BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN037O11

Length=602
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008222861.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           266   2e-83   Prunus mume [ume]
ref|XP_009373545.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           264   1e-82   Pyrus x bretschneideri [bai li]
ref|XP_007223132.1|  hypothetical protein PRUPE_ppa005434mg             264   1e-82   Prunus persica
ref|XP_008380476.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           264   1e-82   Malus domestica [apple tree]
ref|XP_011084213.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           263   4e-82   Sesamum indicum [beniseed]
ref|XP_009608204.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      261   2e-81   Nicotiana tomentosiformis
ref|XP_004247883.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           261   2e-81   Solanum lycopersicum
ref|XP_006360928.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      259   5e-81   Solanum tuberosum [potatoes]
ref|XP_009768456.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      259   1e-80   Nicotiana sylvestris
ref|XP_010093344.1|  UDP-glucuronate 4-epimerase 6                      257   6e-80   Morus notabilis
ref|XP_010023657.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           256   1e-79   Eucalyptus grandis [rose gum]
ref|XP_004502237.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      255   2e-79   Cicer arietinum [garbanzo]
ref|XP_004297013.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           255   3e-79   Fragaria vesca subsp. vesca
ref|XP_010274074.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      255   4e-79   Nelumbo nucifera [Indian lotus]
ref|XP_002265088.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           254   6e-79   Vitis vinifera
ref|XP_003601662.1|  UDP-D-glucuronic acid 4-epimerase                  254   8e-79   Medicago truncatula
gb|AFK49564.1|  unknown                                                 254   9e-79   Medicago truncatula
ref|XP_004138968.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      254   9e-79   Cucumis sativus [cucumbers]
emb|CAN83418.1|  hypothetical protein VITISV_041351                     254   1e-78   Vitis vinifera
ref|XP_008457221.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           252   4e-78   Cucumis melo [Oriental melon]
ref|XP_010243459.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      249   7e-77   Nelumbo nucifera [Indian lotus]
dbj|BAE71216.1|  putative NAD dependent epimerase                       248   3e-76   Trifolium pratense [peavine clover]
gb|KDO42082.1|  hypothetical protein CISIN_1g011841mg                   248   3e-76   Citrus sinensis [apfelsine]
ref|XP_006421024.1|  hypothetical protein CICLE_v10004881mg             248   3e-76   Citrus clementina [clementine]
ref|XP_006492536.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      248   3e-76   Citrus sinensis [apfelsine]
gb|KDP39331.1|  hypothetical protein JCGZ_01088                         247   7e-76   Jatropha curcas
ref|XP_011003624.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      246   8e-76   Populus euphratica
ref|XP_002298679.1|  UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein     246   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_006349916.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      243   3e-74   Solanum tuberosum [potatoes]
ref|XP_009783247.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      242   3e-74   Nicotiana sylvestris
ref|XP_007034225.1|  UDP-D-glucuronate 4-epimerase 6                    242   4e-74   Theobroma cacao [chocolate]
gb|KJB28115.1|  hypothetical protein B456_005G028000                    240   5e-74   Gossypium raimondii
gb|ADB24770.1|  UDP-D-glucuronic acid 4-epimerase                       240   2e-73   Gossypium hirsutum [American cotton]
ref|XP_009616292.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      239   4e-73   Nicotiana tomentosiformis
ref|XP_007163818.1|  hypothetical protein PHAVU_001G267000g             239   5e-73   Phaseolus vulgaris [French bean]
gb|AGV54436.1|  UDP-D-glucuronic acid 4-epimerase                       239   5e-73   Phaseolus vulgaris [French bean]
ref|XP_006373087.1|  hypothetical protein POPTR_0017s08580g             239   6e-73   
ref|XP_011042175.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      239   9e-73   Populus euphratica
gb|AHA84281.1|  UDP-glucuronate 4-epimerase 6                           238   1e-72   Phaseolus vulgaris [French bean]
emb|CDP21869.1|  unnamed protein product                                236   8e-72   Coffea canephora [robusta coffee]
ref|XP_003538527.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      233   1e-70   Glycine max [soybeans]
gb|KJB72008.1|  hypothetical protein B456_011G153500                    228   7e-69   Gossypium raimondii
gb|ADB24769.1|  UDP-D-glucuronic acid 4-epimerase                       228   8e-69   Gossypium hirsutum [American cotton]
ref|XP_009408344.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      218   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794651.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    217   2e-64   Phoenix dactylifera
ref|XP_010532756.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           216   4e-64   Tarenaya hassleriana [spider flower]
ref|XP_010905148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      214   2e-63   Elaeis guineensis
