISVPSNVTLTMEGQ  68

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGE+ ITYPREVKLEK++ G+LRVRKA+ETRR+
Sbjct  69   DLKVKGPLGEMAITYPREVKLEKDDGGILRVRKAVETRRA  108


 Score =   121 bits (303),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQLVGVGYRA +EGKDIVLNLGFSHPVRM IP G
Sbjct  108  ANQMHGLFRTLTDNMVVGVSKGFEKKLQLVGVGYRATIEGKDIVLNLGFSHPVRMEIPAG  167

Query  593  LQV  601
            LQV
Sbjct  168  LQV  170



>gb|KJB80515.1| hypothetical protein B456_013G101000 [Gossypium raimondii]
Length=225

 Score =   142 bits (357),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +  TSNLRS F+G+ +GI    + I R + VRK +ECKESRIGKQPI VPSNVTI MEGQ
Sbjct  7    SLQTSNLRSAFLGEKTGICVSSIPITRVSLVRKAIECKESRIGKQPITVPSNVTITMEGQ  66

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGE+ +TYPREVK+ +EESG LRVRK++ETRR+
Sbjct  67   DIKVKGPLGEMALTYPREVKVNREESGALRVRKSVETRRA  106


 Score =   120 bits (301),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQL+GVGYRA +EGKD+VL+LGFSHPVRMAIPDG
Sbjct  106  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLIGVGYRATLEGKDLVLSLGFSHPVRMAIPDG  165

Query  593  LQV  601
            +QV
Sbjct  166  IQV  168



>ref|XP_011098741.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Sesamum indicum]
 ref|XP_011098742.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Sesamum indicum]
Length=226

 Score =   139 bits (349),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            T  +S L   F+G+A+G+RF  ++  R   VRK VECKESRIGKQPI VPSNVT+ M+GQ
Sbjct  8    TMQSSYLSCPFLGEANGLRFSPVSAPRVAVVRKIVECKESRIGKQPITVPSNVTLTMDGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL +TYPRE+KLEKEESG LRV+K++ETRR+
Sbjct  68   DLKVKGPLGELALTYPREIKLEKEESGALRVKKSVETRRA  107


 Score =   122 bits (305),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVG GYRA VEGKDIVLNLGFSHPVRMAIP G
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGTGYRAAVEGKDIVLNLGFSHPVRMAIPSG  166

Query  593  LQV  601
            LQV
Sbjct  167  LQV  169



>ref|XP_007045631.1| Ribosomal protein L6 family [Theobroma cacao]
 gb|EOY01463.1| Ribosomal protein L6 family [Theobroma cacao]
Length=225

 Score =   141 bits (355),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TSNLRS F+G+ + I    + + R + VRK VECKESRIGKQPI VPSNVTI +EGQ
Sbjct  7    SFQTSNLRSAFLGERNAICISSIPVTRVSLVRKAVECKESRIGKQPIQVPSNVTITLEGQ  66

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL +TYPREVK+++EE G+LRVRKA+ETRR+
Sbjct  67   DVKVKGPLGELALTYPREVKVDREEPGILRVRKAVETRRA  106


 Score =   118 bits (296),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQL+GVGYRAM EGKD+VL+LGFSHPVRMAIP+G
Sbjct  106  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLIGVGYRAMFEGKDLVLSLGFSHPVRMAIPEG  165

Query  593  LQV  601
            ++V
Sbjct  166  IKV  168



>ref|XP_003548187.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like isoform 
1 [Glycine max]
Length=226

 Score =   139 bits (349),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F  SNL+S F+G+ + +R   +  A   F RKTVECKESRIGKQPIPVPSNVT+K+EGQ
Sbjct  8    SFRISNLKSVFVGETNKLRVSSVPGAHVGFNRKTVECKESRIGKQPIPVPSNVTVKLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D +VKGPLGEL +TYPREV +E+EESG LRV+KA+ETRR+
Sbjct  68   DIQVKGPLGELALTYPREVLVEREESGTLRVKKAVETRRA  107


 Score =   120 bits (300),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+++GVSKGFDKKLQLVGVGYRAMVEG ++VLNLGFSHPV+M IPDG
Sbjct  107  ANQMHGLFRTLTDNLVIGVSKGFDKKLQLVGVGYRAMVEGNEVVLNLGFSHPVKMTIPDG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>gb|ACU23468.1| unknown [Glycine max]
Length=226

 Score =   138 bits (348),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F  SNL+S F+G+ + +R   +  A   F RKTVECKESRIGKQPIPVPSNVT+K+EGQ
Sbjct  8    SFRISNLKSVFVGETNKLRVSSVPGAHVGFNRKTVECKESRIGKQPIPVPSNVTVKLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D +VKGPLGEL +TYPREV +E+EESG LRV+KA+ETRR+
Sbjct  68   DIQVKGPLGELALTYPREVLVEREESGTLRVKKAVETRRA  107


 Score =   119 bits (298),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+++GVSKGFDKKLQLVGVGYRAMVEG ++VLNLGFSHPV+M IPDG
Sbjct  107  ANQMHGLFRTLTDNLVIGVSKGFDKKLQLVGVGYRAMVEGNEVVLNLGFSHPVKMTIPDG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>gb|KHN42547.1| 50S ribosomal protein L6, chloroplastic [Glycine soja]
Length=226

 Score =   139 bits (349),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F  SNL+S F+G+ + +R   +  A   F RKTVECKESRIGKQPIPVPSNVT+K+EGQ
Sbjct  8    SFRISNLKSVFVGETNKLRVSSVPGAHVGFNRKTVECKESRIGKQPIPVPSNVTVKLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D +VKGPLGEL +TYPREV +E+EESG LRV+KA+ETRR+
Sbjct  68   DIQVKGPLGELALTYPREVLVEREESGTLRVKKAVETRRA  107


 Score =   119 bits (298),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN++ GVSKGFDKKLQLVGVGYRAMVEG ++VLNLGFSHPV+M IPDG
Sbjct  107  ANQMHGLFRTLTDNLVTGVSKGFDKKLQLVGVGYRAMVEGNEVVLNLGFSHPVKMTIPDG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>gb|KHG21050.1| 50S ribosomal L6, chloroplastic -like protein [Gossypium arboreum]
Length=225

 Score =   139 bits (351),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +  TSNLRS F+G+ +G     + I R + VRK +ECKESRIGKQPI VPSNVTI MEGQ
Sbjct  7    SLQTSNLRSAFLGEKNGSCVSSIPITRVSLVRKAIECKESRIGKQPITVPSNVTITMEGQ  66

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGE+ +TYPREVK+++EESG LR+RK++ETRR+
Sbjct  67   DIKVKGPLGEMALTYPREVKVDREESGALRIRKSVETRRA  106


 Score =   117 bits (294),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQL+GVGYRA +EGKD+VL+LGFSHPVRMAIPD 
Sbjct  106  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLIGVGYRATLEGKDLVLSLGFSHPVRMAIPDD  165

Query  593  LQV  601
            +QV
Sbjct  166  IQV  168



>ref|XP_008455431.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Cucumis melo]
Length=233

 Score =   130 bits (328),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 78/98 (80%), Gaps = 0/98 (0%)
 Frame = +1

Query  121  ATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDF  300
            + +N RS F+G+ +G     + +     +RKT+ECKESRIGKQPI VPSNVTI ++GQD 
Sbjct  17   SPNNFRSTFLGEKNGFCVSAMPVCHIGLLRKTIECKESRIGKQPIQVPSNVTITLQGQDL  76

Query  301  KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            KVKGPLGEL I YPREVK+E+E+SG++RV+KA+ETRR+
Sbjct  77   KVKGPLGELSILYPREVKIEREDSGIIRVKKALETRRA  114


 Score =   125 bits (313),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQL+GVGYRAMVEGKD+VLNLGFSHPVRMAIPDG
Sbjct  114  ANQMHGLFRTLTDNMVVGVSKGFEKKLQLIGVGYRAMVEGKDLVLNLGFSHPVRMAIPDG  173

Query  593  LQV  601
            +Q+
Sbjct  174  IQI  176



>ref|XP_003534001.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Glycine 
max]
 gb|KHN23211.1| 50S ribosomal protein L6, chloroplastic [Glycine soja]
Length=226

 Score =   137 bits (346),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  97   TTQRKKTFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVT  276
            T+    +F  SNL S F+G+ +  R   +  A   F+RKTVECKESRIGKQPIPVPSNVT
Sbjct  2    TSSVTSSFRISNLNSVFVGETNKFRVSTVPGAHVGFIRKTVECKESRIGKQPIPVPSNVT  61

Query  277  IKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            +K+EGQD +VKGPLGEL ++YPREV +E+EESG LRV+KA+ETRR+
Sbjct  62   VKLEGQDIQVKGPLGELALSYPREVLVEREESGTLRVKKAVETRRA  107


 Score =   117 bits (293),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+++GVSKGF+KKLQLVGVGYRAMVEG ++VLNLGFSHPV+M IPDG
Sbjct  107  ANQMHGLFRTLTDNLVIGVSKGFEKKLQLVGVGYRAMVEGNEVVLNLGFSHPVKMIIPDG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>ref|XP_011005106.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Populus euphratica]
Length=226

 Score =   139 bits (350),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TSNLRS F+G+ +GI    + + R  F+RK +ECKESRIGKQPI VPSNVTI +EGQ
Sbjct  8    SFQTSNLRSVFLGERNGICVPSVPVTRFGFLRKAIECKESRIGKQPIQVPSNVTITLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL  TYPREVKLE++E G++RV+KA+ETRR+
Sbjct  68   DLKVKGPLGELSRTYPREVKLERDEDGIIRVKKALETRRA  107


 Score =   115 bits (289),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA VEGKD+VL+LGFSHPVRMAIP  
Sbjct  107  ANQMHGLFRTLTDNMLVGVSKGFEKRLQLVGVGYRANVEGKDLVLSLGFSHPVRMAIPAT  166

Query  593  LQV  601
            LQV
Sbjct  167  LQV  169



>ref|XP_002320459.1| ribosomal protein L6 [Populus trichocarpa]
 gb|EEE98774.1| ribosomal protein L6 [Populus trichocarpa]
Length=227

 Score =   138 bits (347),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TSNLRS F+G+ + I    + + R  F+RK +ECKESRIGKQPI VPSNVTIK+EGQ
Sbjct  9    SFQTSNLRSVFLGERNRICVPSVPVTRIGFLRKAIECKESRIGKQPIQVPSNVTIKLEGQ  68

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL  TYPREVKLE++E G++RV+KA+ETRR+
Sbjct  69   DLKVKGPLGELSRTYPREVKLERDEDGIIRVKKALETRRA  108


 Score =   116 bits (291),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA VEGKD+VL+LGFSHPVRMAIP  
Sbjct  108  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRANVEGKDLVLSLGFSHPVRMAIPAT  167

Query  593  LQV  601
            LQV
Sbjct  168  LQV  170



>ref|XP_002279657.2| PREDICTED: 50S ribosomal protein L6, chloroplastic [Vitis vinifera]
 emb|CBI28941.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   138 bits (348),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TSNLRS F+G+ +GI    + + R  F+RKT+ECKESRIGK+PI VPSNVTI +EGQ
Sbjct  8    SFQTSNLRSAFLGERNGIYVSSVPVTRVGFLRKTIECKESRIGKKPIEVPSNVTITLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL  TYPREVK++K+ESG+L V+KA ETRR+
Sbjct  68   DLKVKGPLGELSRTYPREVKVQKDESGILTVKKAFETRRA  107


 Score =   115 bits (287),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA VEGKD+VLNLGFSHPVRM IP  
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATVEGKDLVLNLGFSHPVRMPIPGD  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>ref|XP_004144493.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004164857.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Cucumis 
sativus]
 gb|KGN43529.1| hypothetical protein Csa_7G044200 [Cucumis sativus]
Length=233

 Score =   127 bits (319),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +1

Query  121  ATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDF  300
            + +N RS F+G+ +G     +       +RKT+ECKESRIGKQPI VPS+VTI ++GQD 
Sbjct  17   SPNNFRSTFLGEKNGFCVSAMPACHIGLLRKTIECKESRIGKQPIQVPSSVTITLQGQDL  76

Query  301  KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            KVKGPLGEL I YPREVK+E+E+SG++RV+KA+ETRR+
Sbjct  77   KVKGPLGELSILYPREVKIEREDSGIIRVKKALETRRA  114


 Score =   125 bits (315),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQL+GVGYRAMVEGKD+VLNLGFSHPVRMAIPDG
Sbjct  114  ANQMHGLFRTLTDNMVVGVSKGFEKKLQLIGVGYRAMVEGKDLVLNLGFSHPVRMAIPDG  173

Query  593  LQV  601
            +Q+
Sbjct  174  IQI  176



>ref|XP_004514093.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Cicer 
arietinum]
Length=226

 Score =   131 bits (329),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F  SN +S ++G+ S +R       R    RKT ECKESRIGKQPIPVPSNVTIK+EGQ
Sbjct  8    SFQISNFKSVYLGERSKLRVSSAPATRVGVFRKTTECKESRIGKQPIPVPSNVTIKLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D +VKGPLGEL +TYPREVK+E+++ G+L+V KA+ETRR+
Sbjct  68   DIQVKGPLGELSLTYPREVKVERQDEGILKVSKAVETRRA  107


 Score =   120 bits (301),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN++VGVSKGF+KKLQL+GVGYRAMVEG D+VLNLGFSHPV+M IPDG
Sbjct  107  ANQMHGLFRTLTDNLVVGVSKGFEKKLQLIGVGYRAMVEGNDVVLNLGFSHPVKMTIPDG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>ref|XP_010522339.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Tarenaya 
hassleriana]
Length=226

 Score =   134 bits (338),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +1

Query  118  FATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQD  297
            F TSN RS F+GD  G R  +  +    F  KTVECKESRIGKQPI VPSNVTI + GQD
Sbjct  9    FQTSNFRSVFLGDGRGFRASRAHVVNVGFSSKTVECKESRIGKQPIAVPSNVTITLAGQD  68

Query  298  FKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
             KVKGPLGEL +TYPREV+++KE+SG LRVRK +ETRR+
Sbjct  69   LKVKGPLGELSLTYPREVEVKKEDSGSLRVRKTVETRRA  107


 Score =   117 bits (292),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNMIVGVSKGF+K+LQL+GVGYRAMVEGK++VLNLGFSHPVRM IP+ 
Sbjct  107  ANQMHGLFRTLTDNMIVGVSKGFEKRLQLIGVGYRAMVEGKELVLNLGFSHPVRMEIPND  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>gb|AFK43716.1| unknown [Medicago truncatula]
Length=226

 Score =   135 bits (340),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F  SN +S+F+G+ S IR          F RKT ECKESRIGKQPIPVPSNVTIKMEGQ
Sbjct  8    SFQLSNFKSSFVGERSRIRISSAPATHVGFFRKTTECKESRIGKQPIPVPSNVTIKMEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
             F  KGPLGEL +TYPREVK+E++E GVL+V KA+ETRR+
Sbjct  68   YFHAKGPLGELSLTYPREVKVERQEEGVLKVSKAVETRRA  107


 Score =   115 bits (287),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN++VGVSKGF+KKLQL+GVGYRA VEG ++VLNLGFSHPV+M IP+G
Sbjct  107  ANQMHGLFRTLTDNIVVGVSKGFEKKLQLIGVGYRATVEGNEVVLNLGFSHPVKMTIPEG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>ref|XP_010557010.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Tarenaya 
hassleriana]
Length=225

 Score =   130 bits (327),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TSNLR  F+GD+ GI   + T     F  KTVECKESRIGKQPI VPSNVTI + GQ
Sbjct  8    SFQTSNLRPVFLGDSRGIPASR-TPVHVGFSSKTVECKESRIGKQPIAVPSNVTITLAGQ  66

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL +TYPREV+++KE+SG LRVRK +ETRR+
Sbjct  67   DLKVKGPLGELSLTYPREVEVKKEDSGFLRVRKTIETRRA  106


 Score =   118 bits (296),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRAMVEGK++VLNLGFSHPVRM IP+ 
Sbjct  106  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRAMVEGKELVLNLGFSHPVRMEIPND  165

Query  593  LQV  601
            LQV
Sbjct  166  LQV  168



>ref|XP_008379631.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Malus 
domestica]
 ref|XP_008365451.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Malus 
domestica]
Length=226

 Score =   132 bits (333),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TSNLRS F+G  +G     + ++   F++KT+ECKESRIGKQPI VPSNVTI +EGQ
Sbjct  8    SFQTSNLRSAFLGKRNGFSVCSVPVSHVKFLKKTIECKESRIGKQPIEVPSNVTITLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
               VKGPLG+L +TYPREV ++KE+SG LRVRKA+ETRR+
Sbjct  68   ALAVKGPLGQLSLTYPREVLVQKEDSGALRVRKAVETRRA  107


 Score =   115 bits (289),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGFDK+LQLVGVGYRA +EGK +VL+LGFSHPVRM IPDG
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFDKRLQLVGVGYRATLEGKILVLSLGFSHPVRMDIPDG  166

Query  593  LQV  601
            +QV
Sbjct  167  IQV  169



>gb|ACU19091.1| unknown [Glycine max]
Length=226

 Score =   135 bits (340),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = +1

Query  97   TTQRKKTFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVT  276
            T+    +F  SNL S F+G+ +  R   +  A   F+RKTVECKESRIGKQPIPVPSNVT
Sbjct  2    TSSVTSSFRISNLNSVFVGETNKFRVSTVPGAHVGFIRKTVECKESRIGKQPIPVPSNVT  61

Query  277  IKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            +K+EGQD +VKGPLGEL ++YPREV +++EESG LRV+KA+ETRR+
Sbjct  62   VKLEGQDIQVKGPLGELALSYPREVLVKREESGTLRVKKAVETRRA  107


 Score =   112 bits (279),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRT TDN+++GV KGF+KKLQLVGVGYRAMVEG ++VLNLGFSHPV+M IPDG
Sbjct  107  ANQMHGLFRTPTDNLVIGVFKGFEKKLQLVGVGYRAMVEGNEVVLNLGFSHPVKMIIPDG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>ref|XP_008223584.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Prunus mume]
Length=226

 Score =   134 bits (337),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +  TSNLRS F+G+ +G     +++    F++KT+ECKESRIGKQPI VPSNV+IK+EGQ
Sbjct  8    SLQTSNLRSAFLGERNGFSVCSVSVTHVGFLKKTIECKESRIGKQPIEVPSNVSIKLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
              +VKGPLG+L +TYPREV L+KE+SG LRVRKA+ETRR+
Sbjct  68   ALEVKGPLGQLSMTYPREVLLQKEDSGFLRVRKALETRRA  107


 Score =   113 bits (282),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA +EG+ +VL+LGFSHPVRM IPDG
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATLEGRILVLSLGFSHPVRMDIPDG  166

Query  593  LQV  601
            +QV
Sbjct  167  IQV  169



>gb|KDP25836.1| hypothetical protein JCGZ_22866 [Jatropha curcas]
Length=226

 Score =   131 bits (329),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TSNLRS F+G+ +G+        R  F+RK + CKESRIGKQPI VP+NVTI ++GQ
Sbjct  8    SFQTSNLRSVFLGERNGVGVPIAPTTRVGFLRKMIVCKESRIGKQPIQVPTNVTITLDGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL  TYPREVKLE++E+GV+RV+KA+ETRR+
Sbjct  68   DLKVKGPLGELSRTYPREVKLERDENGVIRVKKALETRRA  107


 Score =   116 bits (290),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA VEGKD+VL+LGFSHPVRM IPD 
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATVEGKDLVLSLGFSHPVRMTIPDD  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>ref|XP_007223925.1| hypothetical protein PRUPE_ppa011034mg [Prunus persica]
 gb|EMJ25124.1| hypothetical protein PRUPE_ppa011034mg [Prunus persica]
Length=226

 Score =   133 bits (334),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +  TSNLRS F+G+ +G     +++    F++KT+ECKESRIGKQPI VPSNV+IK+EGQ
Sbjct  8    SLQTSNLRSAFLGERNGFSVCSVSVTHVGFLKKTIECKESRIGKQPIEVPSNVSIKLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
              +VKGPLG+L +TYPREV ++KE+SG LRVRKA+ETRR+
Sbjct  68   ALEVKGPLGQLSMTYPREVLVQKEDSGFLRVRKALETRRA  107


 Score =   113 bits (282),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA +EG+ +VL+LGFSHPVRM IPDG
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATLEGRILVLSLGFSHPVRMDIPDG  166

Query  593  LQV  601
            +QV
Sbjct  167  IQV  169



>ref|XP_010689735.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   126 bits (317),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 74/99 (75%), Gaps = 1/99 (1%)
 Frame = +1

Query  118  FATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQD  297
             A S+L+S F+G    I      + R  F RK VECKESRIGKQPI VP+NV I MEGQD
Sbjct  4    LAPSHLKSVFLGGKIDIGASN-PVTRAGFWRKNVECKESRIGKQPIAVPANVAIAMEGQD  62

Query  298  FKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
             KVKGPLGEL ITYPREV +EK+ESG LRVRKA+ETRR+
Sbjct  63   LKVKGPLGELAITYPREVIVEKQESGFLRVRKAVETRRA  101


 Score =   119 bits (299),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQLVGVGYRA VEGKD+VL+LGFSHPVRMA+PD 
Sbjct  101  ANQMHGLFRTLTDNMVVGVSKGFEKKLQLVGVGYRATVEGKDLVLSLGFSHPVRMAVPDD  160

Query  593  LQV  601
            LQV
Sbjct  161  LQV  163



>ref|XP_006418054.1| hypothetical protein EUTSA_v10008693mg [Eutrema salsugineum]
 gb|ESQ36407.1| hypothetical protein EUTSA_v10008693mg [Eutrema salsugineum]
Length=226

 Score =   130 bits (328),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F  SN+RS F+GD +  +      A+  F  KT+ECKESRIGKQPI VPSNVTI +EGQ
Sbjct  8    SFQPSNVRSAFLGDRNVFKVSTTPFAQVGFSSKTIECKESRIGKQPIAVPSNVTIALEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL +TYPREV+L KE+SG LRV+K +ETRR+
Sbjct  68   DLKVKGPLGELALTYPREVELTKEDSGFLRVKKTVETRRA  107


 Score =   114 bits (284),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IPD 
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMQIPDS  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>ref|XP_009401055.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   123 bits (309),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = +1

Query  121  ATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDF  300
            ++ NL S F+GD S I       +R +F+RK VECKESRIGK+PI VP NVTI ++GQD 
Sbjct  10   SSCNLNSAFLGDRSRICISDAPFSRVHFLRKPVECKESRIGKRPIEVPPNVTIALDGQDL  69

Query  301  KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            KVKGPLGEL  TYPREVK++++ESG L+V KA+ETRR+
Sbjct  70   KVKGPLGELSRTYPREVKVQRDESGFLKVSKAVETRRA  107


 Score =   120 bits (302),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA +EG+D+VLNLGFSHPVRMAIPDG
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATLEGRDLVLNLGFSHPVRMAIPDG  166

Query  593  LQV  601
            LQV
Sbjct  167  LQV  169



>ref|XP_008342000.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Malus 
domestica]
Length=225

 Score =   129 bits (325),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 78/99 (79%), Gaps = 2/99 (2%)
 Frame = +1

Query  118  FATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQD  297
            F TSNLRS F+G+  G  F   ++    F++KT+ECKESRIGKQPI VPSNVTI +EGQ 
Sbjct  10   FQTSNLRSAFLGERKG--FXXCSVPXVGFLKKTIECKESRIGKQPIEVPSNVTITLEGQA  67

Query  298  FKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
              VKGPLG+L +TYPREV ++KE+SG LRVRKA+ETRR+
Sbjct  68   LAVKGPLGQLSLTYPREVLVQKEDSGTLRVRKAVETRRA  106


 Score =   114 bits (285),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA +EGK +VL+LGFSHPVRM IPDG
Sbjct  106  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATLEGKILVLSLGFSHPVRMDIPDG  165

Query  593  LQV  601
            +QV
Sbjct  166  IQV  168



>ref|XP_010276744.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Nelumbo 
nucifera]
Length=225

 Score =   123 bits (309),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +1

Query  127  SNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  306
             NL+S F+G+ S  +  ++ +    F+RKTVECKESRIGK+PI VP NV I +EGQD KV
Sbjct  11   CNLKSKFLGEVSATQVGRVPVTHVGFLRKTVECKESRIGKKPIEVPPNVAITLEGQDLKV  70

Query  307  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            KGPLGEL  TYPREVKL +EESG LRV KA+ETRR+
Sbjct  71   KGPLGELSRTYPREVKLVREESGNLRVIKAVETRRA  106


 Score =   119 bits (298),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA +EGKD+VLNLGFSHPVRM IPDG
Sbjct  106  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATLEGKDLVLNLGFSHPVRMTIPDG  165

Query  593  LQV  601
            L+V
Sbjct  166  LKV  168



>ref|XP_010100629.1| 50S ribosomal protein L6 [Morus notabilis]
 gb|EXB83377.1| 50S ribosomal protein L6 [Morus notabilis]
Length=225