ref|XP_010906178.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      214   3e-63   Elaeis guineensis
ref|XP_010673389.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           213   6e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010527460.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    213   9e-63   Tarenaya hassleriana [spider flower]
ref|NP_189024.1|  UDP-D-glucuronate 4-epimerase 6                       213   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AAN60250.1|  unknown                                                 212   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883465.1|  hypothetical protein ARALYDRAFT_898926             211   4e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_006297629.1|  hypothetical protein CARUB_v10013650mg             209   2e-61   Capsella rubella
gb|KFK39681.1|  hypothetical protein AALP_AA3G275400                    209   2e-61   Arabis alpina [alpine rockcress]
ref|XP_010421811.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      206   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009106288.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           209   3e-61   Brassica rapa
ref|XP_009102574.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           208   3e-61   Brassica rapa
ref|XP_006418833.1|  hypothetical protein EUTSA_v10002521mg             209   4e-61   Eutrema salsugineum [saltwater cress]
emb|CDY18087.1|  BnaA01g23480D                                          208   6e-61   Brassica napus [oilseed rape]
emb|CDY64583.1|  BnaCnng44170D                                          207   9e-61   Brassica napus [oilseed rape]
ref|XP_010468437.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      207   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010488461.1|  PREDICTED: UDP-glucuronate 4-epimerase 6           207   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008792930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      207   2e-60   Phoenix dactylifera
ref|XP_009386871.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      204   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX77481.1|  BnaA07g06190D                                          201   2e-58   
ref|XP_006848494.1|  hypothetical protein AMTR_s00013p00257170          201   3e-58   Amborella trichopoda
emb|CDX85133.1|  BnaC07g07730D                                          198   3e-57   
ref|XP_006365466.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      197   4e-57   Solanum tuberosum [potatoes]
emb|CDX92990.1|  BnaA03g37120D                                          196   2e-56   
ref|XP_009135867.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      196   2e-56   Brassica rapa
emb|CDY53207.1|  BnaC03g74010D                                          192   5e-55   Brassica napus [oilseed rape]
ref|XP_009412723.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      192   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003532740.2|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      187   6e-53   Glycine max [soybeans]
ref|XP_002522810.1|  UDP-glucuronate 5-epimerase, putative              174   9e-49   
ref|XP_006580148.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    175   9e-49   
ref|XP_003524930.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-lik...    175   1e-48   Glycine max [soybeans]
ref|XP_004239852.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      175   1e-48   Solanum lycopersicum
ref|NP_001147328.1|  protein capI                                       176   1e-48   Zea mays [maize]
ref|XP_009411848.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      174   6e-48   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC75426.1|  putative type 1 capsule synthesis gene(CapI)           174   6e-48   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001062295.1|  Os08g0526100                                       174   8e-48   
gb|EEC83914.1|  hypothetical protein OsI_29969                          174   2e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_002965131.1|  hypothetical protein SELMODRAFT_266836             171   5e-47   
gb|EEC84839.1|  hypothetical protein OsI_31939                          171   7e-47   Oryza sativa Indica Group [Indian rice]
ref|NP_001063595.1|  Os09g0504000                                       171   8e-47   
ref|XP_002962217.1|  hypothetical protein SELMODRAFT_77268              170   1e-46   Selaginella moellendorffii
gb|EAZ43405.1|  hypothetical protein OsJ_28010                          171   5e-46   Oryza sativa Japonica Group [Japonica rice]
gb|ABK25339.1|  unknown                                                 166   2e-45   Picea sitchensis
dbj|BAJ86203.1|  predicted protein                                      167   4e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002444715.1|  hypothetical protein SORBIDRAFT_07g026520          164   3e-44   Sorghum bicolor [broomcorn]
ref|XP_009397005.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      163   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004957272.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      164   4e-44   Setaria italica
gb|EMT02349.1|  UDP-glucuronate 4-epimerase 6                           165   8e-44   
ref|XP_002320057.1|  UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein     162   8e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006396209.1|  hypothetical protein EUTSA_v10028667mg             160   5e-43   Eutrema salsugineum [saltwater cress]