 Score =   124 bits (310),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TS  RS F+G+ +G     + ++R  FV+K +ECKESRIGKQ I VPSNVTI +EGQ
Sbjct  8    SFQTS-FRSVFLGERNGFSVSSVPVSRVGFVKKNIECKESRIGKQAIEVPSNVTITLEGQ  66

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
              KVKGPLGEL + YPREVK+E+EESG+LRVRKA+ETRR+
Sbjct  67   GLKVKGPLGELSLNYPREVKVEREESGILRVRKAVETRRA  106


 Score =   119 bits (297),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRAM+EGKD+VL+LGFSHPVRM IP+G
Sbjct  106  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRAMLEGKDLVLSLGFSHPVRMTIPNG  165

Query  593  LQV  601
            +QV
Sbjct  166  IQV  168



>ref|XP_007152280.1| hypothetical protein PHAVU_004G116200g [Phaseolus vulgaris]
 gb|ESW24274.1| hypothetical protein PHAVU_004G116200g [Phaseolus vulgaris]
Length=226

 Score =   130 bits (328),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F  SNL++ F+G+ + +R   +  A+  FVRKTVECKESRIGKQ I VP+NVT+K+EGQ
Sbjct  8    SFRISNLKTVFVGETNKLRVSSVPGAQAGFVRKTVECKESRIGKQRITVPTNVTVKLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
              +VKGPLGEL +TYPREV +EKEE+G LRVRKA+ETRR+
Sbjct  68   GIQVKGPLGELALTYPREVLVEKEEAGTLRVRKAVETRRA  107


 Score =   111 bits (277),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLT+N++VGVS+GF+KKLQLVGVGYRAMVEG  +VLNLGFSHPV+M IP G
Sbjct  107  ANQMHGLFRTLTNNLVVGVSEGFEKKLQLVGVGYRAMVEGNAVVLNLGFSHPVKMEIPGG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>ref|XP_004287942.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=226

 Score =   129 bits (323),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TSNLRS F+G+  G   +        F++K VECKESRIGKQPI VP+NVT+K+EGQ
Sbjct  8    SFQTSNLRSAFLGERKGFTVYSAPATNVGFLKKAVECKESRIGKQPIEVPANVTLKLEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
              +VKGPLG+L +  PREV +EK+ESGVL+VRKAMETRR+
Sbjct  68   SLEVKGPLGQLSMILPREVVVEKQESGVLKVRKAMETRRA  107


 Score =   112 bits (281),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQL+GVGYRA +EG+ +VL+LGFSHPVRM IPDG
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLIGVGYRATLEGRILVLSLGFSHPVRMDIPDG  166

Query  593  LQV  601
            +QV
Sbjct  167  IQV  169



>ref|XP_010243082.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Nelumbo 
nucifera]
Length=226

 Score =   120 bits (302),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            NL+S F+G+ S  +  ++ + +   +RK VECKESRIGK+ I VPSNVTI +EGQD KVK
Sbjct  13   NLKSTFLGEMSATQVVRVPVTKVGLLRKVVECKESRIGKKAIEVPSNVTITLEGQDLKVK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL  TYPREVK+ +EESG L+V KA++TRR+
Sbjct  73   GPLGELSRTYPREVKIVREESGTLKVNKALDTRRA  107


 Score =   120 bits (301),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA VEG D+VLNLGFSHPVRMAIPDG
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATVEGNDLVLNLGFSHPVRMAIPDG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169



>ref|XP_002892273.1| EMB2394 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68532.1| EMB2394 [Arabidopsis lyrata subsp. lyrata]
Length=223

 Score =   125 bits (314),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  315
            RS F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  71

Query  316  LGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            LGEL +TYPREV+L KEESG+LRV+K +ETRR+
Sbjct  72   LGELALTYPREVELTKEESGLLRVKKTVETRRA  104


 Score =   114 bits (285),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IPD 
Sbjct  104  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMQIPDS  163

Query  593  LQV  601
            L+V
Sbjct  164  LKV  166



>ref|XP_010051031.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Eucalyptus 
grandis]
 gb|KCW89410.1| hypothetical protein EUGRSUZ_A01711 [Eucalyptus grandis]
Length=226

 Score =   120 bits (302),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +1

Query  118  FATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQD  297
              T  LRS  +G+ SGI    + +    F+R  +ECKESRIGKQPI VP NVTI +EGQ 
Sbjct  9    LQTCKLRSAILGERSGICISSVPVTHVGFMRSNIECKESRIGKQPIEVPKNVTITLEGQS  68

Query  298  FKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
             +VKGPLGEL   YPREVK+EK+ESG L+V KA+ETRR+
Sbjct  69   LRVKGPLGELSQIYPREVKVEKQESGYLKVNKALETRRA  107


 Score =   117 bits (294),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA +EG+D+VL+LGFSHPVRMAIP+G
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATLEGRDLVLSLGFSHPVRMAIPEG  166

Query  593  LQV  601
            +QV
Sbjct  167  IQV  169



>ref|XP_009353272.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Pyrus x bretschneideri]
Length=226

 Score =   126 bits (317),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TSNLRS F+G+ +G     + ++   F++KT+ECKESRIGKQP  VPSN+TI +EGQ
Sbjct  8    SFQTSNLRSTFLGERNGFSVCSVPVSHVGFLKKTIECKESRIGKQPSEVPSNLTISVEGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
               VKGPLG+L +TY REV ++KE+SG LRVRKA+ETRR+
Sbjct  68   ALAVKGPLGQLSLTYQREVLVQKEDSGALRVRKAVETRRA  107


 Score =   112 bits (279),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGFDK+LQLVG+GYRA +EGK +VL+LGFSHPVRM  P+G
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFDKRLQLVGIGYRATLEGKILVLSLGFSHPVRMDTPNG  166

Query  593  LQV  601
            +QV
Sbjct  167  IQV  169



>ref|XP_006304184.1| hypothetical protein CARUB_v10010237mg [Capsella rubella]
 gb|EOA37082.1| hypothetical protein CARUB_v10010237mg [Capsella rubella]
Length=223

 Score =   124 bits (311),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  315
            RS F+GD +  +      A+  F  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSSTPFAQVGFSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  71

Query  316  LGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            LGEL +TYPREV+L KE+SG LRV+K +ETRR+
Sbjct  72   LGELALTYPREVELTKEDSGFLRVKKTVETRRA  104


 Score =   114 bits (284),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IPD 
Sbjct  104  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMQIPDS  163

Query  593  LQV  601
            L+V
Sbjct  164  LKV  166



>ref|XP_010484767.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Camelina 
sativa]
Length=223

 Score =   124 bits (310),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  315
            RS F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSNTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  71

Query  316  LGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            LGEL +TYPREV+L KE+SG+LRV+K +ETRR+
Sbjct  72   LGELALTYPREVELTKEDSGLLRVKKTVETRRA  104


 Score =   114 bits (284),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IPD 
Sbjct  104  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMKIPDS  163

Query  593  LQV  601
            L+V
Sbjct  164  LKV  166



>ref|XP_010457601.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Camelina 
sativa]
Length=223

 Score =   123 bits (309),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 77/96 (80%), Gaps = 6/96 (6%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLTI---ARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  306
            RS F+GD +    FK++I   A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KV
Sbjct  12   RSAFLGDRN---VFKVSITPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKV  68

Query  307  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            KGPLGEL +TYPREV+L KE+SG+LRV+K +ETRR+
Sbjct  69   KGPLGELALTYPREVELTKEDSGLLRVKKTVETRRA  104


 Score =   114 bits (285),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IPD 
Sbjct  104  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMKIPDS  163

Query  593  LQV  601
            L+V
Sbjct  164  LKV  166



>ref|XP_006447548.1| hypothetical protein CICLE_v10016578mg [Citrus clementina]
 ref|XP_006469689.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Citrus 
sinensis]
 gb|ESR60788.1| hypothetical protein CICLE_v10016578mg [Citrus clementina]
 gb|KDO41663.1| hypothetical protein CISIN_1g027306mg [Citrus sinensis]
Length=225

 Score =   125 bits (314),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +F TSNL+S F G+ +G     + + R  F RKT+ECKESRIGKQPI VPSNVTI + GQ
Sbjct  8    SFHTSNLKSIFFGERNGFSMSNVPVNRVGFSRKTIECKESRIGKQPIEVPSNVTITLGGQ  67

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL + YPREVK+++E+S  LRVRK +ETRR+
Sbjct  68   DLKVKGPLGELSLVYPREVKVDREDS-FLRVRKTVETRRA  106


 Score =   111 bits (278),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQ+VGVGYRA +EG+ +VL+LGFSHPVRM IPDG
Sbjct  106  ANQMHGLFRTLTDNMVVGVSKGFEKKLQMVGVGYRAALEGQVLVLSLGFSHPVRMTIPDG  165

Query  593  LQV  601
            ++V
Sbjct  166  IKV  168



>emb|CDY46838.1| BnaA10g03220D [Brassica napus]
Length=223

 Score =   124 bits (312),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  315
            RS F+GD +  +      A+  + RKT+ECKESRIGKQPI VP+NVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSNTPYAQVGYSRKTIECKESRIGKQPIAVPTNVTIALEGQDLKVKGP  71

Query  316  LGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            LGEL +TYPREV+L KE++GVLRV+K +ETRR+
Sbjct  72   LGELALTYPREVELIKEDAGVLRVKKTVETRRA  104


 Score =   112 bits (280),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IP+ 
Sbjct  104  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMQIPES  163

Query  593  LQV  601
            L+V
Sbjct  164  LKV  166



>ref|NP_172011.1| 50S ribosomal protein L6 [Arabidopsis thaliana]
 sp|O23049.1|RK6_ARATH RecName: Full=50S ribosomal protein L6, chloroplastic; AltName: 
Full=Protein EMBRYO DEFECTIVE 2394; Flags: Precursor [Arabidopsis 
thaliana]
 pdb|3BBO|I Chain I, Homology Model For The Spinach Chloroplast 50s Subunit 
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
 gb|AAK25975.1|AF360265_1 putative chloroplast 50S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAB71459.1| Similar to Mycobacterium RlpF (gb|Z84395). ESTs gb|T75785,gb|R30580,gb|T04698 
come from this gene [Arabidopsis thaliana]
 gb|AAK64135.1| putative chloroplast 50S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AAM62933.1| putative chloroplast 50S ribosomal protein L6 [Arabidopsis thaliana]
 gb|AEE27802.1| 50S ribosomal protein L6 [Arabidopsis thaliana]
Length=223

 Score =   124 bits (311),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  315
            RS F+GD +  +      A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  71

Query  316  LGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            LGEL +TYPREV+L KEESG LRV+K +ETRR+
Sbjct  72   LGELALTYPREVELTKEESGFLRVKKTVETRRA  104


 Score =   112 bits (280),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA V+GK++VLNLGFSHPV+M IPD 
Sbjct  104  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVDGKELVLNLGFSHPVKMQIPDS  163

Query  593  LQV  601
            L+V
Sbjct  164  LKV  166



>emb|CDY70611.1| BnaAnng34360D [Brassica napus]
Length=223

 Score =   124 bits (310),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  315
            RS+F+G+ +  +     IA+  F  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGP
Sbjct  12   RSSFLGERNVFKVSTAPIAQVGFSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGP  71

Query  316  LGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            LGEL +TYPREV+L KE+SG LRV+K +ETRR+
Sbjct  72   LGELALTYPREVELLKEDSGFLRVKKTVETRRA  104


 Score =   112 bits (281),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IP+ 
Sbjct  104  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMQIPES  163

Query  593  LQV  601
            L+V
Sbjct  164  LKV  166



>ref|XP_009119188.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Brassica 
rapa]
Length=223

 Score =   124 bits (310),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  315
            RS F+GD +  +      A+  + RKT++CKESRIGKQPI VP+NVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVLATPSAQVGYSRKTIQCKESRIGKQPIAVPTNVTIALEGQDLKVKGP  71

Query  316  LGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            LGEL +TYPREV+L KE++GVLRV+K +ETRR+
Sbjct  72   LGELALTYPREVELIKEDAGVLRVKKTVETRRA  104


 Score =   112 bits (281),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IP+ 
Sbjct  104  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMQIPES  163

Query  593  LQV  601
            L+V
Sbjct  164  LKV  166



>ref|XP_010907839.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Elaeis guineensis]
Length=247

 Score =   119 bits (299),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRAM+EG+D+VLNLGFSHP+RM IP+G
Sbjct  128  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRAMLEGRDLVLNLGFSHPIRMTIPEG  187

Query  593  LQV  601
            LQV
Sbjct  188  LQV  190


 Score =   116 bits (291),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  TFATSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            +  + NL+S F+G+   I      I+R  F+RK V+CKESRIGK+PI VP NVTI ++GQ
Sbjct  29   SIHSCNLKSLFLGERKEICITNSPISRIGFLRKPVQCKESRIGKRPIEVPPNVTIALDGQ  88

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL  TYPREVK+E  ESG LRV KA +TRR+
Sbjct  89   DLKVKGPLGELSTTYPREVKIEILESGTLRVFKASDTRRA  128



>ref|XP_010475192.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Camelina 
sativa]
Length=224

 Score =   121 bits (304),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 74/94 (79%), Gaps = 1/94 (1%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLT-IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKG  312
            RS F+GD +  +    T  A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKG
Sbjct  12   RSAFLGDRNVFKVSSSTPFAQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKG  71

Query  313  PLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            PLGEL +TYPREV+L KE+SG+LRV+K +ETRR+
Sbjct  72   PLGELALTYPREVELTKEDSGLLRVKKTVETRRA  105


 Score =   114 bits (285),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IPD 
Sbjct  105  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMKIPDS  164

Query  593  LQV  601
            L+V
Sbjct  165  LKV  167



>ref|XP_003557902.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Brachypodium 
distachyon]
Length=226

 Score =   121 bits (304),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDK+LQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+G
Sbjct  107  ANQMHGLFRTLTDNIIVGVSKGFDKRLQLVGVGYRATVEGKDLVMNLGFSHPVRMAVPEG  166

Query  593  LQV  601
            LQV
Sbjct  167  LQV  169


 Score =   114 bits (285),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G + GIR   +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFLGKSQGIRLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEQQFVKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL + YP EVK+ KEESG LRV K +ET+R+
Sbjct  73   GPLGELSLNYPNEVKVVKEESGKLRVFKTVETKRA  107



>ref|XP_006650092.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Oryza 
brachyantha]
Length=226

 Score =   121 bits (304),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDKKLQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+G
Sbjct  107  ANQMHGLFRTLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGKDLVMNLGFSHPVRMAVPEG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169


 Score =   112 bits (280),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+    GIR   +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFVAKTQGIRLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL + YP EVK+ KEESG LRV K +ET+R+
Sbjct  73   GPLGELSLNYPAEVKVVKEESGKLRVSKTVETKRA  107



>dbj|BAJ92513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score =   121 bits (304),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDK+LQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+G
Sbjct  97   ANQMHGLFRTLTDNIIVGVSKGFDKRLQLVGVGYRATVEGKDLVMNLGFSHPVRMAVPEG  156

Query  593  LQV  601
            LQV
Sbjct  157  LQV  159


 Score =   111 bits (278),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +1

Query  127  SNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKV  306
            SN R+ F+G + GI    +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K 
Sbjct  2    SNSRTGFLGKSRGIHLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKA  61

Query  307  KGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            KGPLGEL + YP EVK+ KEE+G LRV K +ET+R+
Sbjct  62   KGPLGELSLNYPTEVKVVKEETGKLRVFKTVETKRA  97



>emb|CDY49511.1| BnaC05g03230D [Brassica napus]
Length=223

 Score =   120 bits (301),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  315
            RS F+GD +  +      A+  + RKT++CKESRIGKQPI VP+NVTI +EGQD KVKGP
Sbjct  12   RSAFLGDRNVFKVSATPSAQVGYSRKTIQCKESRIGKQPIAVPTNVTIALEGQDLKVKGP  71

Query  316  LGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            LGEL +TYPREV+L KE++G LRV+K +ETRR+
Sbjct  72   LGELALTYPREVELIKEDAGFLRVKKTVETRRA  104


 Score =   112 bits (281),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IP+ 
Sbjct  104  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMQIPES  163

Query  593  LQV  601
            L+V
Sbjct  164  LKV  166



>dbj|BAJ84917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=239

 Score =   122 bits (305),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDK+LQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+G
Sbjct  120  ANQMHGLFRTLTDNIIVGVSKGFDKRLQLVGVGYRATVEGKDLVMNLGFSHPVRMAVPEG  179

Query  593  LQV  601
            LQV
Sbjct  180  LQV  182


 Score =   110 bits (275),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G + GI    +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  26   NSRTGFLGKSRGIHLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAK  85

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL + YP EVK+ KEE+G LRV K +ET+R+
Sbjct  86   GPLGELSLNYPTEVKVVKEETGKLRVFKTVETKRA  120



>ref|NP_001050139.1| Os03g0356300 [Oryza sativa Japonica Group]
 gb|ABF96017.1| 50S ribosomal protein L6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12053.1| Os03g0356300 [Oryza sativa Japonica Group]
 gb|EAY90037.1| hypothetical protein OsI_11607 [Oryza sativa Indica Group]
 dbj|BAG87949.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   121 bits (303),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDKKLQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+G
Sbjct  107  ANQMHGLFRTLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGKDLVMNLGFSHPVRMAVPEG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169


 Score =   110 bits (276),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F G   GIR   +   R  FVR TVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFAGKTQGIRLRVIPAGRVGFVRTTVECKESRIGKKPIEVPSNVTLTLEEQFIKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL + YP EVK+ KEESG LRV K +ET+R+
Sbjct  73   GPLGELSLNYPGEVKVVKEESGKLRVSKTVETKRA  107



>gb|EAZ26952.1| hypothetical protein OsJ_10878 [Oryza sativa Japonica Group]
Length=226

 Score =   121 bits (303),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDKKLQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+G
Sbjct  107  ANQMHGLFRTLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGKDLVMNLGFSHPVRMAVPEG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169


 Score =   110 bits (276),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F G   GIR   +   R  FVR TVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFAGKTQGIRLRVIPAGRVGFVRTTVECKESRIGKKPIEVPSNVTLTLEEQFIKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL + YP EVK+ KEESG LRV K +ET+R+
Sbjct  73   GPLGELSLNYPGEVKVVKEESGKLRVSKTVETKRA  107



>ref|NP_001051292.1| Os03g0751400 [Oryza sativa Japonica Group]
 gb|AAO32311.1| putative chloroplast 50S ribosomal protein L6 [Oryza sativa Japonica 
Group]
 gb|AAR87250.1| putative ribosomal protein L6 [Oryza sativa Japonica Group]
 gb|ABF98910.1| 50S ribosomal protein L6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13206.1| Os03g0751400 [Oryza sativa Japonica Group]
 gb|EAY91881.1| hypothetical protein OsI_13529 [Oryza sativa Indica Group]
 gb|EAZ28603.1| hypothetical protein OsJ_12590 [Oryza sativa Japonica Group]
 dbj|BAG91224.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   120 bits (302),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDKKLQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+G
Sbjct  107  ANQMHGLFRTLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGKDLVMNLGFSHPVRMAVPEG  166

Query  593  LQV  601
            L+V
Sbjct  167  LKV  169


 Score =   111 bits (277),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G   GI    +   R  FVRKT+ECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFLGKRQGICLHVIPAGRVGFVRKTIECKESRIGKKPIEVPSNVTLTLEEQFIKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL + YP EVK+ KEESG LRV K +ET+R+
Sbjct  73   GPLGELSLNYPGEVKVVKEESGKLRVSKTVETKRA  107



>dbj|BAJ91776.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88259.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93276.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   121 bits (304),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDK+LQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+G
Sbjct  107  ANQMHGLFRTLTDNIIVGVSKGFDKRLQLVGVGYRATVEGKDLVMNLGFSHPVRMAVPEG  166

Query  593  LQV  601
            LQV
Sbjct  167  LQV  169


 Score =   110 bits (274),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G + GI    +   R  FVRKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFLGKSRGIHLRVIPAGRVGFVRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL + YP EVK+ KEE+G LRV K +ET+R+
Sbjct  73   GPLGELSLNYPTEVKVVKEETGKLRVFKTVETKRA  107



>gb|ACG25590.1| 50S ribosomal protein L6 [Zea mays]
Length=224

 Score =   119 bits (298),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 7/97 (7%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLT----IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  303
            RS+F+GD +    FK++      +  F  KT+ECKESRIGKQPI VPSNVTI +EGQD K
Sbjct  12   RSSFLGDRNA---FKVSTTPPFTQVGFSSKTIECKESRIGKQPISVPSNVTIALEGQDLK  68

Query  304  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            VKGPLGEL +TYPREV+L KE+SG LRV+K +ETRR+
Sbjct  69   VKGPLGELALTYPREVELLKEDSGFLRVKKTVETRRA  105


 Score =   111 bits (278),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL +VGVGYRA VEGK++VLNLGFSHPV+M IP+ 
Sbjct  105  ANQMHGLFRTLTDNMVVGVSKGFEKKLIVVGVGYRATVEGKELVLNLGFSHPVKMQIPES  164

Query  593  LQV  601
            L+V
Sbjct  165  LKV  167



>gb|EMT33559.1| 50S ribosomal protein L6, chloroplastic [Aegilops tauschii]
Length=279

 Score =   120 bits (302),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDK+LQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+G
Sbjct  160  ANQMHGLFRTLTDNIIVGVSKGFDKRLQLVGVGYRATVEGKDLVMNLGFSHPVRMAVPEG  219

Query  593  LQV  601
            LQV
Sbjct  220  LQV  222


 Score =   109 bits (273),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G + GI    +   R  F+RKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  66   NSRTGFLGKSQGILLRVIPAGRVGFIRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAK  125

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL + YP EVK+ KEE+G LRV K +ET+R+
Sbjct  126  GPLGELSLNYPTEVKVVKEETGKLRVFKTVETKRA  160



>ref|XP_009118616.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Brassica 
rapa]
Length=224

 Score =   117 bits (292),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 7/97 (7%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLT----IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  303
            RS+F+GD +    FK++      +  F  KT+ECKESRIGKQPI VPSNVTI + GQD K
Sbjct  12   RSSFLGDRNA---FKVSTTPPFTQVGFSSKTIECKESRIGKQPISVPSNVTIALAGQDLK  68

Query  304  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            VKGPLGEL +TYPREV+L KE+SG LRV+K +ETRR+
Sbjct  69   VKGPLGELALTYPREVELLKEDSGFLRVKKTVETRRA  105


 Score =   112 bits (281),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IP+ 
Sbjct  105  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMQIPES  164

Query  593  LQV  601
            L+V
Sbjct  165  LKV  167



>emb|CDY06163.1| BnaA09g50400D [Brassica napus]
Length=224

 Score =   117 bits (292),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 60/97 (62%), Positives = 74/97 (76%), Gaps = 7/97 (7%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLT----IARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  303
            RS+F+GD +    FK++      +  F  KT+ECKESRIGKQPI VPSNVTI + GQD K
Sbjct  12   RSSFLGDRNA---FKVSTTPPFTQVGFSSKTIECKESRIGKQPISVPSNVTIALAGQDLK  68

Query  304  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            VKGPLGEL +TYPREV+L KE+SG LRV+K +ETRR+
Sbjct  69   VKGPLGELALTYPREVELLKEDSGFLRVKKTVETRRA  105


 Score =   112 bits (280),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA VEGK++VLNLGFSHPV+M IP+ 
Sbjct  105  ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVEGKELVLNLGFSHPVKMQIPES  164

Query  593  LQV  601
            L+V
Sbjct  165  LKV  167



>dbj|BAH20405.1| AT1G05190 [Arabidopsis thaliana]
Length=200

 Score =   116 bits (291),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  190  ARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEE  369
            A+  +  KT+ECKESRIGKQPI VPSNVTI +EGQD KVKGPLGEL +TYPREV+L KEE
Sbjct  7    AQVGYSSKTIECKESRIGKQPIAVPSNVTIALEGQDLKVKGPLGELALTYPREVELTKEE  66

Query  370  SGVLRVRKAMETRRS  414
            SG LRV+K +ETRR+
Sbjct  67   SGFLRVKKTVETRRA  81


 Score =   112 bits (280),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKL LVGVGYRA V+GK++VLNLGFSHPV+M IPD 
Sbjct  81   ANQMHGLFRTLTDNMVVGVSKGFEKKLILVGVGYRATVDGKELVLNLGFSHPVKMQIPDS  140

Query  593  LQV  601
            L+V
Sbjct  141  LKV  143



>ref|XP_002465260.1| hypothetical protein SORBIDRAFT_01g035090 [Sorghum bicolor]
 gb|EER92258.1| hypothetical protein SORBIDRAFT_01g035090 [Sorghum bicolor]
Length=226

 Score =   118 bits (295),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDKKLQLVGVGYRA VEG D+V+NLGFSHPVRMAIP+G
Sbjct  107  ANQMHGLFRTLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGNDLVMNLGFSHPVRMAIPEG  166

Query  593  LQV  601
            L V
Sbjct  167  LAV  169


 Score =   110 bits (274),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G   GIR   L   R  FVR  VECKESRIGKQPI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFLGKTHGIRPRVLPAGRVGFVRTVVECKESRIGKQPIEVPSNVTLTLEEQFVKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL +++P +VK+ KEESG+LRV K  ET+R+
Sbjct  73   GPLGELSLSFPGDVKIVKEESGMLRVYKTAETKRA  107



>gb|EMS56589.1| 50S ribosomal protein L6, chloroplastic [Triticum urartu]
Length=280

 Score =   120 bits (301),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDK+LQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+G
Sbjct  161  ANQMHGLFRTLTDNIIVGVSKGFDKRLQLVGVGYRATVEGKDLVMNLGFSHPVRMAVPEG  220

Query  593  LQV  601
            LQV
Sbjct  221  LQV  223


 Score =   107 bits (267),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R  F+G + GI    +   R  F+RKTVECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  67   NSRIGFLGKSQGILLRVIPAGRVGFIRKTVECKESRIGKKPIEVPSNVTLTLEEQFVKAK  126

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL + YP EVK+ KEE+G LRV K +ET+R+
Sbjct  127  GPLGELTLNYPAEVKVVKEETGKLRVFKTVETKRA  161



>ref|XP_004984341.1| PREDICTED: 50S ribosomal protein L6, chloroplastic-like [Setaria 
italica]
Length=226

 Score =   120 bits (300),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+I+GVSKGFDKKLQLVGVGYRA VEG D+V+NLGFSHPVRMA+P+G
Sbjct  107  ANQMHGLFRTLTDNIIIGVSKGFDKKLQLVGVGYRAAVEGNDLVMNLGFSHPVRMAVPEG  166

Query  593  LQV  601
            LQV
Sbjct  167  LQV  169


 Score =   107 bits (266),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G   GIR   +   R  FVR  VECKESRIGK+PI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFLGKTQGIRPRVIPAGRVGFVRTVVECKESRIGKKPIDVPSNVTLTLEEQFVKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL ++YP EVK+ KEESG LR+ K  ET+R+
Sbjct  73   GPLGELSLSYPGEVKVVKEESGKLRLYKTAETKRA  107



>ref|NP_001148555.1| 50S ribosomal protein L6 [Zea mays]
 gb|ACG32024.1| 50S ribosomal protein L6 [Zea mays]
 gb|ACN30855.1| unknown [Zea mays]
 gb|AFW88352.1| 50S ribosomal protein L6 [Zea mays]
Length=226

 Score =   118 bits (295),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDKKLQLVGVGYRA VEG D+V+NLGFSHPVRMAIP+G
Sbjct  107  ANQMHGLFRTLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGNDLVMNLGFSHPVRMAIPEG  166

Query  593  LQV  601
            L V
Sbjct  167  LAV  169


 Score =   105 bits (262),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G   GIR       R  FVR  VECKESRIGKQPI VPSNVT+ +E Q  K K
Sbjct  13   NSRTGFLGKTRGIRPCVFPAGRVGFVRTVVECKESRIGKQPIEVPSNVTLTLEEQFVKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL +++P ++K+ KEESG LRV K  ET+R+
Sbjct  73   GPLGELSLSFPGDLKIVKEESGNLRVYKTAETKRA  107



>emb|CDP19076.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   120 bits (302),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRA +EGKDIVL+LGFSHPVRM IPDG
Sbjct  107  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRATIEGKDIVLSLGFSHPVRMTIPDG  166

Query  593  LQV  601
            LQV
Sbjct  167  LQV  169


 Score =   100 bits (250),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 10/100 (10%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIA---RNNFV--RKTVECKESRIGKQPIPVPSNVTIKMEGQ  294
            NL+S F    +G+R  ++ +       FV  R  VECKESRIGKQ I VPSNVT+ ++GQ
Sbjct  13   NLKSPF----TGMRVPRIAVVGYQHAKFVTRRTIVECKESRIGKQLIEVPSNVTLTIDGQ  68

Query  295  DFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            D KVKGPLGEL +TYP+E+ L++++SG LRVRK++ETRR+
Sbjct  69   DLKVKGPLGELALTYPKEILLQRDDSG-LRVRKSIETRRA  107



>ref|NP_001152325.1| 50S ribosomal protein L6 [Zea mays]
 gb|ACG47033.1| 50S ribosomal protein L6 [Zea mays]
 tpg|DAA45424.1| TPA: 50S ribosomal protein L6 [Zea mays]
Length=226

 Score =   118 bits (295),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN+IVGVSKGFDKKLQLVGVGYRA VEG D+V+NLGFSHPVRMAIP+G
Sbjct  107  ANQMHGLFRTLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGNDLVMNLGFSHPVRMAIPEG  166

Query  593  LQV  601
            L V
Sbjct  167  LAV  169


 Score =   103 bits (256),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G   G R    +  R  FVR  VECKESRIGKQPI VP NVT+ +E Q  K K
Sbjct  13   NSRTGFLGKTHGTRPRLFSAGRVGFVRTLVECKESRIGKQPIEVPPNVTLTLEEQFVKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL +++P +VK+ KEESG LRV K  ET+R+
Sbjct  73   GPLGELSLSFPGDVKIVKEESGNLRVYKTAETKRA  107



>gb|KDO41664.1| hypothetical protein CISIN_1g027306mg [Citrus sinensis]
Length=199

 Score =   111 bits (278),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQ+VGVGYRA +EG+ +VL+LGFSHPVRM IPDG
Sbjct  80   ANQMHGLFRTLTDNMVVGVSKGFEKKLQMVGVGYRAALEGQVLVLSLGFSHPVRMTIPDG  139

Query  593  LQV  601
            ++V
Sbjct  140  IKV  142


 Score =   108 bits (270),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 1/78 (1%)
 Frame = +1

Query  181  LTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLE  360
            + + R  F RKT+ECKESRIGKQPI VPSNVTI + GQD KVKGPLGEL + YPREVK++
Sbjct  4    VPVNRVGFSRKTIECKESRIGKQPIEVPSNVTITLGGQDLKVKGPLGELSLVYPREVKVD  63

Query  361  KEESGVLRVRKAMETRRS  414
            +E+S  LRVRK +ETRR+
Sbjct  64   REDS-FLRVRKTVETRRA  80



>gb|EPS61113.1| hypothetical protein M569_13685, partial [Genlisea aurea]
Length=208

 Score =   109 bits (273),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVS+GF+K+LQLVG GYRA VEG ++VL+LGFSHPVRM+IP G
Sbjct  89   ANQMHGLFRTLTDNMVVGVSRGFEKRLQLVGTGYRAAVEGGEVVLSLGFSHPVRMSIPSG  148

Query  593  LQV  601
            ++V
Sbjct  149  IRV  151


 Score =   108 bits (271),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +1

Query  205  VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLR  384
            VRK  ECKESRIGKQPI VPS V++ +EGQD KVKGPLGEL ITYPRE+++ +EESGVL+
Sbjct  20   VRKITECKESRIGKQPITVPSTVSLTLEGQDLKVKGPLGELAITYPREIQVLEEESGVLK  79

Query  385  VRKAMETRRS  414
            VRKA+++RR+
Sbjct  80   VRKALDSRRA  89



>ref|XP_006858065.1| hypothetical protein AMTR_s00062p00057610 [Amborella trichopoda]
 gb|ERN19532.1| hypothetical protein AMTR_s00062p00057610 [Amborella trichopoda]
Length=225

 Score =   110 bits (274),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQL+GVGYRA +EG D+VLNLGFSHPVRM IP  
Sbjct  106  ANQMHGLFRTLTDNMVVGVSKGFEKRLQLIGVGYRATLEGNDLVLNLGFSHPVRMPIPKE  165

Query  593  LQV  601
            ++V
Sbjct  166  IKV  168


 Score =   104 bits (260),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +1

Query  133  LRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKG  312
            L+S F G+ +G       +    F RK VECKESR+GK PI VPS+VTI ++GQD KVKG
Sbjct  13   LKSKFWGEKNGRVHTSSPVIGIGFFRKNVECKESRVGKHPIEVPSSVTITLDGQDLKVKG  72

Query  313  PLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            PLGEL  TYPREVK+E+ +   L+V KA++TRR+
Sbjct  73   PLGELSRTYPREVKVERLDPTTLKVSKALDTRRA  106



>gb|ABK21300.1| unknown [Picea sitchensis]
 gb|ABK26219.1| unknown [Picea sitchensis]
Length=231

 Score =   115 bits (288),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+KKLQLVGVGYRA VEG D+V+NLGFSHPVR+A+P G
Sbjct  112  ANQMHGLFRTLTDNMVVGVSKGFEKKLQLVGVGYRAAVEGSDLVMNLGFSHPVRLAVPAG  171

Query  593  LQV  601
            ++V
Sbjct  172  IKV  174


 Score = 97.8 bits (242),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 70/98 (71%), Gaps = 4/98 (4%)
 Frame = +1

Query  133  LRSNFIGDASGIRFFK----LTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDF  300
            LRS  +G+ +G++  +    + I +   VR T+ECKESRIGK+P+ VP+NV I +EGQ  
Sbjct  15   LRSTLLGEDNGLKAARDRPAIAIVKLPSVRPTIECKESRIGKKPVVVPANVNITLEGQHI  74

Query  301  KVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            +V G LGEL  TYP E+K+E++ SG +++ KA+ETRR+
Sbjct  75   RVNGLLGELSQTYPNEIKVERDPSGFIKISKAVETRRA  112



>ref|XP_008680805.1| PREDICTED: 50S ribosomal protein L6 isoform X1 [Zea mays]
Length=245

 Score =   107 bits (266),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 60/82 (73%), Gaps = 19/82 (23%)
 Frame = +2

Query  413  ANEMHGLFR-------------------TLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGK  535
            AN+MHGLFR                   TLTDN+IVGVSKGFDKKLQLVGVGYRA VEG 
Sbjct  107  ANQMHGLFRSSKQKHLRQGHMQAGTTRRTLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGN  166

Query  536  DIVLNLGFSHPVRMAIPDGLQV  601
            D+V+NLGFSHPVRMAIP+GL V
Sbjct  167  DLVMNLGFSHPVRMAIPEGLAV  188


 Score =   103 bits (257),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G   G R    +  R  FVR  VECKESRIGKQPI VP NVT+ +E Q  K K
Sbjct  13   NSRTGFLGKTHGTRPRLFSAGRVGFVRTLVECKESRIGKQPIEVPPNVTLTLEEQFVKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL +++P +VK+ KEESG LRV K  ET+R+
Sbjct  73   GPLGELSLSFPGDVKIVKEESGNLRVYKTAETKRA  107



>ref|XP_008802994.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Phoenix dactylifera]
Length=175

 Score =   121 bits (303),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDNM+VGVSKGF+K+LQLVGVGYRAM+EG+D+VLNLGFSHPVRMAIP+G
Sbjct  56   ANQMHGLFRTLTDNMVVGVSKGFEKRLQLVGVGYRAMLEGRDLVLNLGFSHPVRMAIPEG  115

Query  593  LQV  601
            LQV
Sbjct  116  LQV  118


 Score = 77.8 bits (190),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  250  PIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            PI VP NVTI ++GQD KVKG LGEL  TYPREVK+E+ ESG LRV KA++TRR+
Sbjct  2    PIEVPPNVTIALDGQDLKVKGRLGELSRTYPREVKIERLESGTLRVFKALDTRRA  56



>ref|XP_002979598.1| hypothetical protein SELMODRAFT_110948 [Selaginella moellendorffii]
 gb|EFJ19487.1| hypothetical protein SELMODRAFT_110948 [Selaginella moellendorffii]
Length=220

 Score =   105 bits (263),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A +MHGLFRTLTDNM+VGVS+GF+KKLQ+VGVGYRA VE  +I+LN+GFSHPV++ IPDG
Sbjct  101  ARQMHGLFRTLTDNMVVGVSQGFEKKLQMVGVGYRATVEPTEIILNVGFSHPVKIKIPDG  160

Query  593  LQV  601
            + V
Sbjct  161  ISV  163


 Score = 84.7 bits (208),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 63/97 (65%), Gaps = 0/97 (0%)
 Frame = +1

Query  124  TSNLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFK  303
             S LRSNF G+  G      + + +  +   V CKESRIGK+P+ VP +V + ++G +  
Sbjct  5    CSGLRSNFSGETLGASICSSSSSASGNLPLRVICKESRIGKRPVEVPKSVNVVLQGPNLS  64

Query  304  VKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            VKGPLGEL   YPREV L ++ESG + V +A+ETRR+
Sbjct  65   VKGPLGELTRYYPREVSLTRDESGRIVVTRALETRRA  101



>ref|XP_002977678.1| hypothetical protein SELMODRAFT_107348, partial [Selaginella 
moellendorffii]
 gb|EFJ21016.1| hypothetical protein SELMODRAFT_107348, partial [Selaginella 
moellendorffii]
Length=212

 Score =   105 bits (263),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A +MHGLFRTLTDNM+VGVS+GF+KKLQ+VGVGYRA VE  +I+LN+GFSHPV++ IPDG
Sbjct  93   ARQMHGLFRTLTDNMVVGVSQGFEKKLQMVGVGYRATVEPTEIILNVGFSHPVKIKIPDG  152

Query  593  LQV  601
            + V
Sbjct  153  ISV  155


 Score = 81.3 bits (199),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +1

Query  136  RSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGP  315
            RSNF G+  G      + + +  +   V CKESRIGK+P+ VP +V + ++G +  VKGP
Sbjct  1    RSNFSGETLGTSICSSSSSASGNLPLRVICKESRIGKRPVEVPKSVNVVLQGPNLSVKGP  60

Query  316  LGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            LGEL   YPREV L ++ESG + V +A+ETRR+
Sbjct  61   LGELTRYYPREVSLTRDESGRIVVTRALETRRA  93



>gb|KEH16126.1| 50S ribosomal protein L6 [Medicago truncatula]
Length=163

 Score =   114 bits (284),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLTDN++VGVSKGF+KKLQL+GVGYRA VEG ++VLNLGFSHPV+M IP+G
Sbjct  44   ANQMHGLFRTLTDNIVVGVSKGFEKKLQLIGVGYRATVEGNEVVLNLGFSHPVKMTIPEG  103

Query  593  LQV  601
            L+V
Sbjct  104  LKV  106


 Score = 68.2 bits (165),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  283  MEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            MEGQ F  KGPLGEL +TYPREVK+E++E GVL+V KA+ETRR+
Sbjct  1    MEGQYFHAKGPLGELSLTYPREVKVERQEEGVLKVSKAVETRRA  44



>ref|XP_006376781.1| hypothetical protein POPTR_0012s06340g, partial [Populus trichocarpa]
 ref|XP_006376782.1| hypothetical protein POPTR_0012s06350g, partial [Populus trichocarpa]
 gb|ERP54578.1| hypothetical protein POPTR_0012s06340g, partial [Populus trichocarpa]
 gb|ERP54579.1| hypothetical protein POPTR_0012s06350g, partial [Populus trichocarpa]
Length=205

 Score =   103 bits (258),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            NLRS F+ + SGI    + + R  F R+ +ECKES IGKQP+ VP NVTI +EGQ+ KVK
Sbjct  1    NLRSVFLDERSGICAPSVPVTRVGFSREIIECKESWIGKQPVQVPFNVTITLEGQNLKVK  60

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            G LG L   YP+EVK+E++E+G+L+V+KA++TR
Sbjct  61   GLLGGLSRNYPQEVKIERDENGILQVKKAVDTR  93


 Score = 77.4 bits (189),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 45/63 (71%), Gaps = 9/63 (14%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFRTLT+NM+VGVS  F+K         R   +GKD+VL+LGFSHPVRM  P  
Sbjct  95   ANQMHGLFRTLTNNMVVGVSNDFEK---------RPSTKGKDLVLSLGFSHPVRMTTPGD  145

Query  593  LQV  601
            LQV
Sbjct  146  LQV  148



>emb|CDY41816.1| BnaC02g12270D [Brassica napus]
Length=208

 Score =   108 bits (271),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A EMHGLFRTLTDNM+VGVSKGF+K L+L GVGYRAMV+GK++VLNLGFSHPV++ IPD 
Sbjct  89   AKEMHGLFRTLTDNMVVGVSKGFEKTLELKGVGYRAMVQGKELVLNLGFSHPVKIEIPDS  148

Query  593  LQV  601
            L+V
Sbjct  149  LKV  151


 Score = 63.2 bits (152),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  292  QDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            QD KVKGPLGEL +TYP EV+L +E+SG LRVRK +ETRR+
Sbjct  49   QDLKVKGPLGELALTYPPEVELTEEDSGFLRVRKTVETRRA  89



>ref|XP_006376783.1| hypothetical protein POPTR_0012s06360g, partial [Populus trichocarpa]
 gb|ERP54580.1| hypothetical protein POPTR_0012s06360g, partial [Populus trichocarpa]
Length=171

 Score = 87.4 bits (215),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +1

Query  217  VECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKA  396
            +ECKES IGKQP+ VP NVTI +EGQ+ KVKG LG L   YP+EVK+E++E+G+L+V+KA
Sbjct  3    IECKESWIGKQPVQVPFNVTITLEGQNLKVKGLLGGLSRNYPQEVKIERDENGILQVKKA  62

Query  397  METR  408
            ++TR
Sbjct  63   VDTR  66


 Score = 70.9 bits (172),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 42/63 (67%), Gaps = 16/63 (25%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+MHGLFR L                QLVGVGYRA +EGKD+VL+LGFSHPVRM+ P  
Sbjct  68   ANQMHGLFRDL----------------QLVGVGYRANIEGKDLVLSLGFSHPVRMSTPGD  111

Query  593  LQV  601
            LQV
Sbjct  112  LQV  114



>ref|XP_005849229.1| hypothetical protein CHLNCDRAFT_34831 [Chlorella variabilis]
 gb|EFN57127.1| hypothetical protein CHLNCDRAFT_34831 [Chlorella variabilis]
Length=209

 Score = 90.5 bits (223),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            AN+ HGL R+L  NM+VGV  GF  KLQ++GVGYRA V G ++ LNLG+SHPV MAIP G
Sbjct  92   ANQQHGLARSLLSNMVVGVDTGFTTKLQMIGVGYRAAVAGNNLTLNLGYSHPVEMAIPSG  151

Query  593  LQV  601
            L V
Sbjct  152  LAV  154


 Score = 67.0 bits (162),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +1

Query  178  KLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKL  357
            + T AR    +  V  K+SRIGK P+PVP  V++ ++GQ  KVKGP GEL  T+   VK 
Sbjct  15   QATTARQQRQQLNVVAKDSRIGKVPVPVPDKVSVTLDGQTVKVKGPRGELQRTFHPAVKF  74

Query  358  EKEESGVLRVRKAMETR  408
            E+EE  + RV +A ETR
Sbjct  75   EQEEKAI-RVVRANETR  90



>gb|KIZ02220.1| 50S ribosomal protein L6 [Monoraphidium neglectum]
Length=200

 Score = 85.9 bits (211),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  389  ERLWRRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHP  568
            +R      A  MHGL RTL  N++VGVS+GF+KKL+LVG GYRA + G+++ LNLG+S P
Sbjct  74   KRAEETKKAAAMHGLSRTLASNIVVGVSEGFEKKLELVGTGYRAAISGQELTLNLGYSKP  133

Query  569  VRMAIPDGLQV  601
              + +PDG++V
Sbjct  134  RILTVPDGIKV  144


 Score = 63.9 bits (154),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  VECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKA  396
            V CKESRIG +PIPVP  VT+ ++G   KVKGP GEL +T    V +E+ E G L +++A
Sbjct  18   VVCKESRIGSKPIPVPKGVTVDLKGSHLKVKGPKGELELTLTPYVTIEQTE-GKLLLKRA  76

Query  397  METRRS  414
             ET+++
Sbjct  77   EETKKA  82



>ref|XP_011399322.1| 50S ribosomal protein L6, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM22401.1| 50S ribosomal protein L6, chloroplastic [Auxenochlorella protothecoides]
Length=210

 Score = 79.3 bits (194),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A   HGL R L +NM+VGVS GF + L LVGVGYRA V G  + LNLG+S PV +AIP G
Sbjct  93   AGAQHGLARALLNNMVVGVSTGFTRTLMLVGVGYRAAVSGTKLTLNLGYSKPVELAIPGG  152

Query  593  LQV  601
            ++V
Sbjct  153  VEV  155


 Score = 67.8 bits (164),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +1

Query  175  FKLTIARNNF-VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREV  351
            FK  + R    + + ++CKESRIG + IPVP  V +K++G +F VKGP GEL  T    V
Sbjct  13   FKTNVGRPRVSISRLIQCKESRIGVKAIPVPKGVDVKLDGHNFVVKGPKGELARTLSTLV  72

Query  352  KLEKEESGVLRVRKAMETRRS  414
             + +EE+G +R+ + +ETR +
Sbjct  73   TVSREENGDIRLVRNVETREA  93



>ref|XP_001421323.1| Plastid ribosomal protein L6 large ribosomal subunit [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO99616.1| Plastid ribosomal protein L6 large ribosomal subunit [Ostreococcus 
lucimarinus CCE9901]
Length=213

 Score = 88.2 bits (217),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A + HGL+RTL +NM+VGVS GF+KKL+L+GVGY+A ++GKD+ L LG+SHPV M +P+G
Sbjct  96   ARKGHGLYRTLANNMMVGVSTGFEKKLKLLGVGYKASMQGKDLNLALGYSHPVIMKLPEG  155

Query  593  LQV  601
            +QV
Sbjct  156  VQV  158


 Score = 55.8 bits (133),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +1

Query  205  VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLR  384
            VR T+E KESRIGKQP+ VP  VT  ++     VKGP G L +++P +  +  EE   ++
Sbjct  28   VRATIEAKESRIGKQPVAVPKGVTYTLKDNHLAVKGPKGSLEMSFP-DTMVFTEEGDSIK  86

Query  385  VRKAMET  405
            + +A +T
Sbjct  87   ISRANDT  93



>ref|WP_015227140.1| 50S ribosomal protein L6 [Halothece sp. PCC 7418]
 gb|AFZ45268.1| LSU ribosomal protein L6P [Halothece sp. PCC 7418]
Length=179

 Score = 87.8 bits (216),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GVS+GF+++LQ+ GVGYRA V+G++++LN+G+SHPV +A P+G
Sbjct  61   ARERHGLARTLVANMVHGVSQGFERRLQIQGVGYRAQVQGRNLILNVGYSHPVEIAPPEG  120

Query  593  LQV  601
            +Q+
Sbjct  121  IQI  123


 Score = 54.3 bits (129),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PIP+P  V I ++G+  KVKGP GEL  T P  V +E+E++ +L V++  ++R+
Sbjct  2    SRIGKLPIPIPQKVEITVDGKQVKVKGPKGELEQTMPDFVTIEQEDNQIL-VKRVNDSRK  60

Query  412  S  414
            +
Sbjct  61   A  61



>ref|WP_015118729.1| 50S ribosomal protein L6 [Rivularia sp. PCC 7116]
 gb|AFY55156.1| LSU ribosomal protein L6P [Rivularia sp. PCC 7116]
Length=183

 Score = 90.5 bits (223),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
              +MHGL R+L  NM+ GVS+GF +KLQL GVGYRA V+GKD+VLN+G+SHPV +  PDG
Sbjct  61   CRQMHGLSRSLVSNMVEGVSQGFQRKLQLQGVGYRAQVKGKDLVLNVGYSHPVEITPPDG  120

Query  593  LQ  598
            +Q
Sbjct  121  VQ  122


 Score = 51.2 bits (121),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE  366
            SRIGKQPI VP+ V IK+EG    VKGP GEL    P +V + +E
Sbjct  2    SRIGKQPIAVPAKVQIKIEGASISVKGPKGELSRELPTQVSVSQE  46



>ref|WP_015231117.1| 50S ribosomal protein L6 [Dactylococcopsis salina]
 gb|AFZ52143.1| ribosomal protein L6, bacterial type [Dactylococcopsis salina 
PCC 8305]
Length=179

 Score = 87.4 bits (215),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GVS+GF+++LQ+ GVGYRA V+G++++LN+G+SHPV +  PDG
Sbjct  61   ARERHGLARTLVANMVHGVSQGFERRLQIQGVGYRAQVQGRNLILNVGYSHPVEIVPPDG  120

Query  593  LQV  601
            +QV
Sbjct  121  IQV  123


 Score = 53.1 bits (126),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PIP+P  V I ++G+  KVKGP GEL  T P  V +E+EE  +L V +  ++R+
Sbjct  2    SRIGKLPIPIPKKVEITLDGKLVKVKGPKGELEQTMPDFVTIEQEEDRIL-VHRVNDSRK  60

Query  412  S  414
            +
Sbjct  61   A  61



>emb|CEG01824.1| Ribosomal protein L6, conserved site [Ostreococcus tauri]
Length=214

 Score = 89.4 bits (220),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 57/73 (78%), Gaps = 3/73 (4%)
 Frame = +2