ref|NP_191922.1|  UDP-D-glucuronate 4-epimerase 3                       159   8e-43   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16292.1|  unknown                                                 159   1e-42   Picea sitchensis
ref|XP_009591830.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           159   1e-42   Nicotiana tomentosiformis
ref|XP_009399578.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           159   2e-42   
gb|KFK30589.1|  hypothetical protein AALP_AA6G001300                    159   2e-42   Arabis alpina [alpine rockcress]
ref|XP_009417460.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           159   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003578376.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      159   2e-42   Brachypodium distachyon [annual false brome]
gb|ACN26174.1|  unknown                                                 154   2e-42   Zea mays [maize]
ref|XP_004229804.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           158   3e-42   Solanum lycopersicum
ref|XP_002301280.2|  hypothetical protein POPTR_0002s14750g             158   4e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008351675.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           157   4e-42   
ref|XP_002462620.1|  hypothetical protein SORBIDRAFT_02g029130          158   5e-42   Sorghum bicolor [broomcorn]
ref|XP_009342752.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           157   6e-42   Pyrus x bretschneideri [bai li]
ref|XP_006660806.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      158   6e-42   Oryza brachyantha
ref|XP_003519171.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      157   6e-42   Glycine max [soybeans]
dbj|BAJ99315.1|  predicted protein                                      157   9e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002872971.1|  UDP-D-glucuronate 4-epimerase 2                    156   1e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_008364369.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           157   1e-41   
gb|KJB41101.1|  hypothetical protein B456_007G090500                    156   1e-41   Gossypium raimondii
ref|XP_007052086.1|  UDP-D-glucuronate 4-epimerase 3                    156   1e-41   
ref|XP_007154841.1|  hypothetical protein PHAVU_003G152300g             156   1e-41   Phaseolus vulgaris [French bean]
ref|XP_003605138.1|  UDP-glucuronate 4-epimerase                        156   1e-41   Medicago truncatula
ref|XP_004506538.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      156   1e-41   Cicer arietinum [garbanzo]
ref|XP_010914055.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           155   2e-41   Elaeis guineensis
ref|XP_006347877.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      155   3e-41   Solanum tuberosum [potatoes]
ref|XP_006287814.1|  hypothetical protein CARUB_v10001027mg             155   4e-41   Capsella rubella
ref|XP_011017483.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      155   4e-41   Populus euphratica
ref|XP_003549520.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      155   4e-41   Glycine max [soybeans]
ref|XP_009586623.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           154   5e-41   Nicotiana tomentosiformis
ref|XP_010523080.1|  PREDICTED: UDP-glucuronate 4-epimerase 3 iso...    154   6e-41   Tarenaya hassleriana [spider flower]
ref|NP_001142515.1|  hypothetical protein                               154   6e-41   Zea mays [maize]
gb|KDP28767.1|  hypothetical protein JCGZ_14538                         154   7e-41   Jatropha curcas
ref|XP_006445275.1|  hypothetical protein CICLE_v10020187mg             154   8e-41   Citrus clementina [clementine]
ref|XP_004973970.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      155   8e-41   Setaria italica
ref|XP_007218024.1|  hypothetical protein PRUPE_ppa005953mg             154   9e-41   Prunus persica
ref|XP_011069826.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           154   1e-40   Sesamum indicum [beniseed]
ref|XP_010909513.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    154   1e-40   Elaeis guineensis
ref|XP_004513504.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      154   1e-40   Cicer arietinum [garbanzo]
ref|XP_006345514.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      154   1e-40   Solanum tuberosum [potatoes]
ref|XP_009800153.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           153   1e-40   Nicotiana sylvestris
ref|XP_009596624.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           153   2e-40   Nicotiana tomentosiformis
ref|XP_011079342.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           153   2e-40   Sesamum indicum [beniseed]
ref|XP_011034154.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           153   2e-40   Populus euphratica
ref|XP_006853046.1|  hypothetical protein AMTR_s00038p00035160          153   2e-40   Amborella trichopoda
ref|XP_004954186.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      153   2e-40   Setaria italica
ref|XP_010929207.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           153   2e-40   Elaeis guineensis
ref|XP_010278008.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           153   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010053904.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           153   3e-40   Eucalyptus grandis [rose gum]