Query  392  RLWRRDGANEM---HGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFS  562
            ++ R D + E    HGL+RTL DNM VGVS GF+KKL+L+GVGY+A ++GKD+ L+LG+S
Sbjct  87   KITRSDDSPEARKGHGLYRTLADNMFVGVSTGFEKKLKLLGVGYKAAMQGKDLNLSLGYS  146

Query  563  HPVRMAIPDGLQV  601
            HPV M +P+G+ V
Sbjct  147  HPVIMKLPEGITV  159


 Score = 50.4 bits (119),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +1

Query  205  VRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGV  378
            V + VE KESRIGK+P+ VP  VT  ++     VKGP GEL + +P  +  E++   +
Sbjct  29   VTRVVEAKESRIGKKPVAVPKGVTYTLKDNHLAVKGPKGELKMQFPPTMVFEEQGDAI  86



>tpg|DAA45423.1| TPA: hypothetical protein ZEAMMB73_235465 [Zea mays]
Length=115

 Score =   103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +1

Query  130  NLRSNFIGDASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVK  309
            N R+ F+G   G R    +  R  FVR  VECKESRIGKQPI VP NVT+ +E Q  K K
Sbjct  13   NSRTGFLGKTHGTRPRLFSAGRVGFVRTLVECKESRIGKQPIEVPPNVTLTLEEQFVKAK  72

Query  310  GPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            GPLGEL +++P +VK+ KEESG LRV K  ET+R+
Sbjct  73   GPLGELSLSFPGDVKIVKEESGNLRVYKTAETKRA  107



>ref|WP_036002394.1| 50S ribosomal protein L6 [Leptolyngbya sp. JSC-1]
Length=179

 Score = 85.1 bits (209),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A + HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G+++VL+LG+SHPV++  PDG
Sbjct  61   ARQRHGLSRTLVANMVEGVSQGFQKRLEIQGVGYRAQVQGRNLVLSLGYSHPVQIEPPDG  120

Query  593  LQ  598
            +Q
Sbjct  121  IQ  122


 Score = 54.7 bits (130),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGK+PIPVP NVT+ +  Q   VKGP GEL  T P EV++ +E   +L
Sbjct  2    SRIGKRPIPVPKNVTVTIANQHVAVKGPKGELARTLPDEVEVVQEGETIL  51



>ref|XP_005643355.1| ribosomal protein L6 [Coccomyxa subellipsoidea C-169]
 gb|EIE18811.1| ribosomal protein L6 [Coccomyxa subellipsoidea C-169]
Length=222

 Score = 83.6 bits (205),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            ANE+HGL R L +NM+VG S G+ K L LVGVGYRA V G  +VLNLG+SHP+ M  P G
Sbjct  105  ANEVHGLIRALANNMVVGTSTGWIKTLSLVGVGYRASVSGTKLVLNLGYSHPIEMDFPKG  164

Query  593  LQV  601
            + V
Sbjct  165  VTV  167


 Score = 55.8 bits (133),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +1

Query  226  KESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMET  405
            KESRIGK PIP+P  V + +     KVKGP GEL +  P  V++E++E+  LRV K  E+
Sbjct  44   KESRIGKAPIPIPKGVQLTLTRDLLKVKGPKGELELAIPEIVEIEQQEN-ALRVYKMEES  102

Query  406  RRS  414
            R++
Sbjct  103  RKA  105



>ref|WP_022605574.1| 50S ribosomal protein L6 [Rubidibacter lacunae]
 gb|ERN42229.1| ribosomal protein L6 [Rubidibacter lacunae KORDI 51-2]
Length=179

 Score = 85.1 bits (209),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A ++HGL RTL  NM+ GVS+GF +KL+L GVGYRA V+G+++VLN+G+SHPV +  P+G
Sbjct  61   ARQLHGLCRTLVANMVEGVSQGFTRKLELQGVGYRAAVQGRNLVLNVGYSHPVEIVPPEG  120

Query  593  LQV  601
            + V
Sbjct  121  ISV  123


 Score = 53.5 bits (127),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PIP+P+ V++ ++GQ  KVKGP GEL    P  + + + + G L V +  E+R
Sbjct  2    SRIGKRPIPIPAKVSVALDGQQVKVKGPKGELARILPAPIAIAQTD-GQLHVTRVDESR  59



>ref|WP_015186046.1| 50S ribosomal protein L6 [Microcoleus sp. PCC 7113]
 gb|AFZ21918.1| LSU ribosomal protein L6P [Microcoleus sp. PCC 7113]
Length=179

 Score = 86.3 bits (212),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 55/73 (75%), Gaps = 3/73 (4%)
 Frame = +2

Query  392  RLWRRD---GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFS  562
            R+ RRD    A + HGL RTL  NM+ GVS+GF+K+L + GVGYRA V+G++++LN+G+S
Sbjct  51   RVVRRDESRAARQRHGLSRTLVANMVEGVSQGFEKRLSIQGVGYRAQVQGRNLILNVGYS  110

Query  563  HPVRMAIPDGLQV  601
             PV +  PDG+QV
Sbjct  111  KPVEIVPPDGIQV  123


 Score = 52.0 bits (123),  Expect(2) = 4e-24, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PI VP  VT+ ++GQ   VKGP GEL    P +V +E++    LRV +  E+R
Sbjct  2    SRIGKRPITVPGKVTVNIDGQHVAVKGPKGELSRILPEQVAIEQDGE-TLRVVRRDESR  59



>ref|WP_017325553.1| 50S ribosomal protein L6 [Synechococcus sp. PCC 7336]
Length=178

 Score = 79.7 bits (195),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  419  EMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQ  598
            +MHGL RTL  NM+ GVS+GF+K+L++ GVGYRA  +G  +VLN+G+S+PV +  P+G+Q
Sbjct  63   QMHGLCRTLVANMVEGVSQGFEKRLEIQGVGYRAQAKGTTLVLNVGYSNPVEIPAPEGIQ  122

Query  599  V  601
            +
Sbjct  123  L  123


 Score = 57.8 bits (138),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKL  357
            SRIGKQPIP+P  VT+K+EGQD  VKGP GEL  T P +V +
Sbjct  2    SRIGKQPIPIPDKVTVKIEGQDVAVKGPKGELQRTIPAKVTV  43



>ref|WP_011612508.1| 50S ribosomal protein L6 [Trichodesmium erythraeum]
 sp|Q110C1.1|RL6_TRIEI RecName: Full=50S ribosomal protein L6 [Trichodesmium erythraeum 
IMS101]
 gb|ABG52153.1| LSU ribosomal protein L6P [Trichodesmium erythraeum IMS101]
Length=179

 Score = 79.3 bits (194),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A + +GL RTL  NM+ GVSKG++K+L + GVGYRA V+GK +VLN+G+S PV M  P+G
Sbjct  61   ARQRYGLCRTLVANMVEGVSKGYEKRLVIQGVGYRAQVQGKTLVLNVGYSKPVEMPAPEG  120

Query  593  LQV  601
            + +
Sbjct  121  INI  123


 Score = 57.8 bits (138),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PIP+P  VTI +EGQ   VKGPLGEL    P E+ ++++E+ ++ V+   ++RR
Sbjct  2    SRIGKLPIPIPKKVTITIEGQKVTVKGPLGELSRVLPPEIAVKEQENTII-VKPQEQSRR  60

Query  412  S  414
            +
Sbjct  61   A  61



>gb|AAP68351.1| putative ribosomal protein CtrL6e, 5'-partial [Oryza sativa Japonica 
Group]
Length=111

 Score =   101 bits (252),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +2

Query  440  TLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            TLTDN+IVGVSKGFDKKLQLVGVGYRA VEGKD+V+NLGFSHPVRMA+P+GL+V
Sbjct  1    TLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGKDLVMNLGFSHPVRMAVPEGLKV  54



>ref|WP_007472094.1| 50S ribosomal protein L6 [Segniliparus rugosus]
 gb|EFV11908.1| 50S ribosomal protein L6 [Segniliparus rugosus ATCC BAA-974]
Length=180

 Score = 73.2 bits (178),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +2

Query  401  RRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMA  580
            RR+ A  +HGL RTL +N++VGV++G+ K+L++VGVGYR   +GKD+   LGFSH V +A
Sbjct  60   RRNRA--LHGLSRTLVNNLVVGVTQGYTKQLEIVGVGYRVQQKGKDLEFALGFSHSVPVA  117

Query  581  IPDGL  595
             P+G+
Sbjct  118  APEGI  122


 Score = 63.5 bits (153),  Expect(2) = 9e-24, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG+ PI VPS V + ++GQD KVKGP GELG+T    +K+E+ E G L V +  + RR
Sbjct  2    SRIGRAPIQVPSGVDVTIDGQDVKVKGPKGELGLTLVEPIKVERGEDGALTVVRPDDERR  61

Query  412  S  414
            +
Sbjct  62   N  62



>ref|WP_008191191.1| 50S ribosomal protein L6 [Moorea producens]
 gb|EGJ28572.1| LSU ribosomal protein L6P [Moorea producens 3L]
Length=179

 Score = 84.7 bits (208),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NMI GVSKGF+K+L + GVGYRA V+G++++LN+G+S PV +  P+G
Sbjct  61   ARESHGLSRTLVANMIEGVSKGFEKRLDIQGVGYRAQVQGRNLILNVGYSKPVEIVPPEG  120

Query  593  LQV  601
            +QV
Sbjct  121  IQV  123


 Score = 52.4 bits (124),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEK  363
            SRIGK+PIP+PS VT+ ++GQ  KVKG  GEL    P  +K E+
Sbjct  2    SRIGKRPIPIPSKVTVTIDGQQVKVKGSKGELDWVLPDTIKAEQ  45



>gb|ACN31842.1| unknown [Zea mays]
 tpg|DAA45422.1| TPA: hypothetical protein ZEAMMB73_235465 [Zea mays]
Length=119

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  437  RTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            RTLTDN+IVGVSKGFDKKLQLVGVGYRA VEG D+V+NLGFSHPVRMAIP+GL V
Sbjct  8    RTLTDNIIVGVSKGFDKKLQLVGVGYRAAVEGNDLVMNLGFSHPVRMAIPEGLAV  62



>ref|WP_007356156.1| MULTISPECIES: 50S ribosomal protein L6 [Kamptonema]
 emb|CBN56952.1| 50S ribosomal protein L6 [ [[Oscillatoria] sp. PCC 6506]
Length=181

 Score = 84.3 bits (207),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = +2

Query  395  LWRRD---GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A ++HGL RTL  NM+ GVS GF ++L++ GVGYRA V+G++++LN+G+S 
Sbjct  52   VTRRDESRTARQLHGLCRTLVSNMVEGVSNGFQRRLEIQGVGYRAQVQGRNLILNVGYSK  111

Query  566  PVRMAIPDGLQV  601
            PV M  P+G+QV
Sbjct  112  PVEMPPPEGIQV  123


 Score = 52.4 bits (124),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PI +PS VT+ ++GQ   VKGP GEL    P EV LE E   +L  R+
Sbjct  2    SRIGKRPISIPSKVTVTIDGQHVAVKGPKGELSRLLPAEVVLELEGETLLVTRR  55



>ref|WP_010311645.1| 50S ribosomal protein L6 [Synechococcus sp. CB0101]
Length=179

 Score = 79.0 bits (193),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + E HGL RTL  NM+ GVSKG+ +KL++VGVGYRA V+GK +V++ G+SH V M  PDG
Sbjct  61   SRERHGLCRTLVANMVEGVSKGYTRKLEIVGVGYRAAVQGKKLVVSAGYSHQVEMVPPDG  120

Query  593  L  595
            +
Sbjct  121  V  121


 Score = 57.8 bits (138),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PIPVP  VT+ + G D KVKGP GEL  T P  V + ++ S ++ V  A + RR
Sbjct  2    SRIGKAPIPVPGGVTVTLSGLDVKVKGPKGELSRTLPDGVTIAQDGSNLV-VSPASDNRR  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_043368788.1| 50S ribosomal protein L6 [Cyanobium sp. PCC 7001]
Length=179

 Score = 82.8 bits (203),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + E HGL RTL  NM+ GVS+G+ +KL++VGVGYRA V+GK +V++ G+SHPV M  PDG
Sbjct  61   SRERHGLCRTLVANMVEGVSQGYTRKLEIVGVGYRAAVQGKKLVVSAGYSHPVEMVPPDG  120

Query  593  L  595
            +
Sbjct  121  V  121


 Score = 53.1 bits (126),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PIPVP  VT+ + G    VKGP GEL  T P  V + +E S ++ V    E+RR
Sbjct  2    SRIGKAPIPVPDKVTVSLSGLAVTVKGPKGELSRTLPEGVSVAQEGSTIV-VSPTSESRR  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_020691491.1| 50S ribosomal protein L6 [Aeromicrobium massiliense]
Length=180

 Score = 73.6 bits (179),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +2

Query  401  RRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKD-IVLNLGFSHPVRM  577
            RR  A  +HGL RTL +NMIVGV+ G++KKL++VGVGYR + +G   I LNLGFSH V +
Sbjct  60   RRSKA--LHGLSRTLVNNMIVGVTDGYEKKLEIVGVGYRVLAKGPSAIELNLGFSHSVPI  117

Query  578  AIPDGL  595
              P+G+
Sbjct  118  EAPEGI  123


 Score = 62.4 bits (150),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+PVP+NVT+ ++GQD  VKGP GEL  +    + + K E G L V +  + RR
Sbjct  2    SRIGKIPVPVPANVTVTIDGQDVTVKGPKGELSHSVAEPITVAKSEDGSLLVERPNDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_015203286.1| 50S ribosomal protein L6 [Crinalium epipsammum]
 gb|AFZ13172.1| LSU ribosomal protein L6P [Crinalium epipsammum PCC 9333]
Length=179

 Score = 83.6 bits (205),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A ++HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G++++LN+G+S PV +  PDG
Sbjct  61   ARQLHGLSRTLVANMVDGVSEGFQKRLEIQGVGYRAQVQGRNLILNVGYSKPVEITPPDG  120

Query  593  LQV  601
            +QV
Sbjct  121  IQV  123


 Score = 52.4 bits (124),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PI +P  VT+ +EGQ   VKGP GEL    P EV +E +E   L V++  E+R
Sbjct  2    SRIGKRPINIPGKVTVAIEGQHVGVKGPKGELSRVLPAEVTVE-QEGDTLVVKRRNESR  59



>ref|WP_006621330.1| MULTISPECIES: 50S ribosomal protein L6 [Arthrospira]
 gb|EDZ92808.1| ribosomal protein L6 [Arthrospira maxima CS-328]
 emb|CCE20751.1| 50S ribosomal subunit protein L6 [Arthrospira sp. PCC 8005]
 gb|EKD10653.1| ribosomal protein L6 [Arthrospira platensis C1]
 emb|CDM93372.1| 50S ribosomal subunit protein L6 [Arthrospira sp. PCC 8005]
Length=179

 Score = 81.3 bits (199),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +2

Query  395  LWRRDG---ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A + HGL RTL  NM+ GVS+GF+++L++ GVGYRA V+GK+++LN+G+S 
Sbjct  52   VKRRDESRVARQRHGLCRTLVANMVDGVSQGFERRLEIQGVGYRAQVQGKNLILNVGYSK  111

Query  566  PVRMAIPDGLQV  601
            PV M  P+G  V
Sbjct  112  PVEMVPPEGCSV  123


 Score = 54.7 bits (130),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PIP+P+ VT+ ++GQ   VKGP GEL    P EV L  EE   L V++  E+R
Sbjct  2    SRIGKRPIPIPAKVTLTLDGQKVTVKGPKGELSRVLPNEVILSLEED-TLIVKRRDESR  59



>ref|WP_024125573.1| 50S ribosomal protein L6 [Thermosynechococcus sp. NK55a]
 gb|AHB89192.1| 50S ribosomal protein L6 RplF [Thermosynechococcus sp. NK55a]
Length=187

 Score = 81.3 bits (199),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  395  LWRRD---GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A E HGL RTL  NM+ GVS+GF KKL++ GVGYRA ++GK +VL++G+SH
Sbjct  52   VRRRDDSRPAKERHGLCRTLLANMVEGVSQGFTKKLEIQGVGYRAQLQGKTLVLSMGYSH  111

Query  566  PVRMAIPDGL  595
            PV +  P+G+
Sbjct  112  PVEIVPPEGI  121


 Score = 54.3 bits (129),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE-ESGVLRVR  390
            SRIGK+PIP+P NVT+ +EGQ   VKGP G+L   +P EV + +E E+ V+R R
Sbjct  2    SRIGKRPIPLPKNVTLTLEGQQVTVKGPKGQLTRVFPPEVNVAQEGETIVVRRR  55



>ref|XP_002505297.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66555.1| predicted protein [Micromonas sp. RCC299]
Length=220

 Score = 83.2 bits (204),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEG-KDIVLNLGFSHPVRMAIPD  589
            A E HGL+RTL +NM+VGVS GF+KKL+LVGVGY+A +EG K I L+LG++H V + IP+
Sbjct  103  AREGHGLYRTLANNMMVGVSTGFEKKLKLVGVGYKAAMEGSKAINLSLGYAHQVIVEIPE  162

Query  590  GLQV  601
            GLQV
Sbjct  163  GLQV  166


 Score = 52.0 bits (123),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +1

Query  214  TVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
             V  K+SRIGKQP+PVP  VT  ++     VKGP GEL + +P  + L + ++ +   R 
Sbjct  38   AVVAKQSRIGKQPVPVPKGVTYTLKDNHLSVKGPKGELQMQFPETMVLTEGDNEIAFAR-  96

Query  394  AMETRRS  414
            A ++RR+
Sbjct  97   ADDSRRA  103



>ref|WP_009782735.1| 50S ribosomal protein L6 [Lyngbya sp. PCC 8106]
 gb|EAW38760.1| 50S ribosomal protein L6 [Lyngbya sp. PCC 8106]
Length=181

 Score = 83.2 bits (204),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = +2

Query  395  LWRRDG---ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A ++HGL RTL  NM+ GVSKGF+K+L++ GVGYRA V+GK+++LN+G+S 
Sbjct  52   VKRRDESRVARQLHGLSRTLVANMVDGVSKGFEKRLEIQGVGYRAQVQGKNLILNVGYSK  111

Query  566  PVRMAIPDGLQV  601
            PV M  P G+ V
Sbjct  112  PVEMNPPQGITV  123


 Score = 52.0 bits (123),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PIP+P  VT  +EGQ   VKGP GEL    P +V LE++   +L V++  E+R
Sbjct  2    SRIGKRPIPIPPKVTFTIEGQHIIVKGPKGELSRVLPEKVILEQDGDTLL-VKRRDESR  59



>ref|WP_025781338.1| 50S ribosomal protein L6 [Candidatus Synechococcus spongiarum]
Length=179

 Score = 80.1 bits (196),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 4/67 (6%)
 Frame = +2

Query  407  DGANEM----HGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVR  574
             GA+ M    HGL RTL  NM+ GV+KG+ K L++VGVGYRA V+GK +VL+ G+SHPV 
Sbjct  55   TGASRMNRMRHGLSRTLVANMVEGVTKGYSKTLEMVGVGYRAQVKGKTLVLSAGYSHPVE  114

Query  575  MAIPDGL  595
            +A P G+
Sbjct  115  LAPPQGI  121


 Score = 54.3 bits (129),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE  366
            SRIGKQP+P+P+NV +++EG+  +VKGP GEL  T P  V +++ 
Sbjct  2    SRIGKQPVPIPANVQVQLEGRTVQVKGPNGELRRTLPEGVAIDRH  46



>ref|WP_023067381.1| 50S ribosomal protein L6 [Lyngbya aestuarii]
 gb|ERT06416.1| ribosomal protein L6 [Lyngbya aestuarii BL J]
Length=181

 Score = 82.4 bits (202),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +2

Query  395  LWRRDG---ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A + HGL RTL  NM+ GVSKGF+K+L++ GVGYRA V+GK+++LN+G+S 
Sbjct  52   VKRRDESRVARQRHGLSRTLVANMVDGVSKGFEKRLEIQGVGYRAQVQGKNLILNVGYSK  111

Query  566  PVRMAIPDGLQV  601
            PV M  P G+ V
Sbjct  112  PVEMNPPQGITV  123


 Score = 52.0 bits (123),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PIP+P  VT+ +EGQ   VKGP GEL    P +V  E++   +L V++  E+R
Sbjct  2    SRIGKRPIPIPPKVTLTIEGQQITVKGPKGELSRVLPAQVLFEQDGETLL-VKRRDESR  59



>ref|WP_009767984.1| 50S ribosomal protein L6 [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ68873.1| LSU ribosomal protein L6P [Oscillatoriales cyanobacterium JSC-12]
Length=179

 Score = 84.3 bits (207),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 53/69 (77%), Gaps = 3/69 (4%)
 Frame = +2

Query  401  RRDG---ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPV  571
            RRD    A + HGL RTL  NM+ GVS+GF ++L++ GVGYRA V+GK++ LN+G+SHPV
Sbjct  54   RRDDSRVARQRHGLCRTLVANMVEGVSQGFQRRLEITGVGYRAQVQGKNLTLNMGYSHPV  113

Query  572  RMAIPDGLQ  598
            ++  P+G+Q
Sbjct  114  QIEPPEGIQ  122


 Score = 50.1 bits (118),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PI +P+ VT+ ++GQ   VKGP GEL    P EV++ +E   VL  R+
Sbjct  2    SRIGKRPISIPNKVTVVIDGQSVTVKGPKGELSRVLPSEVEVVQEGETVLVNRR  55



>ref|WP_009543883.1| MULTISPECIES: 50S ribosomal protein L6 [Cyanothece]
 sp|B1WQS5.1|RL6_CYAA5 RecName: Full=50S ribosomal protein L6 [Cyanothece sp. ATCC 51142]
 gb|ACB53377.1| 50S ribosomal protein L6 [Cyanothece sp. ATCC 51142]
Length=179

 Score = 82.8 bits (203),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +2

Query  374  ECLGSERLWRRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNL  553
            E +  +R+     A E HGLFRTL  NMI GVS+GF+K+L + GVGYRA  +G  + LN+
Sbjct  48   ETVEVQRVDDSRTARERHGLFRTLVANMIQGVSQGFEKRLNIQGVGYRAQAQGSKLTLNV  107

Query  554  GFSHPVRMAIPDGLQV  601
            G+S PV M +P G+ V
Sbjct  108  GYSKPVEMTMPQGINV  123


 Score = 51.6 bits (122),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE  366
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P EV + +E
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSEVTVNQE  46



>ref|WP_011055950.1| 50S ribosomal protein L6 [Thermosynechococcus elongatus]
 ref|NP_680886.1| 50S ribosomal protein L6 [Thermosynechococcus elongatus BP-1]
 sp|Q8DML8.1|RL6_THEEB RecName: Full=50S ribosomal protein L6 [Thermosynechococcus elongatus 
BP-1]
 dbj|BAC07648.1| 50S ribosomal protein L6 [Thermosynechococcus elongatus BP-1]
Length=187

 Score = 81.3 bits (199),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = +2

Query  395  LWRRD---GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A E HGL RTL  NM+ GVS+GF KKL++ GVGYRA ++GK +VL++G+SH
Sbjct  52   VKRRDDSRPAKERHGLCRTLLANMVEGVSQGFTKKLEIQGVGYRAQLQGKTLVLSMGYSH  111

Query  566  PVRMAIPDGL  595
            PV +  P+G+
Sbjct  112  PVEIVPPEGI  121


 Score = 53.1 bits (126),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIP+P NVT+ ++GQ   VKGP G+L   +P EV + +E   ++  R+
Sbjct  2    SRIGKRPIPLPKNVTLTLDGQQVTVKGPKGQLSRVFPPEVNVVQEGEAIVVKRR  55



>ref|WP_019500654.1| 50S ribosomal protein L6 [Pseudanabaena sp. PCC 6802]
Length=179

 Score = 79.0 bits (193),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +2

Query  392  RLWRRD---GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFS  562
            ++ RRD    A +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G  ++LN+G+S
Sbjct  51   QVNRRDDSRPARQMHGLCRTLVANMVEGVSEGFQRRLEIQGVGYRAQVQGTTLILNVGYS  110

Query  563  HPVRMAIPDGLQ  598
            +PV +  P G+Q
Sbjct  111  NPVPVEAPAGIQ  122


 Score = 55.1 bits (131),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PIPVP+ VT+ + GQ   VKGP GEL  T P +V++ + +S VL+V +  ++R
Sbjct  2    SRIGKRPIPVPNKVTVTIAGQHVTVKGPKGELQRTLPNQVEVVQSDS-VLQVNRRDDSR  59



>ref|WP_030473453.1| 50S ribosomal protein L6 [Lechevalieria aerocolonigenes]
Length=179

 Score = 72.0 bits (175),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 50/65 (77%), Gaps = 2/65 (3%)
 Frame = +2

Query  401  RRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMA  580
            RR+ A  +HGL RTL  NM+VGV++G++KK+++ GVGYR  ++G ++   LG+SHPV++ 
Sbjct  60   RRNRA--LHGLSRTLVHNMVVGVTQGYEKKMEIHGVGYRVALKGSELEFALGYSHPVKVE  117

Query  581  IPDGL  595
             P+G+
Sbjct  118  APEGI  122


 Score = 62.0 bits (149),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGKQPI VPS V + + GQD  VKGP G L +T    + LEK E G L V++  + RR
Sbjct  2    SRIGKQPIIVPSGVDVNIAGQDVSVKGPKGTLTLTIAEPISLEKAEDGTLEVKRPNDERR  61

Query  412  S  414
            +
Sbjct  62   N  62



>ref|XP_001784938.1| predicted protein [Physcomitrella patens]
 gb|EDQ50246.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  374  ECLGSERLWRRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNL  553
            E L  ER      A +MHGLFRTLTDNM++GVSKGF+K+LQL+GVGYRA VE  ++ LNL
Sbjct  97   EVLLVERAVESRRARQMHGLFRTLTDNMVIGVSKGFEKRLQLIGVGYRAAVEKDELALNL  156

Query  554  GFSHPVRMAIPDGLQV  601
            GFSH VRM IP+ + V
Sbjct  157  GFSHQVRMKIPEAITV  172


 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 64/104 (62%), Gaps = 11/104 (11%)
 Frame = +1

Query  121  ATSNLRSNFIG-----DASGIRFFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKM  285
             +S+LRS+F G     D +G         +   V   +E KESRIGK PIPVP  VT+ +
Sbjct  12   CSSSLRSSFQGESLIVDNAGSLCQVQLQGKGALV---IEAKESRIGKAPIPVPKGVTVNL  68

Query  286  EGQDFKVKGPLGELGITYPREVKLEKEESG-VLRVRKAMETRRS  414
            +GQ+  VKG LGEL  TYPREVKL    SG VL V +A+E+RR+
Sbjct  69   DGQNLSVKGALGELVRTYPREVKL--TNSGEVLLVERAVESRRA  110



>ref|WP_012593618.1| MULTISPECIES: 50S ribosomal protein L6 [Cyanothece]
 sp|B7K234.1|RL6_CYAP8 RecName: Full=50S ribosomal protein L6 [Cyanothece sp. PCC 8801]
 gb|ACK64341.1| ribosomal protein L6 signature 1 [Cyanothece sp. PCC 8801]
 gb|ACU99203.1| ribosomal protein L6 [Cyanothece sp. PCC 8802]
Length=179

 Score = 82.4 bits (202),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GVSKGF+K+L + GVGYRA V+G  + LN+G+S PV M +P G
Sbjct  61   ARERHGLTRTLVANMVEGVSKGFEKRLSIQGVGYRAQVQGTKLTLNVGYSKPVEMTMPAG  120

Query  593  LQV  601
            +QV
Sbjct  121  IQV  123


 Score = 51.6 bits (122),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L  T P +V + +E   +L
Sbjct  2    SRIGKRPIPIPNKVTIDIQGQHVAVKGPKGSLERTLPDKVNVVQENDTLL  51



>ref|WP_008275484.1| 50S ribosomal protein L6 [Cyanothece sp. CCY0110]
 gb|EAZ91358.1| 50S ribosomal protein L6 [Cyanothece sp. CCY0110]
Length=179

 Score = 83.6 bits (205),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGLFRTL  NMI GVSKGF+K+L + GVGYRA  +G  + LN+G+S PV M +P G
Sbjct  61   ARERHGLFRTLVSNMIEGVSKGFEKRLSIQGVGYRAQAQGTKLTLNVGYSKPVEMTMPKG  120

Query  593  LQV  601
            + V
Sbjct  121  INV  123


 Score = 50.1 bits (118),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P +V + ++   +L V++  ++R
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSQVTVNQDGETIL-VQRVDDSR  59



>ref|WP_011628222.1| 50S ribosomal protein L6 [Alkalilimnicola ehrlichii]
 sp|Q0ABG0.1|RL6_ALKEH RecName: Full=50S ribosomal protein L6 [Alkalilimnicola ehrlichii 
MLHE-1]
 gb|ABI55827.1| LSU ribosomal protein L6P [Alkalilimnicola ehrlichii MLHE-1]
Length=177

 Score = 75.1 bits (183),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            + G  R L +NM+ GVS+GF++KL+L GVGYRA V+GK++ L LGFSHPV   +P+G+ +
Sbjct  64   LAGTTRALLNNMVTGVSQGFERKLELRGVGYRAQVQGKNLNLTLGFSHPVDYPVPEGITI  123


 Score = 58.5 bits (140),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SR+ K+P+ VPS V +K++GQD KVKGP GEL  T    V +E+ + G LRV+  ++ RR
Sbjct  2    SRVAKRPVKVPSGVEVKLDGQDVKVKGPKGELAWTVHDWVAVEQAD-GELRVQAQLDDRR  60

Query  412  S  414
            +
Sbjct  61   A  61



>ref|WP_036532292.1| 50S ribosomal protein L6 [Neosynechococcus sphagnicola]
 gb|KGF73056.1| 50S ribosomal protein L6 [Neosynechococcus sphagnicola sy1]
Length=179

 Score = 81.3 bits (199),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 53/71 (75%), Gaps = 3/71 (4%)
 Frame = +2

Query  395  LWRRD---GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A   HGL RTL  NM+ GVS+GF ++L++ GVGYRA ++G ++VLN+G+SH
Sbjct  52   VKRRDESRAARARHGLSRTLVANMVDGVSQGFQRRLEIQGVGYRAQLQGVNLVLNMGYSH  111

Query  566  PVRMAIPDGLQ  598
            PV++  PDG+Q
Sbjct  112  PVQIVPPDGIQ  122


 Score = 52.0 bits (123),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PI +P  VT+ +EGQ   VKGP GEL    P EV +E+E +  L V++  E+R
Sbjct  2    SRIGKRPISIPPKVTVTLEGQQVLVKGPKGELSRLLPAEVSVEQEGT-TLVVKRRDESR  59



>ref|WP_006618086.1| 50S ribosomal protein L6 [Arthrospira platensis]
 dbj|BAI90070.1| 50S ribosomal protein L6 [Arthrospira platensis NIES-39]
 gb|KDR56830.1| 50S ribosomal protein L6 [Arthrospira platensis str. Paraca]
Length=179

 Score = 81.3 bits (199),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +2

Query  395  LWRRDG---ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A + HGL RTL  NM+ GVS+GF+++L++ GVGYRA V+GK+++LN+G+S 
Sbjct  52   VKRRDESLVARQRHGLCRTLVANMVDGVSQGFERRLEIQGVGYRAQVQGKNLILNVGYSK  111

Query  566  PVRMAIPDGLQV  601
            PV M  P+G  V
Sbjct  112  PVEMVPPEGCSV  123


 Score = 51.6 bits (122),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKE  366
            SRIGK+PIP+P+ VT+ ++GQ   VKGP GEL    P EV L  E
Sbjct  2    SRIGKRPIPIPAKVTLTLDGQKVTVKGPKGELSRVLPNEVILSLE  46



>ref|WP_039717296.1| 50S ribosomal protein L6 [Scytonema millei]
 gb|KIF19826.1| 50S ribosomal protein L6 [Scytonema millei VB511283]
Length=179

 Score = 82.4 bits (202),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + ++HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G+++VL+LG+SHPV++  P+G
Sbjct  61   SRQLHGLSRTLVANMVDGVSQGFQKRLEIQGVGYRAQVQGRNLVLSLGYSHPVQIEPPEG  120

Query  593  LQV  601
            +Q+
Sbjct  121  IQL  123


 Score = 50.4 bits (119),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI +PS VT+ + G    VKGP GEL    P  V +E+E   +L V++  E+R 
Sbjct  2    SRIGKRPITIPSKVTVTINGSHVAVKGPKGELARVLPSAVTVEQEGDTIL-VKRHDESRL  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_015170862.1| 50S ribosomal protein L6 [Geitlerinema sp. PCC 7407]
 gb|AFY65294.1| LSU ribosomal protein L6P [Geitlerinema sp. PCC 7407]
Length=179

 Score = 80.9 bits (198),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = +2

Query  395  LWRRDG---ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A E HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G++++LN+G+SH
Sbjct  52   VKRRDESRVARERHGLCRTLLSNMVEGVSQGFQKRLEIQGVGYRAQVQGRNLILNVGYSH  111

Query  566  PVRMAIPDGLQV  601
             V +  P+G+Q+
Sbjct  112  QVNIEPPEGVQL  123


 Score = 52.0 bits (123),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PI +P+ VT+ + GQ   VKGP GEL  T+P  V  E++   +L V++  E+R
Sbjct  2    SRIGKRPISIPAKVTVSISGQSITVKGPKGELSRTFPAGVVFEQDGETIL-VKRRDESR  59



>ref|WP_023071150.1| 50S ribosomal protein L6 [Leptolyngbya sp. Heron Island J]
 gb|ESA38002.1| 50s ribosomal protein l6 [Leptolyngbya sp. Heron Island J]
Length=178

 Score = 79.7 bits (195),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A   HGL RTL  NM+ GVSKGF+K+L++ GVGYRA V+GK + +NLG+SHPV    P G
Sbjct  61   ARARHGLSRTLIANMVEGVSKGFEKRLEIKGVGYRAAVKGKTLTMNLGYSHPVEFEPPAG  120

Query  593  LQ  598
            ++
Sbjct  121  IE  122


 Score = 52.8 bits (125),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+P+PVPS VT+ ++ Q   VKGP GEL    P EV + +E   V+  R+
Sbjct  2    SRIGKKPVPVPSGVTVSIDAQSVVVKGPKGELSRVLPGEVNIAQEGEQVVVTRQ  55



>ref|WP_043058732.1| 50S ribosomal protein L6 [Mesorhizobium sp. UASWS1009]
 gb|KIU54917.1| 50S ribosomal protein L6 [Mesorhizobium sp. UASWS1009]
Length=177

 Score = 79.0 bits (193),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL DNMIVGV+ G+ KKL+L G GYR + +G D+ L LGFSHPV +  P+G
Sbjct  61   SRSLHGLTRTLIDNMIVGVTAGYSKKLELHGTGYRVVAKGSDLELQLGFSHPVEVTAPEG  120

Query  593  L  595
            +
Sbjct  121  I  121


 Score = 53.5 bits (127),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELG--ITYPREVKLEKEESGVLRVRKAMET  405
            SRIGK PI VPS V + + G D  VKGP GELG  I+ P E KLE+    V+R     E+
Sbjct  2    SRIGKLPITVPSGVEVAINGSDVSVKGPKGELGMSISGPIEAKLEENTITVIRPDDERES  61

Query  406  R  408
            R
Sbjct  62   R  62



>ref|WP_028191074.1| 50S ribosomal protein L6 [Salinispora arenicola]
Length=180

 Score = 78.6 bits (192),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  PDG
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPDG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 53.9 bits (128),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + ++GQ  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGELSHTLAEPITVERAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|XP_002966651.1| hypothetical protein SELMODRAFT_6327, partial [Selaginella moellendorffii]
 ref|XP_002978092.1| hypothetical protein SELMODRAFT_6323, partial [Selaginella moellendorffii]
 gb|EFJ20749.1| hypothetical protein SELMODRAFT_6323, partial [Selaginella moellendorffii]
 gb|EFJ32678.1| hypothetical protein SELMODRAFT_6327, partial [Selaginella moellendorffii]
Length=171

 Score = 79.7 bits (195),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  389  ERLWRRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHP  568
            +R+     +  MHGL R L  NM+VGVS+GF+KKL +VGVGYRA+V+G  ++LN+GF  P
Sbjct  49   KRVMETKKSRAMHGLSRQLLSNMVVGVSQGFEKKLIMVGVGYRAVVQGNKLLLNIGFKMP  108

Query  569  VRMAIPDGL  595
              +AIPDG+
Sbjct  109  EVVAIPDGI  117


 Score = 52.4 bits (124),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = +1

Query  241  GKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRRS  414
            G++P+PVP  VT+K++GQ  +V GPLG L  T+  EV++  E    L +++ MET++S
Sbjct  1    GRKPVPVPKGVTVKIDGQLVEVTGPLGSLSWTFRDEVRITLEND-TLILKRVMETKKS  57



>ref|XP_001771522.1| predicted protein [Physcomitrella patens]
 gb|EDQ63722.1| predicted protein [Physcomitrella patens]
Length=230

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +2

Query  374  ECLGSERLWRRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNL  553
            + L  ER      A +MHGLFRTLTDNM++GVSKGF+K+LQL+GVGYRA VE  ++ LNL
Sbjct  98   DVLTVERAVESRRARQMHGLFRTLTDNMVIGVSKGFEKRLQLIGVGYRAAVEKDELALNL  157

Query  554  GFSHPVRMAIPDGLQV  601
            GFSH VRM IP+ + V
Sbjct  158  GFSHQVRMKIPEDITV  173


 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +1

Query  217  VECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKA  396
            ++ KESRIGK PIPVP  VTI +EGQ   VKGPLGEL  TYPREVKL      VL V +A
Sbjct  47   IKAKESRIGKAPIPVPKGVTINLEGQSLTVKGPLGELARTYPREVKLT-NAGDVLTVERA  105

Query  397  METRRS  414
            +E+RR+
Sbjct  106  VESRRA  111



>ref|WP_018908047.1| 50S ribosomal protein L6 [Salinispora arenicola]
Length=180

 Score = 77.0 bits (188),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 55.1 bits (131),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + ++GQ  KVKGP GEL  T    + +E+ E G L V +  E R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGELSHTLAEPITVERAEDGQLNVARPNEERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_006100646.1| 50S ribosomal protein L6 [Coleofasciculus chthonoplastes]
 gb|EDX76158.1| ribosomal protein L6, putative [Coleofasciculus chthonoplastes 
PCC 7420]
Length=179

 Score = 78.2 bits (191),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +2

Query  395  LWRRDG---ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A + HGL RTL  NM+ GVSKGF+++L + GVGYRA V+G++++LN+G+S 
Sbjct  52   VRRRDESRLARQRHGLSRTLVANMVEGVSKGFERRLAIQGVGYRAQVQGRNLILNVGYSQ  111

Query  566  PVRMAIPDGLQV  601
            PV +  P+ +Q+
Sbjct  112  PVEIVPPEDVQL  123


 Score = 53.9 bits (128),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PI +P+ VT+ +EGQ   VKGP GEL    P++V +E+E    + VR+  E+R
Sbjct  2    SRIGKRPITIPNKVTVTIEGQQVTVKGPKGELQRVLPKQVTIEQEGE-TIHVRRRDESR  59



>ref|WP_015152288.1| 50S ribosomal protein L6 [Chroococcidiopsis thermalis]
 gb|AFY85737.1| LSU ribosomal protein L6P [Chroococcidiopsis thermalis PCC 7203]
Length=179

 Score = 82.8 bits (203),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + ++HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G+++VL+LG+SHPV++  P+G
Sbjct  61   SRQLHGLSRTLVANMVDGVSQGFQKRLEIQGVGYRAQVQGRNLVLSLGYSHPVQIEPPEG  120

Query  593  LQV  601
            +Q+
Sbjct  121  IQL  123


 Score = 49.3 bits (116),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI +PS VT+ + G    VKGP GEL    P  V +E+E   +L V++  ++R 
Sbjct  2    SRIGKRPITIPSKVTVTINGSHVAVKGPKGELARVLPSAVTVEQEGDTIL-VKRQDDSRL  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_029639091.1| 50S ribosomal protein L6 [alpha proteobacterium Mf 1.05b.01]
Length=177

 Score = 73.2 bits (178),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A  M G+ RTL  N++ GV++GF K+L++ GVGYRA ++GKD+ L LGFSH V   IP+G
Sbjct  61   ARAMWGMQRTLVQNIVTGVTEGFTKRLEINGVGYRAQMQGKDLQLALGFSHEVVHKIPEG  120

Query  593  LQV  601
            +QV
Sbjct  121  IQV  123


 Score = 58.5 bits (140),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGKQPI VP  VT+ ++GQ+  VKGP GE+ +T   EV L + + G L V    ET+R
Sbjct  2    SRIGKQPIAVPGGVTVNIDGQNLAVKGPKGEMSMTLVDEVTLAQGDDG-LTVTPRDETQR  60

Query  412  S*RDAWFIQ  438
            + R  W +Q
Sbjct  61   A-RAMWGMQ  68



>ref|WP_040788652.1| 50S ribosomal protein L6 [Nocardia paucivorans]
Length=179

 Score = 73.2 bits (178),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  NMI GV++G++KK+++ GVGYR   +GKD+   LG+SHPV +  P+G
Sbjct  62   SRSLHGLTRTLIANMITGVTQGYEKKMEIFGVGYRVQQKGKDLEFALGYSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 58.5 bits (140),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+PVPS V + + GQD  VKGP G+L +T    + + + + G + V +  + RR
Sbjct  2    SRIGKHPVPVPSGVEVTLNGQDIAVKGPKGQLSLTVAEPITVSRNDDGAIVVTRPDDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_010469303.1| MULTISPECIES: 50S ribosomal protein L6 [Acaryochloris]
 sp|B0C1E7.1|RL6_ACAM1 RecName: Full=50S ribosomal protein L6 [Acaryochloris marina 
MBIC11017]
 gb|ABW29682.1| 50S ribosomal protein L6 [Acaryochloris marina MBIC11017]
Length=179

 Score = 85.9 bits (211),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A + HGL RTL  NM+ GVSKGF+KKLQ+ GVGYRA V+G++++LN+G+S+PV +  P+G
Sbjct  61   ARQRHGLSRTLIANMVEGVSKGFEKKLQIQGVGYRAQVQGRNLILNVGYSNPVTIEPPEG  120

Query  593  LQV  601
            +QV
Sbjct  121  VQV  123


 Score = 45.4 bits (106),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK PIP+P  V + ++GQ   VKGP GEL      EV +E+ ++ V   R+
Sbjct  2    SRIGKVPIPIPDKVNVTIKGQAVTVKGPKGELSREITPEVAIEQADNLVTVTRR  55



>ref|WP_007073021.1| 50S ribosomal protein L6 [Micromonospora sp. ATCC 39149]
 gb|EEP71745.1| 50S ribosomal protein L6 [Micromonospora sp. ATCC 39149]
Length=180

 Score = 75.9 bits (185),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G  K L++ G GYR   +GKD+   LGFSHPV +  PDG
Sbjct  62   AKELHGLSRTLVANMIVGVTEGHRKSLEIAGTGYRVTAKGKDLEFALGFSHPVLVPAPDG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 55.5 bits (132),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V I ++GQ  KVKGP GEL +T    +  E+ E G L+V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGQTVKVKGPKGELTLTLAEPITAERAEDGQLQVNRPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_013735942.1| 50S ribosomal protein L6 [Verrucosispora maris]
 gb|AEB47301.1| 50S ribosomal protein L6 [Verrucosispora maris AB-18-032]
Length=180

 Score = 78.2 bits (191),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  PDG
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEISGTGYRVTAKGKDLEFALGFSHPVTVPAPDG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 53.5 bits (127),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVPS V + ++G+  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPSGVDVTIDGRTVKVKGPKGELSHTLAEPISIERAEDGQLSVNRPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_015187428.1| 50S ribosomal protein L6 [Gloeocapsa sp. PCC 7428]
 gb|AFZ29552.1| LSU ribosomal protein L6P [Gloeocapsa sp. PCC 7428]
Length=179

 Score = 84.3 bits (207),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A +MHGL RTL  NM+ GVS+GF ++L++ GVGYRA V+G+++ LN+G+SHPV++  P+G
Sbjct  61   ARQMHGLARTLVANMVDGVSQGFQRRLEIQGVGYRAAVQGRNLTLNVGYSHPVQIEPPEG  120

Query  593  LQV  601
            +Q+
Sbjct  121  IQI  123


 Score = 47.0 bits (110),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PI +P+ V + ++G    VKGP GEL    P  V +E+E   +L  RK
Sbjct  2    SRIGKRPIAIPAKVQVTLDGSQVTVKGPKGELSRELPSAVTIEQEGDTLLVKRK  55



>ref|WP_035830882.1| 50S ribosomal protein L6 [Cyanobium sp. CACIAM 14]
 gb|KEF42319.1| 50S ribosomal protein L6 [Cyanobium sp. CACIAM 14]
Length=179

 Score = 81.3 bits (199),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + E HGL RTL  NM+ GVSKGF +KL++VGVGYRA V+G+ +V++ G+SHPV M  P+G
Sbjct  61   SRERHGLSRTLVANMVEGVSKGFTRKLEIVGVGYRAQVQGRKLVVSAGYSHPVEMDPPEG  120

Query  593  L  595
            +
Sbjct  121  I  121


 Score = 50.4 bits (119),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PIP+P  VT+ ++G    VKGP GEL    P  V +  +++G L V    + RR
Sbjct  2    SRIGKAPIPIPDKVTVTLQGLSVTVKGPKGELSRVLPEGVSVS-QDNGTLVVSPTSDHRR  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_018400614.1| 50S ribosomal protein L6 [filamentous cyanobacterium ESFC-1]
Length=181

 Score = 78.6 bits (192),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A + HGL RTL  NM+VGVS+GF K+LQ+ GVGYRA ++GK +VLN+G+S+PV +  P+ 
Sbjct  61   ARQRHGLSRTLIANMVVGVSQGFVKRLQIQGVGYRAQMQGKTLVLNVGYSNPVEIEPPED  120

Query  593  LQV  601
            +Q+
Sbjct  121  VQL  123


 Score = 52.8 bits (125),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PIP+P  V+I ++GQ   VKGP G+L  T P EV + +E++ +  V++  E+R
Sbjct  2    SRIGKRPIPIPDKVSITLDGQHVAVKGPKGQLERTLPPEVVITQEDNTIF-VKRRNESR  59



>emb|CCQ60081.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 0401]
Length=179

 Score = 79.7 bits (195),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A+E HGL RTL  NM+ GVSKGF+K+L + GVGYRA  +G  + LN+G+S+PV M +P G
Sbjct  61   AHERHGLSRTLVANMVEGVSKGFEKRLSIQGVGYRAQAQGTKLTLNVGYSNPVEMTMPKG  120

Query  593  LQV  601
            + V
Sbjct  121  VNV  123


 Score = 51.6 bits (122),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P +V +++E   V+
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSKVSVKQEGENVV  51



>ref|WP_017659044.1| 50S ribosomal protein L6 [Geitlerinema sp. PCC 7105]
Length=179

 Score = 73.6 bits (179),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  425  HGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            HGL RTL  NM+ GVS GF+++L++ GVGYRA V+GK +VLN+G+S PV +  P+G+++
Sbjct  65   HGLSRTLLFNMVEGVSNGFERRLEIQGVGYRAQVKGKTLVLNVGYSQPVEIDPPEGVEL  123


 Score = 57.8 bits (138),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI VP NVT+ ++GQ   VKGP GEL   +P+EV  +++   +L V++  E+R 
Sbjct  2    SRIGKRPISVPKNVTVTIDGQAVSVKGPKGELSRVFPKEVSFDRDGEAIL-VKRHDESRV  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_013139775.1| 50S ribosomal protein L6 [Segniliparus rotundus]
 gb|ADG99326.1| ribosomal protein L6 [Segniliparus rotundus DSM 44985]
Length=180

 Score = 70.5 bits (171),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL +N++VGV++G+ K+L++VGVGYR   +GKD+   LGFSH V +  P+G+
Sbjct  65   LHGLSRTLVNNLVVGVTEGYTKQLEIVGVGYRVQQKGKDLEFALGFSHSVPVQAPEGV  122


 Score = 60.5 bits (145),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG+ PI VP  V + ++GQ+ KVKGP GELG+T    +K+E+ + GVL V +  + RR
Sbjct  2    SRIGRAPIQVPPGVDVTIDGQNVKVKGPKGELGLTLVEPIKVERGDDGVLSVTRPDDERR  61

Query  412  S  414
            +
Sbjct  62   N  62



>ref|WP_018682818.1| 50S ribosomal protein L6 [Actinokineospora enzanensis]
Length=179

 Score = 73.2 bits (178),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL R+L +N++VGV+ G++KK+++ GVGYR + +G D+   LG+SHPV++A P+G+
Sbjct  65   LHGLTRSLVNNIVVGVTAGYEKKMEIHGVGYRVVAKGSDLEFALGYSHPVKVAAPEGI  122


 Score = 57.8 bits (138),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG+ PIPVPS V + +EGQD  VKGP G L +     + +E+ E G L+V +  + R+
Sbjct  2    SRIGRLPIPVPSGVDVTIEGQDISVKGPKGTLALKVSEPITVERAEDGTLQVTRPNDERQ  61

Query  412  S  414
            +
Sbjct  62   N  62



>ref|WP_007306418.1| 50S ribosomal protein L6 [Crocosphaera watsonii]
 gb|EAM49865.1| Ribosomal protein L6 [Crocosphaera watsonii WH 8501]
 gb|EHJ11711.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 0003]
 emb|CCQ53513.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 8502]
 emb|CCQ57161.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 0005]
Length=179

 Score = 79.3 bits (194),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GVSKGF+K+L + GVGYRA  +G  + LN+G+S+PV M +P G
Sbjct  61   ARERHGLSRTLVANMVEGVSKGFEKRLSIQGVGYRAQAQGTKLTLNVGYSNPVEMTMPKG  120