ref|XP_004133919.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      153   3e-40   
ref|XP_004155787.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      152   3e-40   
ref|XP_002452964.1|  hypothetical protein SORBIDRAFT_04g035630          152   3e-40   Sorghum bicolor [broomcorn]
gb|EPS60141.1|  hypothetical protein M569_14661                         152   3e-40   Genlisea aurea
ref|XP_004162690.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      152   3e-40   
ref|XP_010424029.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      148   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004240046.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      152   4e-40   Solanum lycopersicum
ref|XP_010268405.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      152   4e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008649176.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      152   4e-40   Zea mays [maize]
ref|XP_006286788.1|  hypothetical protein CARUB_v10003353mg             152   4e-40   Capsella rubella
ref|XP_008465609.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           152   5e-40   Cucumis melo [Oriental melon]
dbj|BAJ85817.1|  predicted protein                                      152   6e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX94504.1|  BnaC09g23320D                                          152   7e-40   
ref|NP_001105911.1|  LOC732831                                          152   7e-40   Zea mays [maize]
ref|XP_008438174.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           151   7e-40   Cucumis melo [Oriental melon]
ref|XP_002309376.1|  hypothetical protein POPTR_0006s19240g             151   8e-40   Populus trichocarpa [western balsam poplar]
ref|XP_007134861.1|  hypothetical protein PHAVU_010G082300g             151   8e-40   Phaseolus vulgaris [French bean]
ref|XP_010692224.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           152   8e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008677814.1|  PREDICTED: LOC732831 isoform X1                    151   8e-40   Zea mays [maize]
ref|XP_004144711.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      151   8e-40   Cucumis sativus [cucumbers]
ref|NP_001048359.1|  Os02g0791500                                       151   9e-40   
ref|XP_010433651.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      151   9e-40   Camelina sativa [gold-of-pleasure]
ref|XP_004507780.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      151   9e-40   Cicer arietinum [garbanzo]
ref|XP_006648037.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      151   9e-40   Oryza brachyantha
emb|CDY63064.1|  BnaAnng18570D                                          151   9e-40   Brassica napus [oilseed rape]
ref|XP_009409770.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      151   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009111519.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           151   1e-39   Brassica rapa
emb|CDO97699.1|  unnamed protein product                                151   1e-39   Coffea canephora [robusta coffee]
gb|KEH32594.1|  UDP-D-glucuronate 4-epimerase                           151   1e-39   Medicago truncatula
emb|CDX86716.1|  BnaA09g21060D                                          151   1e-39   
ref|XP_003517038.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      151   1e-39   Glycine max [soybeans]
ref|XP_002281007.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      151   1e-39   Vitis vinifera
gb|KJB24820.1|  hypothetical protein B456_004G162700                    151   1e-39   Gossypium raimondii
ref|XP_004248561.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      150   1e-39   Solanum lycopersicum
ref|XP_008354844.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           150   2e-39   
gb|AAM61323.1|  nucleotide sugar epimerase, putative                    150   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|ADB24771.1|  UDP-D-glucuronic acid 4-epimerase                       150   2e-39   Gossypium hirsutum [American cotton]
gb|ACJ11754.1|  UDP-D-glucuronic acid 4-epimerase                       150   2e-39   Gossypium hirsutum [American cotton]
ref|XP_009784108.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      150   2e-39   Nicotiana sylvestris
ref|NP_171702.1|  UDP-D-glucuronate 4-epimerase 2                       150   2e-39   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK06545.1|  predicted protein                                      150   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW85530.1|  hypothetical protein ZEAMMB73_797483                    150   2e-39   
ref|XP_010661665.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      150   3e-39   Vitis vinifera
gb|KJB76605.1|  hypothetical protein B456_012G096800                    150   3e-39   Gossypium raimondii
ref|XP_011090565.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      150   3e-39   Sesamum indicum [beniseed]
ref|XP_009786918.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      150   3e-39   Nicotiana sylvestris
ref|XP_009789635.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           150   3e-39   Nicotiana sylvestris
ref|XP_003521958.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      150   3e-39   Glycine max [soybeans]
ref|XP_003564175.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      150   3e-39   Brachypodium distachyon [annual false brome]
emb|CDP21367.1|  unnamed protein product                                150   4e-39   Coffea canephora [robusta coffee]