Query  593  LQV  601
            + V
Sbjct  121  VNV  123


 Score = 51.6 bits (122),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P +V +++E   V+
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSKVSVKQEGENVV  51



>ref|WP_034304256.1| 50S ribosomal protein L6 [Amycolatopsis lurida]
 gb|KFU83012.1| 50S ribosomal protein L6 [Amycolatopsis lurida NRRL 2430]
 gb|AJK51997.1| 50S ribosomal protein L6 [Amycolatopsis lurida NRRL 2430]
Length=179

 Score = 74.7 bits (182),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G+
Sbjct  65   LHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEGI  122


 Score = 56.2 bits (134),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + +EGQ  KVKGP G L  T    + +EK E+G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIEGQQIKVKGPKGTLEHTIAEPITVEKAENGTLEVKRPDEERT  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_015105249.1| 50S ribosomal protein L6 [Saccharothrix espanaensis]
 emb|CCH35141.1| 50S ribosomal protein L6 [Saccharothrix espanaensis DSM 44229]
Length=179

 Score = 72.0 bits (175),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  NM++GV++G++KK+++ GVGYR  ++G D+   LG+SHPV++  P G
Sbjct  62   SRSLHGLSRTLVQNMVIGVTQGYEKKMEIHGVGYRVALKGSDLEFALGYSHPVKVEAPAG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 58.9 bits (141),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PI VPS V + + GQD  VKGP G L +T    + +EK E G L V++  + RR
Sbjct  2    SRIGKLPITVPSGVDVNIAGQDVNVKGPKGTLSLTIAEPIIIEKVEDGTLEVKRPNDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>emb|CCQ65151.1| LSU ribosomal protein L6p (L9e) [Crocosphaera watsonii WH 0402]
Length=180

 Score = 79.3 bits (194),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GVSKGF+K+L + GVGYRA  +G  + LN+G+S+PV M +P G
Sbjct  61   ARERHGLSRTLVANMVEGVSKGFEKRLSIQGVGYRAQAQGTKLTLNVGYSNPVEMTMPKG  120

Query  593  LQV  601
            + V
Sbjct  121  VNV  123


 Score = 51.6 bits (122),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGK+PIP+P+ VTI ++GQ   VKGP G L +  P +V +++E   V+
Sbjct  2    SRIGKKPIPLPNKVTIDIKGQHIAVKGPKGSLELDLPSKVSVKQEGENVV  51



>ref|WP_012184316.1| 50S ribosomal protein L6 [Salinispora arenicola]
 sp|A8M514.1|RL6_SALAI RecName: Full=50S ribosomal protein L6 [Salinispora arenicola 
CNS-205]
 gb|ABW00082.1| ribosomal protein L6 [Salinispora arenicola CNS-205]
Length=180

 Score = 77.0 bits (188),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 53.9 bits (128),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + ++GQ  KVKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGELSHTLAEPITVERAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|XP_001696829.1| plastid ribosomal protein L6 [Chlamydomonas reinhardtii]
 gb|EDP00937.1| plastid ribosomal protein L6 [Chlamydomonas reinhardtii]
Length=207

 Score = 81.3 bits (199),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A   HGL R+L +N++VGVS GF+K++++VG GYRA V GKD+ LN+G+S P  +AIP+G
Sbjct  86   AMSQHGLNRSLVNNLVVGVSTGFEKRMEMVGTGYRAAVAGKDLTLNVGYSKPRVLAIPEG  145

Query  593  LQV  601
            L+V
Sbjct  146  LKV  148


 Score = 49.7 bits (117),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = +1

Query  172  FFKLTIARNNFVRKTVECKESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREV  351
            F    ++R++  R  V  K+SRIG+ PI VP  VT+ +EGQ  +VKGP G L  T    V
Sbjct  9    FRAAAVSRSS--RLCVVAKDSRIGRAPITVPKGVTVTLEGQLVRVKGPNGTLEQTLSPLV  66

Query  352  KLEKEESGVLRVRKAMETR  408
            K+E+ + G L++ K  + R
Sbjct  67   KIEQAD-GKLKLFKLADDR  84



>ref|XP_003060321.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55090.1| predicted protein [Micromonas pusilla CCMP1545]
Length=218

 Score = 86.7 bits (213),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL+RTLT+NM+VGVS GF+KKL+LVGVGY+A ++GKD+ L LG++HPV ++ P G
Sbjct  102  AREGHGLYRTLTNNMMVGVSTGFEKKLKLVGVGYKASMQGKDLNLALGYAHPVILSPPPG  161

Query  593  LQV  601
            + +
Sbjct  162  IDI  164


 Score = 43.9 bits (102),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +1

Query  229  ESRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            ESR+GKQP+ VP  VT  ++     VKGP G L   +P +  +  E+   +++ KA E+R
Sbjct  42   ESRVGKQPVKVPKGVTYTLKDNHLAVKGPKGSLEFQFP-DTMVFTEDGDEIKLSKADESR  100



>ref|WP_015805277.1| 50S ribosomal protein L6 [Actinosynnema mirum]
 gb|ACU40397.1| ribosomal protein L6 [Actinosynnema mirum DSM 43827]
Length=179

 Score = 72.4 bits (176),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  NM+VGV++G++KK+++ GVGYR  ++G D+   LG+SHPV++  P G
Sbjct  62   SRSLHGLSRTLVQNMVVGVTQGYEKKMEIHGVGYRVALKGSDLEFALGYSHPVKVEAPAG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 58.2 bits (139),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PI VPS V + ++GQ   VKGP G L +T    + LEK + G L V++  + RR
Sbjct  2    SRIGKLPITVPSGVDVNIDGQAVSVKGPKGTLNLTIAEPITLEKADDGTLEVKRPNDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_017297633.1| 50S ribosomal protein L6 [Nodosilinea nodulosa]
Length=179

 Score = 74.7 bits (182),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GVS G+ K+L++ G+GYRA V+G+++ L+LG+SHPV    P G
Sbjct  61   ARERHGLCRTLVANMVEGVSNGYQKRLEIQGIGYRAQVQGRNLNLSLGYSHPVVFEPPTG  120

Query  593  LQ  598
            ++
Sbjct  121  IE  122


 Score = 55.8 bits (133),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIPVP+ V+I ++GQD +VKGP GEL  T P  V + ++   +L  RK
Sbjct  2    SRIGKRPIPVPAKVSITIDGQDVQVKGPKGELSRTLPSGVVIVQDGDTILVNRK  55



>ref|WP_030006185.1| 50S ribosomal protein L6 [Synechococcus sp. NKBG042902]
Length=180

 Score = 80.9 bits (198),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NMI GVS+G+ K+L+++GVGYRA V+G  + LN+G+S PV M +P+G
Sbjct  61   ARERHGLCRTLVANMIEGVSQGYSKQLEIIGVGYRAQVQGNKLTLNVGYSKPVEMQMPEG  120

Query  593  L  595
            +
Sbjct  121  V  121


 Score = 49.7 bits (117),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGK+PIP+P  VT+ + G +  VKGP G L  T P +V + +E++ V+
Sbjct  2    SRIGKKPIPIPDKVTVTLNGANVAVKGPKGSLERTLPEKVTVTQEDNTVV  51



>ref|WP_027654160.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 79.0 bits (193),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMI+GV++G+ K L++ G GYR   +GKD+   LGFSHPV +A PDG
Sbjct  62   AKELHGLSRTLVANMIIGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVIVAAPDG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 51.2 bits (121),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTIAEPITIERAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_014349107.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica]
 ref|YP_005262279.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica GUH-2]
 emb|CCF61635.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica GUH-2]
Length=179

 Score = 70.9 bits (172),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL  NMI GV+KG++KKL++ GVGYR  ++G+++   LG+SHPV    P G+
Sbjct  65   LHGLTRTLVANMIEGVTKGYEKKLEIAGVGYRVALKGQNLEFALGYSHPVVAEPPQGI  122


 Score = 59.7 bits (143),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGKQPI +PS V + + GQD  VKGP G+L +T    + + K E G L+V +  + RR
Sbjct  2    SRIGKQPIAIPSGVEVTINGQDIAVKGPKGQLSLTVSEPITITKGEDGQLQVARPDDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_002787868.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCI17958.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9807]
Length=186

 Score = 80.9 bits (198),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA+V+G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRALVQGSKLVLNVGYSKPVEMEMPDG  120

Query  593  LQV  601
            + V
Sbjct  121  VSV  123


 Score = 49.3 bits (116),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVTINKDGETILVTRQ  55



>ref|WP_007031044.1| 50S ribosomal protein L6 [Amycolatopsis decaplanina]
 gb|EME60510.1| 50S ribosomal protein L6 [Amycolatopsis decaplanina DSM 44594]
Length=179

 Score = 74.7 bits (182),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 55.5 bits (132),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + +EGQ  KVKGP G L  T    + +E+ E G L+V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIEGQQIKVKGPKGTLEHTIAEPITVERAEDGTLQVKRPDEERT  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_010314956.1| 50S ribosomal protein L6 [Synechococcus sp. CB0205]
Length=179

 Score = 75.1 bits (183),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  425  HGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            HGL RTL  NM+ GVS+GF +KL++VGVGYRA V+GK +V++ G+SH V M  P+G+
Sbjct  65   HGLCRTLVANMVEGVSQGFTRKLEIVGVGYRAAVQGKKLVVSAGYSHQVEMIAPEGV  121


 Score = 54.7 bits (130),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEES  372
            SRIGK PIPVP  VT+ + G D KVKGP GEL  T P  V + ++ S
Sbjct  2    SRIGKSPIPVPGGVTVSLNGLDVKVKGPKGELSRTLPEGVAIAQDGS  48



>ref|WP_011434166.1| 50S ribosomal protein L6 [Synechococcus sp. JA-2-3B'a(2-13)]
 sp|Q2JIL3.1|RL6_SYNJB RecName: Full=50S ribosomal protein L6 [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03541.1| ribosomal protein L6 [Synechococcus sp. JA-2-3B'a(2-13)]
Length=181

 Score = 88.2 bits (217),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  374  ECLGSERLWRRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNL  553
            + L   RL     A ++HGL RTL  NM+ GVSKGF+++L+LVGVGYRA ++G  +VLN+
Sbjct  48   QMLTVSRLNDSRPARQLHGLCRTLVANMVDGVSKGFERRLELVGVGYRAAIQGSKLVLNV  107

Query  554  GFSHPVRMAIPDGLQV  601
            G+SHPV +  P G+Q+
Sbjct  108  GYSHPVEIPFPPGIQI  123


 Score = 42.0 bits (97),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEK  363
            SRIG++PI +P+ V I+++GQ   VKGP G+L  + P  + +++
Sbjct  2    SRIGRRPIALPAKVEIQIDGQHIAVKGPKGQLSRSLPPLITVQQ  45



>ref|WP_012306676.1| 50S ribosomal protein L6 [Synechococcus sp. PCC 7002]
 sp|B1XJJ3.1|RL6_SYNP2 RecName: Full=50S ribosomal protein L6 [Synechococcus sp. PCC 
7002]
 gb|ACA99053.1| 50S ribosomal protein L6 [Synechococcus sp. PCC 7002]
Length=180

 Score = 80.9 bits (198),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NMI GVS+G+ K+L+++GVGYRA V+G  + LN+G+S PV M +P+G
Sbjct  61   ARERHGLCRTLVANMIEGVSQGYSKQLEIIGVGYRAQVQGNKLTLNVGYSKPVEMQMPEG  120

Query  593  L  595
            +
Sbjct  121  V  121


 Score = 48.9 bits (115),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGK+PIP+P  VT+ + G +  VKGP G L  T P +V + +E++ ++
Sbjct  2    SRIGKKPIPIPDKVTVTLNGANVAVKGPKGSLERTLPEKVTVTQEDNTIV  51



>ref|WP_035991895.1| 50S ribosomal protein L6 [Leptolyngbya sp. KIOST-1]
Length=179

 Score = 73.6 bits (179),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 49/69 (71%), Gaps = 3/69 (4%)
 Frame = +2

Query  401  RRDG---ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPV  571
            RRD    A E HGL RTL  NM+ GV+ G+ K+L++ G+GYRA V+G+++ L+LG+SHPV
Sbjct  54   RRDDSRLARERHGLCRTLVANMVEGVANGYQKRLEIQGIGYRAQVQGRNLNLSLGYSHPV  113

Query  572  RMAIPDGLQ  598
                P G++
Sbjct  114  VFEPPAGIE  122


 Score = 56.2 bits (134),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGK+PIPVP+ V+I ++GQD +VKGP GEL  T P  V + +E   VL
Sbjct  2    SRIGKRPIPVPAKVSITIDGQDVQVKGPKGELSRTLPSGVVVVQEGDTVL  51



>ref|WP_006515901.1| 50S ribosomal protein L6 [Leptolyngbya sp. PCC 7375]
 gb|EKV01506.1| LSU ribosomal protein L6P [Leptolyngbya sp. PCC 7375]
Length=178

 Score = 78.2 bits (191),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A   HGL RTL  NM+ GVSKGF+K+L++ GVGYRA V+GK + +NLG+SHPV    P G
Sbjct  61   ARACHGLSRTLIANMVEGVSKGFEKRLEIKGVGYRAAVKGKTLNMNLGYSHPVEFEPPKG  120

Query  593  L  595
            +
Sbjct  121  I  121


 Score = 51.6 bits (122),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+P+PVPS VT+ +  Q   VKGP GEL    P EV + +E   V+  R+
Sbjct  2    SRIGKKPVPVPSGVTVSINAQSVVVKGPKGELSRILPGEVNITQEGEQVIVTRQ  55



>ref|WP_039795552.1| 50S ribosomal protein L6 [Nocardia araoensis]
Length=179

 Score = 72.8 bits (177),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  NMIVGV++G++KK+++ GVGYR  ++G+++   LG+SHPV +  P+G
Sbjct  62   SRALHGLTRTLVSNMIVGVTQGYEKKMEIFGVGYRVALKGQNLEFALGYSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 57.0 bits (136),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI +P+ V I ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKKPIAIPAGVDITIDGQDIAVKGPKGTLSLTVAEPITVAKGEDGQLEVARPDDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_028479346.1| 50S ribosomal protein L6 [Nocardia sp. CNY236]
Length=179

 Score = 72.8 bits (177),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  NMIVGV++G++KK+++ GVGYR  ++G+++   LG+SHPV +  P+G
Sbjct  62   SRALHGLTRTLVSNMIVGVTQGYEKKMEIFGVGYRVALKGQNLEFALGYSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 56.6 bits (135),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI +P+ V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKKPIAIPTGVDVSIDGQDVSVKGPKGTLSLTVSEPITVAKSEDGQLEVTRPDDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_037332683.1| 50S ribosomal protein L6 [Amycolatopsis sp. MJM2582]
 gb|KFZ82847.1| 50S ribosomal protein L6 [Amycolatopsis sp. MJM2582]
Length=179

 Score = 74.3 bits (181),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 55.1 bits (131),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQ  KVKGP G L  T    + +EK E G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQQIKVKGPKGTLEHTIAEPITVEKAEDGTLEVKRPDEERT  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_023358196.1| 50S ribosomal protein L6 [Actinoplanes friuliensis]
 gb|AGZ39205.1| 50S ribosomal protein L6 [Actinoplanes friuliensis DSM 7358]
Length=180

 Score = 74.7 bits (182),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYKKTLEINGTGYRVTAKGKDLEFALGFSHPVNVVPPAG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 54.7 bits (130),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + + GQ  KVKGP GEL  T    + +EK E+G L V +  + RR
Sbjct  2    SRIGRKSIPVPAGVDVTITGQTVKVKGPKGELSHTVAEPITVEKAENGELAVNRPNDERR  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_015109414.1| 50S ribosomal protein L6 [Cyanobium gracile]
 gb|AFY28964.1| ribosomal protein L6, bacterial type [Cyanobium gracile PCC 6307]
Length=179

 Score = 80.1 bits (196),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + E HGL RTL  NM+ GVS+GF +KL++VGVGYRA V+G+ +V++ G+SHPV M  P+G
Sbjct  61   SRERHGLSRTLVANMVEGVSQGFTRKLEIVGVGYRAQVQGRKLVVSAGYSHPVEMVPPEG  120

Query  593  L  595
            +
Sbjct  121  V  121


 Score = 49.3 bits (116),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 34/61 (56%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PIP+P  VTI ++G    VKGP GEL    P  V +  +E G + V      RR
Sbjct  2    SRIGKAPIPIPDKVTISLDGLAVTVKGPKGELSRVLPEGVSVS-QEGGTVVVSPTSSHRR  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_036533248.1| 50S ribosomal protein L6 [Nocardia cyriacigeorgica]
Length=179

 Score = 71.6 bits (174),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL  NMI GV+KG++KKL++ GVGYR  ++G+++   LGFSHPV    P G+
Sbjct  65   LHGLTRTLVANMIEGVTKGYEKKLEIAGVGYRVALKGQNLEFALGFSHPVVAEPPQGI  122


 Score = 58.2 bits (139),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGKQPI +PS V + + GQD  VKGP G+L +T    + + K + G L+V +  + RR
Sbjct  2    SRIGKQPIAIPSGVEVTINGQDVAVKGPKGQLSLTVSEPITVTKGDDGQLQVARPDDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_011936544.1| 50S ribosomal protein L6 [Synechococcus sp. RCC307]
 sp|A5GVX4.1|RL6_SYNR3 RecName: Full=50S ribosomal protein L6 [Synechococcus sp. RCC307]
 emb|CAK29033.1| 50S ribosomal protein L6 [Synechococcus sp. RCC307]
Length=179

 Score = 83.6 bits (205),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + E HGL RTL  NM+ GVSKGF KKL+++GVGYRA V+GK +V++ G+SHPV M  P+G
Sbjct  61   SRERHGLCRTLVANMVEGVSKGFSKKLEIIGVGYRAQVKGKKLVVSAGYSHPVEMDAPEG  120

Query  593  L  595
            +
Sbjct  121  V  121


 Score = 45.8 bits (107),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+P+P  V++++ G   KVKGP GEL    P  V + + ++ V  V  +  +RR
Sbjct  2    SRIGKNPVPIPEKVSVEISGLTVKVKGPKGELERVLPDGVSVSQADNAVT-VSPSDTSRR  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_033081910.1| 50S ribosomal protein L6 [Colwellia psychrerythraea]
 gb|KGJ95033.1| Ribosomal protein L6, subgroup [Colwellia psychrerythraea]
Length=177

 Score = 75.5 bits (184),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  410  GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD  589
            GA    G  R L +NM+ GVSKGF+KKL L GVGYRA   GK + L+LGFSHP++ AIP+
Sbjct  60   GAWAQAGTTRALINNMVEGVSKGFEKKLVLQGVGYRAKAAGKSLDLSLGFSHPIKHAIPE  119

Query  590  GL  595
            G+
Sbjct  120  GI  121


 Score = 53.5 bits (127),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SR+ K P+ VP+ VTI + GQD KVKGP+GEL  T   +V + +EE+ ++
Sbjct  2    SRVAKAPVVVPAGVTITLSGQDIKVKGPVGELSRTIHSDVVVSQEENNII  51



>ref|WP_015136283.1| 50S ribosomal protein L6 [Leptolyngbya sp. PCC 7376]
 gb|AFY40572.1| LSU ribosomal protein L6P [Leptolyngbya sp. PCC 7376]
Length=179

 Score = 79.3 bits (194),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  410  GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD  589
             A E HGL RTL  NM+ GVS G+ K L+++GVGYRA V+G  ++LN+G+S PV M +P+
Sbjct  60   AARERHGLCRTLVANMVEGVSNGYSKSLEIIGVGYRAQVKGNTLILNVGYSKPVEMVMPE  119

Query  590  GL  595
            G+
Sbjct  120  GI  121


 Score = 49.7 bits (117),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGKQP+P+P  VT+ + G    VKGP G L  T P +V + +E++ V+
Sbjct  2    SRIGKQPVPIPDKVTVAVNGLSVSVKGPKGSLERTLPEKVTIAQEDNTVV  51



>ref|WP_012196215.1| 50S ribosomal protein L6 [Prochlorococcus marinus]
 sp|A9BCN3.1|RL6_PROM4 RecName: Full=50S ribosomal protein L6 [Prochlorococcus marinus 
str. MIT 9211]
 gb|ABX09595.1| 50S ribosomal protein L6 [Prochlorococcus marinus str. MIT 9211]
Length=179

 Score = 78.2 bits (191),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + E HGL R+L  NM+ GVSKG+ KKL++VGVG RA V+GK+++++ G+SHPV +  PDG
Sbjct  61   SRERHGLSRSLVANMVEGVSKGYSKKLEIVGVGSRAQVKGKNLIVSAGYSHPVEVIPPDG  120

Query  593  L  595
            +
Sbjct  121  I  121


 Score = 51.2 bits (121),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 40/64 (63%), Gaps = 2/64 (3%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGKQPIPVP  V ++++G    VKGP GEL  T P  V + + ++ +  V  A+ ++R
Sbjct  2    SRIGKQPIPVPEKVAVELDGLSLTVKGPKGELSRTLPEGVSISQVDNSI--VVSAINSKR  59

Query  412  S*RD  423
              R+
Sbjct  60   KSRE  63



>ref|WP_012111673.1| 50S ribosomal protein L6 [Parvibaculum lavamentivorans]
 sp|A7HWS6.1|RL6_PARL1 RecName: Full=50S ribosomal protein L6 [Parvibaculum lavamentivorans 
DS-1]
 gb|ABS64359.1| ribosomal protein L6 [Parvibaculum lavamentivorans DS-1]
Length=177

 Score = 71.6 bits (174),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A  M GL RTL  N++ GV+ GF K L++ GVGYRA ++GK++ LNLGFSH V   IP+G
Sbjct  61   ARAMWGLSRTLVKNIVTGVTDGFTKTLEINGVGYRAAIQGKNLQLNLGFSHDVLYPIPEG  120

Query  593  LQV  601
            + +
Sbjct  121  IDI  123


 Score = 57.4 bits (137),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VP  VT+ + GQD  VKGP GEL +T   +V +E+ ESG L+V    +T+R
Sbjct  2    SRIGKYPVEVPKGVTVTLNGQDLAVKGPKGELKLTLVDDVTVEQGESG-LKVAPREDTQR  60

Query  412  S*RDAW  429
            + R  W
Sbjct  61   A-RAMW  65



>ref|WP_015218384.1| 50S ribosomal protein L6 [Cyanobacterium aponinum]
 gb|AFZ52653.1| LSU ribosomal protein L6P [Cyanobacterium aponinum PCC 10605]
Length=179

 Score = 84.3 bits (207),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL DNMI GVS+GF+KKL++ GVGYRA  +G  + LN+G+S PV M +P G
Sbjct  61   ARERHGLCRTLVDNMIQGVSQGFEKKLEIQGVGYRAQAQGSKLTLNVGYSKPVEMEMPQG  120

Query  593  LQV  601
            + V
Sbjct  121  ISV  123


 Score = 45.1 bits (105),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVR  390
            SRIGK+PI +P+ V + ++GQ  +VKGP G+L  T P  V L +E   +  VR
Sbjct  2    SRIGKRPITIPAKVEVTIDGQLVQVKGPKGDLSRTLPALVTLTQEGQEIKVVR  54



>ref|WP_006634987.1| 50S ribosomal protein L6 [Microcoleus vaginatus]
 gb|EGK84832.1| ribosomal protein L6 [Microcoleus vaginatus FGP-2]
Length=182

 Score = 80.9 bits (198),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  395  LWRRDG---ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A ++HGL RTL  NM+ GVS+GF ++L+++G GYRA V+G++++LN+G+S 
Sbjct  52   VTRRDESRVARQLHGLCRTLVANMVEGVSQGFQRRLEIIGTGYRAQVQGRNLILNVGYSK  111

Query  566  PVRMAIPDGL  595
            PV M  P+G+
Sbjct  112  PVEMPPPEGI  121


 Score = 48.1 bits (113),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PI +P+ VTI ++GQ   VKGP GEL    P E+ +  E   +L  R+
Sbjct  2    SRIGKRPISIPNKVTITLDGQKVAVKGPKGELSRVIPAEIVMGLEGETLLVTRR  55



>ref|WP_015178716.1| 50S ribosomal protein L6 [Oscillatoria nigro-viridis]
 gb|AFZ09496.1| ribosomal protein L6 [Oscillatoria nigro-viridis PCC 7112]
Length=182

 Score = 80.9 bits (198),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 53/70 (76%), Gaps = 3/70 (4%)
 Frame = +2

Query  395  LWRRDG---ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A ++HGL RTL  NM+ GVS+GF ++L+++G GYRA V+G++++LN+G+S 
Sbjct  52   VTRRDESRVARQLHGLCRTLVANMVEGVSQGFQRRLEIIGTGYRAQVQGRNLILNVGYSK  111

Query  566  PVRMAIPDGL  595
            PV M  P+G+
Sbjct  112  PVEMPPPEGI  121


 Score = 48.1 bits (113),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PI +P+ VTI ++GQ   VKGP GEL    P E+ +  E   +L  R+
Sbjct  2    SRIGKRPISIPNKVTITLDGQKVAVKGPKGELSRVIPAEIVMGIEGETLLVTRR  55



>ref|WP_030478310.1| 50S ribosomal protein L6 [Lentzea albidocapillata]
Length=179

 Score = 70.5 bits (171),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +2

Query  401  RRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMA  580
            RR+ A  +HGL RTL  NM+VGV++G++KK+++ GVGYR  ++G ++   LG+SHPV++ 
Sbjct  60   RRNRA--LHGLSRTLVHNMVVGVTQGYEKKMEIHGVGYRVALKGSELEFALGYSHPVKVE  117

Query  581  IPDGL  595
             P G+
Sbjct  118  APAGI  122


 Score = 58.5 bits (140),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGKQPI VPS V + + GQD  +KGP G L +T    + +EK E G L V++  + RR
Sbjct  2    SRIGKQPIIVPSGVDVNIAGQDVSIKGPKGLLTLTLAEPIIVEKAEDGTLEVKRPNDERR  61

Query  412  S  414
            +
Sbjct  62   N  62



>ref|WP_042104150.1| 50S ribosomal protein L6 [Parachlamydiaceae bacterium HS-T3]
Length=180

 Score = 86.3 bits (212),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 54/68 (79%), Gaps = 3/68 (4%)
 Frame = +2

Query  407  DGANEM---HGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRM  577
            +G  EM   HGLFR L +NM+VGV KGF++KL+++GVGYRA V+G+ + L +GFSHP ++
Sbjct  56   EGKEEMGNFHGLFRALINNMVVGVDKGFERKLEMIGVGYRAAVQGQLLDLQIGFSHPTKL  115

Query  578  AIPDGLQV  601
             IP+G+QV
Sbjct  116  PIPEGIQV  123


 Score = 43.1 bits (100),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGEL  327
            SR GKQPIPVP NV +K+ G +  VKGP G L
Sbjct  2    SRKGKQPIPVPKNVEVKVSGTNVSVKGPKGSL  33



>ref|WP_010244377.1| 50S ribosomal protein L6 [Peptoniphilus rhinitidis]
Length=178

 Score = 75.9 bits (185),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            +HGL RTL  NMI+GV++G+ K L+++G GYRA  +GK + LNLGFSHP+ +  P+G++V
Sbjct  64   LHGLTRTLIYNMIIGVTEGYSKSLEIIGTGYRAAKKGKVLSLNLGFSHPLELEDPEGIEV  123


 Score = 53.1 bits (126),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI +P  V IK++GQ   VKGP GEL  ++ +++K+E  + GVL V +  E +R
Sbjct  2    SRIGKKPIEIPKGVDIKVDGQTVTVKGPKGELTQSFDKDLKIELND-GVLTVERPNEIKR  60



>ref|WP_015164363.1| 50S ribosomal protein L6 [Pseudanabaena sp. PCC 7367]
 gb|AFY69390.1| LSU ribosomal protein L6P [Pseudanabaena sp. PCC 7367]
Length=179

 Score = 81.3 bits (199),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 54/70 (77%), Gaps = 2/70 (3%)
 Frame = +2

Query  398  WRRDG--ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPV  571
             RR+     + HGL RTL  NM+ GV+ GF+++LQ+ GVGYRA ++GK+++LN+G+S+PV
Sbjct  54   QRRESRICRQQHGLSRTLIANMVEGVTNGFERRLQIQGVGYRAQLQGKNLILNVGYSNPV  113

Query  572  RMAIPDGLQV  601
            ++  PDG+Q+
Sbjct  114  QVEPPDGIQI  123


 Score = 47.8 bits (112),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK PIP+P  V I + GQ   VKGP GEL  T    V +E+E   +L V++  E+R
Sbjct  2    SRIGKLPIPIPKKVQITIAGQQVTVKGPKGELQRTLTDYVDIEQEGEEIL-VKQRRESR  59



>ref|WP_015141077.1| 50S ribosomal protein L6 [Nostoc sp. PCC 7524]
 gb|AFY50667.1| ribosomal protein L6, bacterial type [Nostoc sp. PCC 7524]
Length=182

 Score = 85.5 bits (210),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + +MHGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G+++VLN+G+SH V++A PDG
Sbjct  61   SRQMHGLSRTLVANMVEGVSQGFQKRLEIQGVGYRAQVQGRNLVLNMGYSHQVQIAPPDG  120

Query  593  LQ  598
            +Q
Sbjct  121  IQ  122


 Score = 43.5 bits (101),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PI VP+ V + ++G    VKGP GEL    P  V + ++   +L  RK
Sbjct  2    SRIGKRPITVPAKVQVTVDGSKVIVKGPKGELSRDLPTHVTVAQDGQTLLVTRK  55



>ref|WP_020633320.1| 50S ribosomal protein L6 [Amycolatopsis alba]
Length=179

 Score = 74.7 bits (182),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G+
Sbjct  65   LHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEGI  122


 Score = 54.3 bits (129),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQ  KVKGP G L  T    + +EK E+G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQQIKVKGPKGTLEHTIAEPIIVEKAENGTLEVKRPDEERT  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_040864897.1| 50S ribosomal protein L6 [Nocardia exalbida]
Length=179

 Score = 72.0 bits (175),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  NM+VGV++G++KK+++ GVGYR  ++G+++   LG+SHPV +  P+G
Sbjct  62   SRALHGLTRTLVSNMVVGVTQGYEKKMEIFGVGYRVALKGQNLEFALGYSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 56.6 bits (135),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI +PS V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKKPIALPSGVDVTIDGQDISVKGPKGTLSLTVAEPITVAKGEDGQLEVARPDDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_039688659.1| 50S ribosomal protein L6 [Coriobacteriaceae bacterium 68-1-3]
 gb|AJC11806.1| 50S ribosomal protein L6 [Coriobacteriaceae bacterium 68-1-3]
Length=180

 Score = 82.4 bits (202),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A   HGL RTL  NM+ G +KGF KKLQLVGVGYRA ++GKD+ L LGFSHPV +  P+G
Sbjct  61   AKSYHGLVRTLVANMVEGSAKGFSKKLQLVGVGYRAALKGKDLDLQLGFSHPVVVPCPEG  120

Query  593  L  595
            +
Sbjct  121  I  121


 Score = 46.2 bits (108),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGKQPI VP+ VT+ ++G     KGP GEL   +P  + + K+E  V+ V +  ++R 
Sbjct  2    SRIGKQPITVPAGVTVTIDGTKVTTKGPKGELTREFP-SMMIIKQEGDVITVERPDDSRE  60

Query  412  S  414
            +
Sbjct  61   A  61



>ref|WP_043694887.1| 50S ribosomal protein L6 [Synechococcus sp. KORDI-49]
 gb|AII44832.1| 50S ribosomal protein L6 [Synechococcus sp. KORDI-49]
Length=179

 Score = 77.4 bits (189),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + E HGL RTL  NM+ GVS G+ K L++VGVG RA V+GK +V++ G+SHPV M  PDG
Sbjct  61   SRERHGLCRTLVANMVEGVSNGYSKSLEIVGVGSRAQVKGKTLVVSAGYSHPVEMEPPDG  120

Query  593  L  595
            +
Sbjct  121  I  121


 Score = 51.2 bits (121),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGK P+P+P  VT+ ++G   KVKGP GEL  T P  V + +EE+ ++
Sbjct  2    SRIGKNPVPLPDKVTVSLDGLTVKVKGPKGELERTLPEGVSVSQEENTIV  51



>ref|WP_006512304.1| 50S ribosomal protein L6 [Xenococcus sp. PCC 7305]
 gb|ELS00551.1| ribosomal protein L6, bacterial type [Xenococcus sp. PCC 7305]
Length=178

 Score = 82.8 bits (203),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A ++HGL RTL  NMI GV KGF+K+LQ++GVGYRA  +G  + LN+G+S PV M +P G
Sbjct  61   ARQLHGLSRTLVANMIEGVFKGFEKRLQIIGVGYRAQAQGSKLTLNVGYSKPVEMEMPAG  120

Query  593  LQV  601
            +QV
Sbjct  121  IQV  123


 Score = 45.8 bits (107),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGEL  327
            SRIGK+PIP+PS +T+ +EG    VKGP G L
Sbjct  2    SRIGKRPIPIPSGITVNIEGSHVSVKGPKGSL  33



>ref|WP_043687380.1| 50S ribosomal protein L6 [Nocardia abscessus]
Length=179

 Score = 72.8 bits (177),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  NMIVGV++G++KK+++ GVGYR  ++G+++   LG+SHPV +  P+G
Sbjct  62   SRALHGLTRTLVSNMIVGVTQGYEKKMEIFGVGYRVALKGQNLEFALGYSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 55.8 bits (133),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI +P+ V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKKPIAIPAGVDVAIDGQDVSVKGPKGALSLTIAEPITVAKGEDGQLEVVRPDDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_012799441.1| 50S ribosomal protein L6 [Slackia heliotrinireducens]
 gb|ACV23341.1| LSU ribosomal protein L6P [Slackia heliotrinireducens DSM 20476]
Length=181

 Score = 73.2 bits (178),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  425  HGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            HGL R+L +NM+ GVSKGF K+L+LVGVGYRA ++G  + + LG+SHPV +  P+G+
Sbjct  65   HGLVRSLINNMVEGVSKGFSKRLELVGVGYRAALKGGKLEMQLGYSHPVIVEAPEGI  121


 Score = 55.1 bits (131),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVR  390
            SRIGK+PIPVP+ V + +EG    VKGPLGEL  TYP  + + +E   ++  R
Sbjct  2    SRIGKKPIPVPAGVDVAIEGNTITVKGPLGELTYTYPVVITVAQEGDEIIVTR  54



>ref|WP_002780093.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCI11964.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9806]
Length=189

 Score = 78.6 bits (192),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  593  LQV  601
            + V
Sbjct  121  VSV  123


 Score = 49.7 bits (117),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V ++K+   +L  R+
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAIDKDGETLLVTRQ  55



>ref|WP_020178178.1| 50S ribosomal protein L6 [Methylopila sp. M107]
Length=177

 Score = 79.0 bits (193),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A  M G+ RT+  N++ GV+KGF+KKL++ GVGYRA V+GK++VL LG+SH V   IPDG
Sbjct  61   ARAMWGMSRTMVSNLVEGVTKGFEKKLEITGVGYRASVQGKNLVLALGYSHDVVYPIPDG  120

Query  593  LQV  601
            +Q+
Sbjct  121  IQI  123


 Score = 49.3 bits (116),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+P+ VPS VT  ++GQ+ KVKGP GEL      +V +E ++ G + V+   ET++
Sbjct  2    SRIGKKPVDVPSGVTAAVDGQNVKVKGPKGELAFRVHDDVVVEFKD-GKVSVQPRSETKQ  60

Query  412  S*RDAW  429
            + R  W
Sbjct  61   A-RAMW  65



>ref|WP_010595601.1| 50S ribosomal protein L6 [Rhodococcus sp. P14]
Length=179

 Score = 71.2 bits (173),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  N+IVGV++G+  K+++ GVGYR  ++GKD+  +LG+SHPV +  P+G
Sbjct  62   SRALHGLSRTLVQNLIVGVTEGYTTKMEIHGVGYRVALKGKDLEFSLGYSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 57.0 bits (136),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKLPVTVPSGVEVTIDGQDVAVKGPKGNLSLTIAEPITIAKGEDGALNVSRPNDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_018720668.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 77.0 bits (188),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 51.2 bits (121),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_002794624.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCI26440.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9808]
 emb|CCI35627.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9701]
 dbj|GAL92996.1| LSU ribosomal protein L6p (L9e) [Microcystis aeruginosa NIES-44]
Length=189

 Score = 78.6 bits (192),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  593  LQV  601
            + V
Sbjct  121  VSV  123


 Score = 49.7 bits (117),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V ++K+   +L  R+
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAIDKDGETLLVTRQ  55



>ref|WP_028322671.1| 50S ribosomal protein L6 [Desulfatiglans anilini]
Length=178

 Score = 82.8 bits (203),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A  +HGL+R L DNM+ GV+KGF++ L++VGVGYRA + G+  VLNLG+SHP++  +PDG
Sbjct  61   ARSVHGLYRVLIDNMVTGVTKGFERTLEIVGVGYRAELNGRVAVLNLGYSHPIQFELPDG  120

Query  593  L  595
            +
Sbjct  121  I  121


 Score = 45.1 bits (105),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PIP P  V++ ++G + KV+GP GEL      +VK+E  E+ + RV    ++R 
Sbjct  2    SRIGKRPIPNPEKVSVSIDGDEIKVRGPKGELTRPLHPKVKVEVGENDI-RVNAVDDSRE  60

Query  412  S  414
            +
Sbjct  61   A  61



>ref|WP_002746609.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CAO89799.1| rplF [Microcystis aeruginosa PCC 7806]
 gb|ELS46360.1| ribosomal protein L6 [Microcystis aeruginosa DIANCHI905]
Length=186

 Score = 79.0 bits (193),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  593  LQV  601
            + V
Sbjct  121  VSV  123


 Score = 49.3 bits (116),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVTINKDGETILVTRQ  55



>ref|WP_037270096.1| 50S ribosomal protein L6 [Rhodococcus rhodnii]
Length=179

 Score = 71.2 bits (173),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL +N+++GV+ G++KKL++ GVGYR  ++G D+   LG+SHP+++  P G+
Sbjct  65   LHGLTRTLVNNLVIGVTAGYEKKLEIHGVGYRVQLKGSDLEFALGYSHPIKVEAPKGI  122


 Score = 56.6 bits (135),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PI VPS V +++EGQ   VKGP G L  T    +KLE+ E G L V++  + R+
Sbjct  2    SRIGKLPITVPSGVDVQIEGQTVNVKGPKGALTHTIAEPIKLERAEDGTLEVKRPNDERQ  61

Query  412  S  414
            +
Sbjct  62   N  62



>ref|WP_033436726.1| 50S ribosomal protein L6 [Saccharothrix sp. NRRL B-16314]
Length=179

 Score = 72.8 bits (177),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  NM+VGV++G++KK+++ GVGYR  ++G D+   LG+SHPV++  P G
Sbjct  62   SRSLHGLSRTLVQNMVVGVTQGYEKKMEIHGVGYRVALKGSDLEFALGYSHPVKVEAPAG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 55.5 bits (132),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PI VPS V + ++GQ   VKGP G L +     + +EK E G L V++  + RR
Sbjct  2    SRIGKLPITVPSGVDVNIDGQAVSVKGPKGTLSLNIAEPIIIEKAEDGTLEVKRPNDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_018729116.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 77.0 bits (188),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 50.8 bits (120),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIEQAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_015148984.1| 50S ribosomal protein L6 [Oscillatoria acuminata]
 gb|AFY82344.1| LSU ribosomal protein L6P [Oscillatoria acuminata PCC 6304]
Length=179

 Score = 81.3 bits (199),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = +2

Query  395  LWRRD---GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSH  565
            + RRD    A + HGL RTL  NM+ GVS+GF K+L++ GVGYRA V+G++++LN+G+S+
Sbjct  52   VKRRDESRAARQRHGLCRTLVANMVQGVSEGFQKRLEIQGVGYRAQVQGRNLILNVGYSN  111

Query  566  PVRMAIPDGLQV  601
            PV +  P+G+ V
Sbjct  112  PVEINPPEGISV  123


 Score = 46.6 bits (109),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK+PI +P+ V + ++GQ   VKGP GEL    P EV +  +E   + V++  E+R
Sbjct  2    SRIGKRPINIPAKVVVSIDGQKVSVKGPKGELSRELPAEV-IVAQEGETIEVKRRDESR  59



>ref|WP_027649217.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 77.0 bits (188),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 50.8 bits (120),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_002753903.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCH92486.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9432]
 emb|CCI07993.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
7941]
 gb|EPF19527.1| hypothetical protein MAESPC_03895 [Microcystis aeruginosa SPC777]
Length=189

 Score = 78.6 bits (192),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  593  LQV  601
            + V
Sbjct  121  VSV  123


 Score = 49.3 bits (116),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V ++K+   +L  R+
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVTIDKDGETLLVTRQ  55



>ref|WP_044565307.1| 50S ribosomal protein L6 [Anaerococcus sp. 9402080]
Length=179

 Score = 77.0 bits (188),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  425  HGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            HGLFR+L  NM+ GV++G+ K LQ+ G GYRA  +G ++V+NLGFSH V MA P+G++V
Sbjct  66   HGLFRSLIANMVTGVTEGYSKTLQIEGTGYRAAKQGNNLVMNLGFSHQVTMADPEGIEV  124


 Score = 50.8 bits (120),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SRIGKQPI +PS VT+ ++GQ+ +V+GP G+L   +P  +++ + ++ +L
Sbjct  2    SRIGKQPIDIPSGVTVDIDGQEIRVEGPKGKLAQKFPTTIEVVESDNQIL  51



>ref|WP_035279546.1| 50S ribosomal protein L6 [Actinokineospora sp. EG49]
 gb|EWC63567.1| LSU ribosomal protein L6p (L9e) [Actinokineospora sp. EG49]
Length=179

 Score = 74.3 bits (181),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL R+L +N++VGV+ GF+KKL++ GVGYR + +G D+   LGFSHPV++  P+G+
Sbjct  65   LHGLTRSLVNNVVVGVTAGFEKKLEIHGVGYRVLAKGSDLEFALGFSHPVKVVAPEGI  122


 Score = 53.5 bits (127),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG+ PIPVP+ V I ++GQ    KGP G L +T    + +E+ E G L V++  + R+
Sbjct  2    SRIGRLPIPVPTGVDITIDGQQLSAKGPKGTLTLTVSEPIVVERAEDGTLEVKRPNDERQ  61

Query  412  S  414
            +
Sbjct  62   N  62



>ref|WP_022871372.1| 50S ribosomal protein L6 [Yaniella halotolerans]
Length=177

 Score = 75.5 bits (184),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL +NMIVGV++G+ KKL+L G GYR + +G DI L LGFSH + +A P+G
Sbjct  61   SRSLHGLTRTLINNMIVGVTEGYSKKLELHGTGYRVVAKGNDIELQLGFSHSIDVAAPEG  120

Query  593  L  595
            +
Sbjct  121  I  121


 Score = 52.4 bits (124),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 2/61 (3%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELG--ITYPREVKLEKEESGVLRVRKAMET  405
            SRIGK PI VPS V + + G D  VKGP GELG  I  P E KLE+    V+R  +  E+
Sbjct  2    SRIGKLPITVPSGVEVAINGSDVSVKGPKGELGMSIDGPIEAKLEENIITVMRPDEERES  61

Query  406  R  408
            R
Sbjct  62   R  62



>ref|WP_029254913.1| 50S ribosomal protein L6 [Rhodococcus erythropolis]
Length=179

 Score = 71.6 bits (174),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  N+I GV++G+ KK+++ GVGYR  ++GKD+   LGFSHPV +  P+G
Sbjct  62   SRALHGLSRTLVANIITGVTQGYTKKMEIHGVGYRVALKGKDLEFALGFSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 56.2 bits (134),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VP+ V + + GQD  VKGP G L +T    + +EK E G L V +  + RR
Sbjct  2    SRIGKIPVTVPAGVDVTISGQDVTVKGPKGTLALTISEPIAIEKAEDGSLSVTRPDDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_030532876.1| MULTISPECIES: 50S ribosomal protein L6 [Prauserella]
 gb|KID32526.1| ribosomal protein L6, bacterial type [Prauserella sp. Am3]
Length=179

 Score = 72.0 bits (175),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL +N++VGVS+G++KK+++ GVGYR   +G D+   LG+SHPV +  P+G
Sbjct  62   SRALHGLTRTLVNNLVVGVSEGYEKKMEIHGVGYRVQAKGSDLEFALGYSHPVLIKAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 55.8 bits (133),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PI VPS V + ++GQ   VKGP G L  T P  + +E++E G L V++  + R 
Sbjct  2    SRIGKLPITVPSGVEVNIDGQHVSVKGPKGTLEHTVPEPITVERDEDGALLVKRPDDERE  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_018801042.1| 50S ribosomal protein L6 [Salinispora arenicola]
Length=180

 Score = 77.0 bits (188),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 50.8 bits (120),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + ++GQ  KVKGP G L  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIDGQTVKVKGPKGVLSHTLAEPITVERAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_002771057.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCI04359.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9443]
Length=189

 Score = 78.6 bits (192),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  593  LQV  601
            + V
Sbjct  121  VSV  123


 Score = 49.3 bits (116),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVTINKDGETILVTRQ  55



>ref|WP_037314677.1| 50S ribosomal protein L6 [Amycolatopsis orientalis]
Length=179

 Score = 74.3 bits (181),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 53.1 bits (126),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQ  +VKGP G L  T    + +E+ E G L+V++  E R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQHIQVKGPKGTLEHTIAEPITVERAEDGTLQVKRPDEERT  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_020643212.1| 50S ribosomal protein L6 [Amycolatopsis balhimycina]
Length=179

 Score = 72.8 bits (177),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL +N++VGV+ G++KK+++ GVGYR   +G D+   LG+SHPV++  P+G
Sbjct  62   SKALHGLTRTLVNNLVVGVTAGYEKKMEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 54.7 bits (130),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQ  KVKGP G L  T    + +E++ESG L V++  + R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQQIKVKGPKGTLEHTVAEPITVERDESGTLLVKRPDDERT  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_003940970.1| MULTISPECIES: 50S ribosomal protein L6 [Rhodococcus]
 sp|C0ZW41.1|RL6_RHOE4 RecName: Full=50S ribosomal protein L6 [Rhodococcus erythropolis 
PR4]
 dbj|BAH32576.1| 50S ribosomal protein L6 [Rhodococcus erythropolis PR4]
 gb|EEN89470.1| ribosomal protein L6 [Rhodococcus erythropolis SK121]
 gb|EME24279.1| 50S ribosomal protein L6 [Rhodococcus qingshengii BKS 20-40]
 gb|AGT91662.1| 50S ribosomal protein L6 [Rhodococcus erythropolis CCM2595]
 gb|EQM33786.1| 50S ribosomal protein L6 [Rhodococcus erythropolis DN1]
 gb|KDQ03198.1| 50S ribosomal protein L6 [Rhodococcus qingshengii]
 gb|KIM16860.1| 50S ribosomal protein L6 [Rhodococcus erythropolis]
Length=179

 Score = 71.6 bits (174),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  N+I GV++G+ KK+++ GVGYR  ++GKD+   LGFSHPV +  P+G
Sbjct  62   SRALHGLSRTLVANIITGVTEGYTKKMEIHGVGYRVALKGKDLEFALGFSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 56.2 bits (134),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VP+ V + + GQD  VKGP G L +T    + +EK E G L V +  + RR
Sbjct  2    SRIGKIPVTVPAGVDVTISGQDVTVKGPKGTLALTISEPIAIEKAEDGSLSVTRPDDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_013127985.1| 50S ribosomal protein L6 [Tsukamurella paurometabola]
 gb|ADG79986.1| ribosomal protein L6 [Tsukamurella paurometabola DSM 20162]
Length=179

 Score = 74.3 bits (181),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 49/65 (75%), Gaps = 2/65 (3%)
 Frame = +2

Query  401  RRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMA  580
            RR+ A  +HGL RTL  NM+ GV++G+ KKL++ GVGYR  ++GKD+  +LG+SHPV + 
Sbjct  60   RRNKA--LHGLSRTLVANMVTGVTEGYTKKLEIYGVGYRVALKGKDLEFSLGYSHPVPIE  117

Query  581  IPDGL  595
             P+G+
Sbjct  118  APEGI  122


 Score = 53.1 bits (126),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VP+ V +++ GQD  VKGP G+L +T    + + K + G + V +  + RR
Sbjct  2    SRIGKHPVVVPTGVDVQIAGQDVTVKGPKGQLALTVSEPISVSKNDEGAIVVARPDDERR  61

Query  412  S  414
            +
Sbjct  62   N  62



>ref|WP_043965528.1| 50S ribosomal protein L6 [Micromonospora carbonacea]
 gb|KIR62988.1| 50S ribosomal protein L6 [Micromonospora carbonacea]
Length=180

 Score = 75.5 bits (184),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G  K L++ G GYR   +GKD+   LGFSHPV +  PDG
Sbjct  62   AKELHGLSRTLIANMIVGVTEGHRKSLEIAGTGYRVTAKGKDLEFALGFSHPVLVPAPDG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 52.0 bits (123),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V I ++GQ  KVKGP GEL       +  E+ E G L+V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGQAVKVKGPKGELTHVLAEPITAERAEDGQLQVNRPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_011041466.1| 50S ribosomal protein L6 [Colwellia psychrerythraea]
 sp|Q488Z8.1|RL6_COLP3 RecName: Full=50S ribosomal protein L6 [Colwellia psychrerythraea 
34H]
 gb|AAZ28521.1| ribosomal protein L6 [Colwellia psychrerythraea 34H]
Length=177

 Score = 75.9 bits (185),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  410  GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD  589
            GA    G  R L +NM+ GVSKGF+KKL L GVGYRA   GK + L+LGFSHP++ AIP+
Sbjct  60   GAWAQAGTTRALINNMVEGVSKGFEKKLVLQGVGYRAKAAGKSLDLSLGFSHPIKHAIPE  119