ref|XP_010539945.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           150   4e-39   Tarenaya hassleriana [spider flower]
ref|XP_008781382.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      149   4e-39   Phoenix dactylifera
ref|XP_007013947.1|  UDP-D-glucuronate 4-epimerase 1                    149   4e-39   
ref|XP_006396783.1|  hypothetical protein EUTSA_v10028672mg             149   4e-39   Eutrema salsugineum [saltwater cress]
ref|XP_010276827.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      149   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010103125.1|  UDP-glucuronate 4-epimerase 1                      149   5e-39   Morus notabilis
ref|XP_010264164.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           149   5e-39   Nelumbo nucifera [Indian lotus]
ref|XP_009348282.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           149   6e-39   Pyrus x bretschneideri [bai li]
ref|XP_002437985.1|  hypothetical protein SORBIDRAFT_10g005920          149   6e-39   Sorghum bicolor [broomcorn]
ref|XP_009600710.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      149   6e-39   Nicotiana tomentosiformis
ref|XP_002280967.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           149   6e-39   
ref|XP_010413058.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      144   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009390535.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      149   7e-39   
ref|XP_008794398.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           149   7e-39   Phoenix dactylifera
emb|CDY04398.1|  BnaC02g28500D                                          149   7e-39   
ref|XP_004966666.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      149   8e-39   Setaria italica
ref|XP_010525760.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           149   9e-39   Tarenaya hassleriana [spider flower]
gb|KGN65261.1|  hypothetical protein Csa_1G277970                       148   1e-38   Cucumis sativus [cucumbers]
ref|XP_008372097.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           148   1e-38   Malus domestica [apple tree]
ref|XP_002874760.1|  UDP-D-glucuronate 4-epimerase 5                    149   1e-38   
ref|XP_006359203.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      149   1e-38   Solanum tuberosum [potatoes]
ref|XP_010047879.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           148   1e-38   Eucalyptus grandis [rose gum]
ref|NP_192962.1|  UDP-D-glucuronate 4-epimerase 5                       148   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009593138.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           149   1e-38   Nicotiana tomentosiformis
gb|KEH16056.1|  UDP-D-glucuronate 4-epimerase                           148   1e-38   Medicago truncatula
ref|XP_004298689.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           148   1e-38   Fragaria vesca subsp. vesca
ref|XP_002892033.1|  UDP-D-glucuronate 4-epimerase 2                    148   1e-38   Arabidopsis lyrata subsp. lyrata
gb|AAK93670.1|  putative nucleotide sugar epimerase                     148   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KDO62346.1|  hypothetical protein CISIN_1g043169mg                   148   1e-38   Citrus sinensis [apfelsine]
ref|XP_011018096.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           148   1e-38   Populus euphratica
ref|XP_002324510.1|  UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein     148   1e-38   Populus trichocarpa [western balsam poplar]
ref|XP_008443815.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      148   1e-38   Cucumis melo [Oriental melon]
ref|XP_003570280.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           148   1e-38   Brachypodium distachyon [annual false brome]
ref|XP_006453511.1|  hypothetical protein CICLE_v10008355mg             148   1e-38   Citrus clementina [clementine]
emb|CDX97356.1|  BnaA02g21470D                                          148   1e-38   
emb|CDY70926.1|  BnaCnng70410D                                          148   1e-38   Brassica napus [oilseed rape]
ref|XP_009128629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      148   1e-38   Brassica rapa
ref|NP_194773.1|  UDP-D-glucuronate 4-epimerase 1                       148   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114629.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    148   2e-38   
ref|XP_010432987.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           148   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010047039.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           148   2e-38   Eucalyptus grandis [rose gum]
ref|XP_006282616.1|  hypothetical protein CARUB_v10004864mg             148   2e-38   Capsella rubella
ref|XP_009127808.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           148   2e-38   Brassica rapa
ref|XP_010438178.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           148   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010426564.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           148   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009380772.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      148   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010419541.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      147   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_011093361.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      147   2e-38   Sesamum indicum [beniseed]
gb|KFK29619.1|  hypothetical protein AALP_AA7G157500                    147   2e-38   Arabis alpina [alpine rockcress]
ref|XP_006412706.1|  hypothetical protein EUTSA_v10025193mg             147   2e-38   
gb|EYU37123.1|  hypothetical protein MIMGU_mgv1a006776mg                147   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_009114630.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    147   2e-38   
dbj|BAD36515.1|  putative uridine diphosphate galacturonate 4-epi...    147   2e-38   Oryza sativa Japonica Group [Japonica rice]
emb|CDX72242.1|  BnaC07g42640D                                          147   2e-38   
gb|EAY99954.1|  hypothetical protein OsI_21957                          147   3e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_010098924.1|  UDP-glucuronate 4-epimerase 3                      147   3e-38   Morus notabilis
ref|XP_010422190.1|  PREDICTED: UDP-glucuronate 4-epimerase 5 iso...    147   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010539138.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      147   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_007222381.1|  hypothetical protein PRUPE_ppa006006mg             147   3e-38   Prunus persica
ref|XP_006845469.1|  hypothetical protein AMTR_s00019p00132110          147   3e-38   Amborella trichopoda
ref|XP_008223573.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           147   3e-38   Prunus mume [ume]
gb|KJB27036.1|  hypothetical protein B456_004G273500                    146   4e-38   Gossypium raimondii
ref|XP_009614886.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      147   4e-38   Nicotiana tomentosiformis
ref|XP_004296420.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           147   4e-38   Fragaria vesca subsp. vesca
emb|CAN73016.1|  hypothetical protein VITISV_004388                     147   4e-38   Vitis vinifera
gb|EPS72617.1|  hypothetical protein M569_02133                         147   4e-38   Genlisea aurea
gb|KJB27035.1|  hypothetical protein B456_004G273500                    147   4e-38   Gossypium raimondii
emb|CDY39205.1|  BnaA03g50170D                                          147   5e-38   Brassica napus [oilseed rape]
ref|XP_008794557.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      147   5e-38   Phoenix dactylifera
ref|XP_002993206.1|  hypothetical protein SELMODRAFT_136684             147   5e-38   
ref|XP_002965479.1|  hypothetical protein SELMODRAFT_84174              147   5e-38   
ref|XP_010447717.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      146   5e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010687680.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           146   5e-38   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP38751.1|  hypothetical protein JCGZ_04104                         146   6e-38   Jatropha curcas
ref|XP_009781950.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      146   6e-38   Nicotiana sylvestris
gb|EYU34305.1|  hypothetical protein MIMGU_mgv1a006903mg                146   9e-38   Erythranthe guttata [common monkey flower]
gb|KJB09908.1|  hypothetical protein B456_001G174300                    146   9e-38   Gossypium raimondii
ref|XP_006350062.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      146   9e-38   Solanum tuberosum [potatoes]
ref|XP_008361335.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           146   9e-38   Malus domestica [apple tree]
gb|KFK42571.1|  hypothetical protein AALP_AA1G012900                    146   1e-37   Arabis alpina [alpine rockcress]
ref|NP_001150944.1|  NAD-dependent epimerase/dehydratase family p...    145   2e-37   Zea mays [maize]
gb|AFW61553.1|  NAD-dependent epimerase/dehydratase family protein      145   2e-37   
ref|XP_009137920.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      145   2e-37   Brassica rapa
gb|EYU30554.1|  hypothetical protein MIMGU_mgv1a006591mg                145   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_011010511.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      144   3e-37   Populus euphratica
ref|XP_006397710.1|  hypothetical protein EUTSA_v10001454mg             144   3e-37   
ref|XP_004251783.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      144   3e-37   
ref|XP_008780407.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      141   4e-37   
ref|XP_001767292.1|  predicted protein                                  144   4e-37   
ref|XP_002528222.1|  UDP-glucuronate 5-epimerase, putative              144   5e-37   
emb|CDX95646.1|  BnaC03g25270D                                          144   5e-37   
emb|CDY67756.1|  BnaA03g56770D                                          144   5e-37   
ref|XP_009133725.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           144   5e-37   
gb|KFK31963.1|  hypothetical protein AALP_AA6G182500                    143   9e-37   
ref|XP_007209167.1|  hypothetical protein PRUPE_ppa006148mg             143   9e-37   
gb|EYU30447.1|  hypothetical protein MIMGU_mgv1a006641mg                143   1e-36   
ref|XP_010506473.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      143   1e-36   
ref|XP_010506472.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           143   1e-36   
ref|XP_010508183.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      143   1e-36   
ref|XP_011076316.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      142   2e-36   