Query  590  GL  595
            G+
Sbjct  120  GI  121


 Score = 52.0 bits (123),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVL  381
            SR+ K P+ VP+ VTI + GQD  VKGP+GEL  T   +V + +EE+ ++
Sbjct  2    SRVAKAPVVVPAGVTITLSGQDITVKGPIGELSRTIHSDVVVSQEENNII  51



>ref|WP_040833621.1| 50S ribosomal protein L6 [Nocardia brevicatena]
Length=179

 Score = 73.2 bits (178),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  NMI GV++G++KK+++ GVGYR   +GKD+   LG+SHPV +  P+G
Sbjct  62   SRSLHGLTRTLIANMITGVTQGYEKKMEIFGVGYRVQQKGKDLEFALGYSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 54.7 bits (130),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + + GQD  VKGP G+L +T    + + + + G + V +  + RR
Sbjct  2    SRIGKHPVLVPSGVEVTLNGQDVAVKGPKGQLALTVAEPIAVSRNDDGAIVVSRPDDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_033428587.1| 50S ribosomal protein L6 [Saccharothrix syringae]
Length=179

 Score = 72.4 bits (176),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  NM++GV++G++KK+++ GVGYR  ++G D+   LG+SHPV++  P G
Sbjct  62   SRSLHGLSRTLVQNMVIGVTQGYEKKMEIHGVGYRVALKGSDLEFALGYSHPVKVEAPAG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 55.1 bits (131),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK PI VPS V + + G++  VKGP G L +T    + +EK E G L V++  + RR
Sbjct  2    SRIGKLPITVPSGVDVNIAGREVSVKGPKGTLSLTIAEPIIIEKAEDGTLEVKRPNDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_002796422.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 sp|B0JHY9.1|RL6_MICAN RecName: Full=50S ribosomal protein L6 [Microcystis aeruginosa 
NIES-843]
 dbj|BAG05551.1| 50S ribosomal protein L6 [Microcystis aeruginosa NIES-843]
 emb|CCI23388.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9809]
Length=189

 Score = 79.0 bits (193),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  593  LQV  601
            + V
Sbjct  121  VSV  123


 Score = 48.9 bits (115),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAINKDGETLLVTRQ  55



>ref|WP_018726241.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 76.6 bits (187),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVPPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 50.8 bits (120),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_039727917.1| MULTISPECIES: 50S ribosomal protein L6 [Oscillatoriophycideae]
 gb|KIF15689.1| 50S ribosomal protein L6 [Aphanocapsa montana BDHKU210001]
 gb|KIF40613.1| 50S ribosomal protein L6 [Lyngbya confervoides BDU141951]
Length=179

 Score = 73.9 bits (180),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + E HGL RTL  NMI GV+ G+ K+L++ GVGYRA V+G  + ++LG+SHPV    P+G
Sbjct  61   SRERHGLCRTLVANMIEGVTNGYQKRLEIQGVGYRAQVQGTKLNMSLGYSHPVIFEPPEG  120

Query  593  LQ  598
            +Q
Sbjct  121  IQ  122


 Score = 53.5 bits (127),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+ IPVP+ VT+ ++GQ   VKGP GEL    P  V + + +S V  V  A E+RR
Sbjct  2    SRIGKRAIPVPAKVTVTIDGQAVTVKGPKGELSRVLPEGVVISQADSAVT-VSPASESRR  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_026137931.1| 50S ribosomal protein L6, partial [Rhodococcus ruber]
Length=174

 Score = 70.5 bits (171),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  N+IVGV+ G+  K+++ GVGYR  ++GKD+  +LG+SHPV +  P+G
Sbjct  62   SRALHGLSRTLVQNLIVGVTDGYTTKMEIHGVGYRVALKGKDLEFSLGYSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 57.0 bits (136),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKLPVTVPSGVEVTIDGQDVAVKGPKGNLSLTIAEPITIAKGEDGALNVSRPNDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|XP_009763796.1| PREDICTED: 50S ribosomal protein L6, chloroplastic [Nicotiana 
sylvestris]
Length=106

 Score = 94.0 bits (232),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  455  MIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            M+VGVSKGF+KKLQLVGVGYRA +EGKDIVLNLGFSHPVRM IPDGLQV
Sbjct  1    MVVGVSKGFEKKLQLVGVGYRATIEGKDIVLNLGFSHPVRMEIPDGLQV  49



>ref|WP_006554596.1| MULTISPECIES: 50S ribosomal protein L6 [Rhodococcus]
 gb|EHK80605.1| 50S ribosomal protein L6 [Rhodococcus pyridinivorans AK37]
 gb|AHD20706.1| 50S ribosomal protein L6 [Rhodococcus pyridinivorans SB3094]
 gb|KHJ73287.1| 50S ribosomal protein L6 [Rhodococcus sp. Chr-9]
Length=179

 Score = 70.5 bits (171),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL  N+IVGV++G+  K+++ GVGYR  ++GKD+  +LG+SHPV +  P+G+
Sbjct  65   LHGLSRTLVQNLIVGVTEGYTTKMEIHGVGYRVALKGKDLEFSLGYSHPVLIEAPEGI  122


 Score = 57.0 bits (136),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V I ++GQD  VKGP G L +T    + + K E G + V +  + RR
Sbjct  2    SRIGKLPVAVPSGVEITIDGQDVAVKGPKGNLSLTIAEPIAVAKGEDGAINVTRPNDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_026086027.1| 50S ribosomal protein L6 [Fischerella muscicola]
Length=182

 Score = 86.7 bits (213),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 57/69 (83%), Gaps = 3/69 (4%)
 Frame = +2

Query  401  RRD---GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPV  571
            RRD    + ++HGLFRTL  NM+ GVSKGF+++L++ GVGYRA ++G+++VLN+G+SH V
Sbjct  54   RRDESRTSRQLHGLFRTLVANMVEGVSKGFERRLEIQGVGYRAQIQGRNLVLNMGYSHQV  113

Query  572  RMAIPDGLQ  598
            ++A P+G+Q
Sbjct  114  QIAPPEGVQ  122


 Score = 40.8 bits (94),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 34/61 (56%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI VP+ V +  +     VKGP GEL    P  V L ++   +L V +  E+R 
Sbjct  2    SRIGKRPITVPAKVQVTFDNAKVSVKGPKGELSRELPANVILSQDGE-ILTVNRRDESRT  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_033094748.1| 50S ribosomal protein L6 [Colwellia psychrerythraea]
 gb|KGJ88845.1| Ribosomal protein L6, subgroup [Colwellia psychrerythraea]
Length=177

 Score = 76.6 bits (187),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  428  GLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            G  R L +NM+ GVSKGF+KKL L GVGYRA   GK + L+LGFSHPV+ AIP+G+ V
Sbjct  66   GTARALINNMVEGVSKGFEKKLVLQGVGYRAKAAGKSLDLSLGFSHPVKHAIPEGITV  123


 Score = 50.8 bits (120),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (58%), Gaps = 5/66 (8%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SR+ K P+ VP+ VTI + GQD  VKGP+GEL  T    V + +EE+ ++      +   
Sbjct  2    SRVAKAPVVVPAGVTITLSGQDITVKGPVGELSRTIHSFVAVSQEENNIITTIACDD---  58

Query  412  S*RDAW  429
              R+AW
Sbjct  59   --RNAW  62



>ref|YP_003734607.1| ribosomal protein L6 [Kryptoperidinium foliaceum]
 gb|ADI40392.1| ribosomal protein L6 [Kryptoperidinium foliaceum]
Length=178

 Score = 86.3 bits (212),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            +HGL+RTL +NM+VGVS+ FD  L L GVGYRA+V+GK+I LNLG+SHPV+M IP+ + V
Sbjct  64   LHGLYRTLINNMVVGVSEQFDLTLILKGVGYRAVVQGKEITLNLGYSHPVKMEIPEDISV  123


 Score = 41.2 bits (95),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 1/59 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK PI +P NVT+  +     V+G  G L    P  + +E++E+  L+V    E R
Sbjct  2    SRIGKLPITIPDNVTVNCQNSQVTVQGKFGTLETNIPDTIGIEQDENS-LKVSLKSEAR  59



>ref|WP_019107908.1| 50S ribosomal protein L6 [Peptoniphilus senegalensis]
Length=178

 Score = 76.3 bits (186),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            +HGL RTL  NMI+GV++G+ K L+++G GYRA  +GK + LNLGFSHP+ +  P+G++V
Sbjct  64   LHGLTRTLIYNMIIGVTEGYSKSLEIIGTGYRAAKKGKTLSLNLGFSHPLDLEDPEGIEV  123


 Score = 51.2 bits (121),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI +P  V +K++GQ   VKGP GEL  ++ +++K+E  + GVL V +  E ++
Sbjct  2    SRIGKKPIEIPKGVDVKIDGQTVTVKGPKGELTQSFNKDLKIEIND-GVLTVERPNEIKK  60



>ref|WP_018217052.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 76.6 bits (187),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVPPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 50.8 bits (120),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTIAEPITIEQAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_025616601.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 76.6 bits (187),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMI+GV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIIGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  593  LQ  598
            + 
Sbjct  122  IS  123


 Score = 50.8 bits (120),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTIAEPITVERAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_027940987.1| 50S ribosomal protein L6 [Amycolatopsis taiwanensis]
Length=179

 Score = 72.8 bits (177),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  N++VGV+ G++KKL++ GVGYR   +GKD+   LG+SHPV +  P+G
Sbjct  62   SKALHGLTRTLVHNLVVGVTSGYEKKLEIHGVGYRVQAKGKDLEFALGYSHPVLIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 54.7 bits (130),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+PVPS V + ++GQ  +VKGP G L  T    +++E+ E G L V++  + R 
Sbjct  2    SRIGKLPVPVPSGVEVTIDGQHIQVKGPKGTLSHTVAEPIRVERGEDGELLVKRPDDERT  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_040272340.1| 50S ribosomal protein L6 [Rhodococcus ruber]
 emb|CDZ89187.1| 50S ribosomal subunit protein L6 [Rhodococcus ruber]
Length=179

 Score = 70.5 bits (171),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  N+IVGV+ G+  K+++ GVGYR  ++GKD+  +LG+SHPV +  P+G
Sbjct  62   SRALHGLSRTLVQNLIVGVTDGYTTKMEIHGVGYRVALKGKDLEFSLGYSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 57.0 bits (136),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQD  VKGP G L +T    + + K E G L V +  + RR
Sbjct  2    SRIGKLPVTVPSGVEVTIDGQDVAVKGPKGNLSLTIAEPITIAKGEDGALNVSRPNDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_002733352.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 gb|ELP56436.1| ribosomal protein L6 [Microcystis aeruginosa TAIHU98]
Length=189

 Score = 78.6 bits (192),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  593  LQV  601
            + V
Sbjct  121  VSV  123


 Score = 48.5 bits (114),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAINKDGETLLVTRQ  55



>ref|WP_041054717.1| 50S ribosomal protein L6 [Jeotgalibacillus campisalis]
 gb|KIL52285.1| 50S ribosomal protein L6 [Jeotgalibacillus campisalis]
Length=178

 Score = 76.3 bits (186),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGLQV  601
            +HG  R + +NM+ GVSKGF++ L+LVGVGYRA  +G  ++LN+G+SHPV M   DG++V
Sbjct  64   IHGTTRAILNNMVQGVSKGFERGLELVGVGYRAQKQGNKLILNVGYSHPVEMTPEDGIEV  123


 Score = 50.8 bits (120),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVR  390
            SR+GK+PI VPS+VT+   G     KGP GEL  T+  E+K E+E++ +  VR
Sbjct  2    SRVGKKPIEVPSDVTLTFNGSTVTAKGPKGELSFTFNSEMKFEQEDTTLTVVR  54



>ref|WP_002757583.1| 50S ribosomal protein L6 [Microcystis aeruginosa]
 emb|CCI00544.1| 50S ribosomal subunit protein L6 [Microcystis aeruginosa PCC 
9717]
Length=189

 Score = 78.6 bits (192),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GV+ GF K+L + GVGYRA  +G  +VLN+G+S PV M +PDG
Sbjct  61   ARERHGLCRTLVANMVEGVATGFQKRLDIQGVGYRAQAQGSKLVLNVGYSKPVEMEMPDG  120

Query  593  LQV  601
            + V
Sbjct  121  VSV  123


 Score = 48.5 bits (114),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRK  393
            SRIGK+PIP+P+ VT+ ++G    VKGP G L  T P  V + K+   +L  R+
Sbjct  2    SRIGKRPIPIPNKVTVDIDGATVTVKGPKGTLQRTLPTAVAINKDGETLLVTRQ  55



>ref|WP_020185777.1| 50S ribosomal protein L6 [Methylopila sp. 73B]
Length=177

 Score = 76.3 bits (186),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  410  GANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPD  589
            GA    G+ RT+  N++ GV+KGF+KKL++ GVGYRA V+GKD+VL LG+SH ++  IP 
Sbjct  60   GARSKWGMSRTMVSNLVEGVTKGFEKKLEISGVGYRAAVQGKDLVLALGYSHDIKYPIPA  119

Query  590  GLQV  601
            G+ +
Sbjct  120  GIDI  123


 Score = 51.2 bits (121),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 2/66 (3%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+P+ VPS VT  ++GQD KVKGP GEL      EV +E ++ G + V+   ET+ 
Sbjct  2    SRIGKKPVDVPSGVTAAVDGQDVKVKGPKGELAFRVHDEVVVEFKD-GKVTVQPRDETKG  60

Query  412  S*RDAW  429
            + R  W
Sbjct  61   A-RSKW  65



>ref|WP_026099472.1| 50S ribosomal protein L6 [Prochlorothrix hollandica]
Length=179

 Score = 82.0 bits (201),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E HGL RTL  NM+ GVS+G+ K+L + GVGYRA V+G+ +VL+LG+SHPV M  P G
Sbjct  61   ARERHGLCRTLVANMVEGVSQGYSKRLAITGVGYRAQVQGQKLVLSLGYSHPVEMDPPSG  120

Query  593  LQ  598
            +Q
Sbjct  121  IQ  122


 Score = 45.4 bits (106),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEES  372
            SRIGK+PIP+P  V + +EG+   VKGP GEL    P  + + + ++
Sbjct  2    SRIGKRPIPIPDKVAVTIEGRHVAVKGPKGELSRLLPWGIVIAQSDN  48



>ref|WP_027844107.1| 50S ribosomal protein L6 [Mastigocoleus testarum]
Length=182

 Score = 82.0 bits (201),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + +MHGL RTL  NM+ GVSKGF+++L++ GVGYRA V+G+++VLN+G+SH V++  P G
Sbjct  61   SRQMHGLSRTLVANMVQGVSKGFERRLEIQGVGYRAQVQGRNLVLNIGYSHQVQIEPPQG  120

Query  593  LQ  598
            +Q
Sbjct  121  VQ  122


 Score = 45.4 bits (106),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGKQPI VP+ V I ++G    VKGP GEL       V +E ++   L V++  ++R 
Sbjct  2    SRIGKQPITVPAKVQITLDGTKIAVKGPKGELSRELSSNVSVE-QDGDTLWVKRQDDSRL  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_015200868.1| 50S ribosomal protein L6 [Calothrix parietina]
 gb|AFZ04259.1| LSU ribosomal protein L6P [Calothrix sp. PCC 6303]
Length=182

 Score = 83.2 bits (204),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            + ++HGLFRTL  NM+ GVS GF ++L++ GVGYRA V+G+++VLN+G+SH V++  PDG
Sbjct  61   SRQLHGLFRTLISNMVEGVSTGFQRRLEIQGVGYRAAVQGRNLVLNMGYSHQVQIPPPDG  120

Query  593  LQ  598
            +Q
Sbjct  121  VQ  122


 Score = 43.9 bits (102),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI VP+ V + + G + +VKGP GEL    P  + L +E   +L V    ++R 
Sbjct  2    SRIGKRPITVPAKVQVTINGSNVQVKGPKGELSRDLPANIVLTQEGE-ILTVSPIDDSRS  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_014847225.1| 50S ribosomal protein L6 [Propionibacterium propionicum]
 gb|AFN45762.1| ribosomal protein L6 [Propionibacterium propionicum F0230a]
Length=180

 Score = 69.7 bits (169),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 6/70 (9%)
 Frame = +2

Query  389  ERLWRRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGK-DIVLNLGFSH  565
            ERL R      +HGL RTL  NM+ GV++G++KKL++VGVGYR + +G   +   LGFSH
Sbjct  59   ERLSR-----SLHGLTRTLVSNMVTGVTQGYEKKLEIVGVGYRVVAKGPTQLEFALGFSH  113

Query  566  PVRMAIPDGL  595
            PV +  P+G+
Sbjct  114  PVVVNAPEGI  123


 Score = 57.8 bits (138),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG+ PI VPSNV +K++GQD  VKGP GEL  T    + + K E G L+V +  + R 
Sbjct  2    SRIGRLPIAVPSNVEVKIDGQDVAVKGPKGELKFTVREPITIAKNEQGELQVSRPDDERL  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_019174650.1| 50S ribosomal protein L6 [Brevibacterium massiliense]
Length=178

 Score = 77.4 bits (189),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  389  ERLWRRDGANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHP  568
            ER      +  +HGL RT+ DNMI+GV++G++KKL++VG GYR   +G DI ++LG+SH 
Sbjct  53   ERPNEERESRALHGLSRTMVDNMIIGVTQGYEKKLEIVGTGYRVQAKGSDIEMSLGYSHS  112

Query  569  VRMAIPDGL  595
            + +A P G+
Sbjct  113  IPVAAPKGI  121


 Score = 50.1 bits (118),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK+PI VPS V +K++GQ   VKGP GEL  T    + +  E+ GV+ + +  E R 
Sbjct  2    SRIGKRPISVPSGVEVKIDGQTVNVKGPKGELSHTVAEPITVALED-GVITLERPNEERE  60

Query  412  S  414
            S
Sbjct  61   S  61



>ref|WP_008375943.1| 50S ribosomal protein L6 [Gordonia malaquae]
 dbj|GAC78122.1| 50S ribosomal protein L6 [Gordonia malaquae NBRC 108250]
Length=178

 Score = 70.9 bits (172),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL +N+++GV++G+  K+++ GVGYR   +GKD+   LG+SHPV +  P+G+
Sbjct  64   LHGLSRTLVNNLVIGVTQGYTTKMEIFGVGYRVAAKGKDLEFALGYSHPVPIEAPEGI  121


 Score = 56.2 bits (134),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIGK PI +P+ V + ++GQD KVKGP GEL +T    + + KEE+ ++  R   E R
Sbjct  2    SRIGKNPIAIPAGVDVTIDGQDVKVKGPKGELNLTVSEPITVTKEENSIVVARPNDERR  60



>ref|WP_018784558.1| 50S ribosomal protein L6 [Micromonospora sp. CNB394]
Length=180

 Score = 77.4 bits (189),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  PDG
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVLVPAPDG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 49.7 bits (117),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V I ++G+  KVKGP GEL       +  E+ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPAGVDITIDGRTVKVKGPKGELSHVLAEPITAERGEDGELHVNRPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



>ref|WP_037816261.1| MULTISPECIES: 50S ribosomal protein L6 [Actinomycetales]
Length=179

 Score = 73.9 bits (180),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G
Sbjct  62   SRALHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 53.1 bits (126),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQ+ KVKGP G L  T    + +E++E G L V++  + R 
Sbjct  2    SRIGKLPVAVPSGVEVTIDGQNVKVKGPKGTLEHTVAEPIVVERDEDGALLVKRPDDERT  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_003938077.1| 50S ribosomal protein L6 [Rhodococcus ruber]
 gb|EME59470.1| 50S ribosomal protein L6 [Rhodococcus ruber BKS 20-38]
Length=179

 Score = 71.2 bits (173),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            +  +HGL RTL  N+IVGV++G+  K+++ GVGYR  ++GKD+  +LG+SHPV +  P+G
Sbjct  62   SRALHGLSRTLVQNLIVGVTEGYTTKMEIHGVGYRVALKGKDLEFSLGYSHPVPIEAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 55.8 bits (133),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQD  VKGP G L +T    + + K + G L V +  + RR
Sbjct  2    SRIGKLPVTVPSGVEVTIDGQDVAVKGPKGNLSLTIAEPITIAKGDDGALNVSRPNDERR  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_018222588.1| 50S ribosomal protein L6 [Salinispora pacifica]
Length=180

 Score = 77.0 bits (188),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 50.1 bits (118),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETR  408
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +E+ E G L V +  + R
Sbjct  2    SRIGRKSIPVPAGVDVTIAGQTVTVKGPKGELSHTVAEPITIERAEDGQLNVARPNDER  60



>ref|WP_031712151.1| 50S ribosomal protein L6 [Mycobacterium tuberculosis]
 gb|KAN56897.1| 50S ribosomal protein L6 RplF [Mycobacterium tuberculosis 3499MM]
Length=179

 Score = 65.1 bits (157),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL  N++ GV++G+  K+++ GVGYR  ++G ++   LG+SHPV +  P+G+
Sbjct  65   LHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPEGI  122


 Score = 62.0 bits (149),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGKQPIPVP+ V + +EGQ   VKGP G LG+T    +K+ + + G + V +  + RR
Sbjct  2    SRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKMARNDDGAIVVTRPDDERR  61

Query  412  S  414
            +
Sbjct  62   N  62



>ref|WP_005166793.1| MULTISPECIES: 50S ribosomal protein L6 [Amycolatopsis]
 gb|EMD22584.1| LSU ribosomal protein L6p (L9e) [Amycolatopsis azurea DSM 43854]
 gb|AIG80054.1| 50S ribosomal protein L6 [Amycolatopsis japonica]
Length=179

 Score = 74.7 bits (182),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G+
Sbjct  65   LHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEGI  122


 Score = 52.4 bits (124),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQ  KV+GP G L  T    + +E+ E+G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVKVTIDGQQIKVEGPKGTLEHTIAEPITVEQAENGTLEVKRPDEERT  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_016331093.1| 50S ribosomal protein L6 [Amycolatopsis orientalis]
 gb|AGM03261.1| large subunit ribosomal protein L6 [Amycolatopsis orientalis 
HCCB10007]
Length=179

 Score = 74.7 bits (182),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  422  MHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDGL  595
            +HGL RTL +N++VGV++G++KKL++ GVGYR   +G D+   LG+SHPV++  P+G+
Sbjct  65   LHGLTRTLVNNLVVGVTEGYEKKLEIHGVGYRVQAKGSDLEFALGYSHPVKIEAPEGI  122


 Score = 52.4 bits (124),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIGK P+ VPS V + ++GQ  KV+GP G L  T    + +E+ E+G L V++  E R 
Sbjct  2    SRIGKLPVAVPSGVKVTIDGQQIKVEGPKGTLEHTIAEPITVEQAENGTLEVKRPDEERT  61

Query  412  S  414
            S
Sbjct  62   S  62



>ref|WP_008312941.1| 50S ribosomal protein L6 [Leptolyngbya sp. PCC 6406]
Length=179

 Score = 74.3 bits (181),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A   HGL RTL  NM+ GVS GF K+L++ GVGYRA ++G+ + ++LG+SHPV    P+G
Sbjct  61   ARARHGLCRTLVANMVEGVSNGFQKRLEIQGVGYRAQIQGQSLNMSLGYSHPVVFNPPEG  120

Query  593  LQ  598
            +Q
Sbjct  121  IQ  122


 Score = 52.8 bits (125),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVR  390
            SRIGK+PIP+PS VT+ ++GQ   VKGP GEL  T P  V++ +E   +L  R
Sbjct  2    SRIGKRPIPIPSKVTVSIDGQFVSVKGPKGELSRTLPTGVEIIQEGDTLLVTR  54



>ref|WP_012015113.1| MULTISPECIES: 50S ribosomal protein L6 [Salinispora]
 sp|A4XBN1.1|RL6_SALTO RecName: Full=50S ribosomal protein L6 [Salinispora tropica CNB-440]
 gb|ABP56338.1| LSU ribosomal protein L6P [Salinispora tropica CNB-440]
Length=180

 Score = 77.0 bits (188),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +2

Query  413  ANEMHGLFRTLTDNMIVGVSKGFDKKLQLVGVGYRAMVEGKDIVLNLGFSHPVRMAIPDG  592
            A E+HGL RTL  NMIVGV++G+ K L++ G GYR   +GKD+   LGFSHPV +  P+G
Sbjct  62   AKELHGLSRTLVANMIVGVTEGYRKSLEIAGTGYRVTAKGKDLEFALGFSHPVTVVAPEG  121

Query  593  L  595
            +
Sbjct  122  I  122


 Score = 49.7 bits (117),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = +1

Query  232  SRIGKQPIPVPSNVTIKMEGQDFKVKGPLGELGITYPREVKLEKEESGVLRVRKAMETRR  411
            SRIG++ IPVP+ V + + GQ   VKGP GEL  T    + +++ E G L V +  + R+
Sbjct  2    SRIGRKSIPVPTGVDVTIAGQTVTVKGPKGELSHTIAEPITIDRAEDGQLNVARPNDERK  61

Query  412  S  414
            +
Sbjct  62   A  62



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940