ref|XP_008664162.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      142   2e-36   
ref|XP_010055537.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      142   3e-36   
ref|XP_009395225.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      142   3e-36   
ref|XP_006295696.1|  hypothetical protein CARUB_v10024814mg             142   3e-36   
ref|XP_002880171.1|  UDP-D-glucuronate 4-epimerase 4                    142   3e-36   
ref|XP_001769370.1|  predicted protein                                  142   4e-36   
ref|XP_006343570.1|  PREDICTED: UDP-glucuronate 4-epimerase 1-like      141   5e-36   
ref|XP_010544649.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           141   5e-36   
ref|XP_002509598.1|  UDP-glucuronate 5-epimerase, putative              140   9e-36   
ref|XP_004515772.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      140   9e-36   
ref|XP_003558346.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      140   1e-35   
ref|XP_008238641.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           140   1e-35   
ref|NP_182056.1|  UDP-D-glucuronate 4-epimerase 4                       140   1e-35   
gb|KDP25603.1|  hypothetical protein JCGZ_20759                         140   1e-35   
emb|CDP09891.1|  unnamed protein product                                140   2e-35   
ref|XP_011033905.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      139   2e-35   
ref|XP_004306933.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           139   2e-35   
ref|XP_011014804.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      139   2e-35   
gb|KFK37325.1|  hypothetical protein AALP_AA4G242100                    139   2e-35   
ref|XP_008660337.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      140   2e-35   
ref|XP_009781927.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      139   3e-35   
ref|XP_010676680.1|  PREDICTED: UDP-glucuronate 4-epimerase 4           139   3e-35   
ref|XP_010323223.1|  PREDICTED: UDP-glucuronate 4-epimerase 1           139   4e-35   
ref|XP_001754001.1|  predicted protein                                  139   4e-35   
ref|XP_001751991.1|  predicted protein                                  139   4e-35   
ref|XP_002303529.2|  hypothetical protein POPTR_0003s11410g             138   5e-35   
ref|XP_004147978.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      138   8e-35   
ref|XP_008448903.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           138   8e-35   
ref|XP_009621323.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      137   1e-34   
ref|XP_011081125.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           137   1e-34   
ref|XP_002468173.1|  hypothetical protein SORBIDRAFT_01g041030          138   1e-34   
ref|XP_003635629.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      137   1e-34   
ref|XP_006837081.1|  hypothetical protein AMTR_s00110p00097630          137   1e-34   
emb|CAN60968.1|  hypothetical protein VITISV_008097                     137   1e-34   
ref|XP_006365249.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      137   2e-34   
ref|XP_004234942.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      137   2e-34   
ref|XP_003635586.2|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      137   2e-34   
ref|XP_006477270.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      137   2e-34   
gb|EPS64795.1|  hypothetical protein M569_09984                         135   2e-34   
ref|XP_001781238.1|  predicted protein                                  136   3e-34   
ref|XP_001761086.1|  predicted protein                                  136   3e-34   
ref|XP_006363737.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      136   4e-34   
ref|XP_004245716.1|  PREDICTED: UDP-glucuronate 4-epimerase 5           136   4e-34   
ref|XP_001761984.1|  predicted protein                                  135   6e-34   
ref|XP_003572425.1|  PREDICTED: UDP-glucuronate 4-epimerase 6-like      135   7e-34   
ref|XP_006440401.1|  hypothetical protein CICLE_v10020257mg             135   7e-34   
ref|XP_010108144.1|  UDP-glucuronate 4-epimerase 3                      135   1e-33   
gb|KEH31675.1|  UDP-D-glucuronate 4-epimerase                           134   1e-33   
gb|KJB43946.1|  hypothetical protein B456_007G225300                    134   2e-33   
ref|XP_002965132.1|  hypothetical protein SELMODRAFT_82699              125   2e-33   
ref|XP_007039971.1|  UDP-D-glucuronate 4-epimerase 3                    132   8e-33   
ref|XP_007155583.1|  hypothetical protein PHAVU_003G214400g             131   1e-32   
gb|KJB25649.1|  hypothetical protein B456_004G202200                    131   2e-32   
ref|XP_009401924.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      131   2e-32   
ref|XP_011029969.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      130   3e-32   
ref|XP_002318876.1|  hypothetical protein POPTR_0012s14480g             130   3e-32   
ref|XP_001759693.1|  predicted protein                                  130   5e-32   
ref|NP_001049561.1|  Os03g0249500                                       128   3e-31   
ref|XP_002266529.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      127   3e-31   
ref|XP_008653512.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      128   4e-31   
ref|XP_003525759.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      127   6e-31   
gb|KDO65412.1|  hypothetical protein CISIN_1g015113mg                   127   6e-31   
ref|XP_001777338.1|  predicted protein                                  127   8e-31   
ref|XP_003549880.1|  PREDICTED: UDP-glucuronate 4-epimerase 5-like      126   9e-31   
ref|XP_004985001.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      126   1e-30   
emb|CBI18845.3|  unnamed protein product                                123   1e-30   
gb|KHN30291.1|  UDP-glucuronate 4-epimerase 1                           124   2e-30   
gb|AFW82019.1|  hypothetical protein ZEAMMB73_069067                    123   5e-30   
ref|XP_006490076.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      124   6e-30   
ref|XP_006421730.1|  hypothetical protein CICLE_v10005072mg             124   7e-30   
gb|KDP22397.1|  hypothetical protein JCGZ_26228                         123   1e-29   
dbj|BAJ88176.1|  predicted protein                                      123   2e-29   
gb|EPS73152.1|  hypothetical protein M569_01604                         122   2e-29   
ref|XP_008234372.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      122   3e-29   
ref|XP_003611251.1|  UDP-glucuronate 4-epimerase                        122   5e-29   
ref|XP_007221187.1|  hypothetical protein PRUPE_ppa021672mg             120   1e-28   
ref|XP_009370520.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      119   2e-28   
ref|XP_009372935.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-like      119   3e-28   
ref|XP_006587717.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    118   8e-28   
ref|XP_003533522.2|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    118   8e-28   
ref|XP_006587715.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    118   9e-28   
ref|XP_006587714.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    118   9e-28   
ref|XP_008376451.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    118   1e-27   
ref|XP_006587718.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    118   1e-27   
ref|XP_006587716.1|  PREDICTED: UDP-glucuronate 4-epimerase 4-lik...    118   1e-27   
ref|XP_010053408.1|  PREDICTED: UDP-glucuronate 4-epimerase 3           117   3e-27   
tpg|DAA44393.1|  TPA: 40S ribosomal protein S20                         115   1e-26   
ref|XP_008439108.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      115   1e-26   
ref|XP_004171294.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      114   1e-26   
ref|XP_004148129.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like      114   3e-26   
gb|AFW73830.1|  hypothetical protein ZEAMMB73_770166                    105   5e-25   
ref|XP_002968145.1|  hypothetical protein SELMODRAFT_89938              110   5e-25   
ref|XP_002970377.1|  hypothetical protein SELMODRAFT_93183              109   7e-25   
ref|XP_010540291.1|  PREDICTED: UDP-glucuronate 4-epimerase 3-like      107   3e-24   
gb|EAZ36080.1|  hypothetical protein OsJ_20391                          103   1e-22   
gb|EMS53276.1|  UDP-glucuronate 4-epimerase 1                           102   6e-22   
emb|CBI24539.3|  unnamed protein product                              97.4    1e-20   
gb|EMT09376.1|  UDP-glucuronate 4-epimerase 1                         94.0    2e-19   
gb|KIC75589.1|  UDP-glucuronate 4-epimerase 4                         94.0    2e-19   
ref|WP_042239280.1|  hypothetical protein                             93.6    2e-19   
ref|WP_039386438.1|  hypothetical protein                             92.0    7e-19   
ref|XP_002504144.1|  predicted protein                                92.0    2e-18   
ref|XP_006651218.1|  PREDICTED: UDP-glucuronate 4-epimerase 2-like    92.0    4e-18   
gb|EMT23409.1|  UDP-glucuronate 4-epimerase 1                         87.0    2e-16   
emb|CEG01274.1|  Nucleotide sugar epimerase                           84.3    9e-16   
ref|WP_013942574.1|  NAD-dependent epimerase                          83.2    1e-15   
ref|XP_002515933.1|  UDP-glucuronate 5-epimerase, putative            80.5    1e-15   
gb|KIA76468.1|  UDP-glucuronate 4-epimerase 4                         82.0    2e-15   
ref|WP_013924154.1|  NAD-dependent epimerase                          82.0    2e-15   
ref|WP_006341506.1|  NAD-dependent epimerase                          82.0    2e-15   
ref|WP_013182875.1|  NAD-dependent epimerase                          81.6    3e-15   
ref|XP_002945754.1|  NAD-dependent epimerase/dehydratase              82.4    4e-15   
gb|AFW77898.1|  hypothetical protein ZEAMMB73_133895                  81.6    4e-15   
ref|XP_003075335.1|  putative nucleotide sugar epimerase (ISS)        82.4    5e-15   
ref|XP_003060215.1|  protein arginine methyltransferase               81.3    6e-15   
ref|WP_032124748.1|  protein CapI                                     80.9    6e-15   
ref|WP_027183803.1|  capsular biosynthesis protein CpsI               81.3    6e-15   
gb|AFW76910.1|  hypothetical protein ZEAMMB73_383341                  82.0    6e-15   
ref|WP_020559072.1|  NAD dependent epimerase/dehydratase              80.9    6e-15   
ref|XP_004345510.1|  UDP-glucuronat epimerase                         82.4    1e-14   
gb|KJE95471.1|  UDP-glucuronat epimerase                              82.4    1e-14   
gb|AFW73050.1|  hypothetical protein ZEAMMB73_892883                  80.5    1e-14   
ref|WP_013259566.1|  epimerase                                        79.7    2e-14   
ref|WP_018604345.1|  NAD dependent epimerase/dehydratase              79.7    2e-14   
ref|WP_009552387.1|  nucleoside-diphosphate-sugar epimerase           79.3    2e-14   
ref|WP_012468563.1|  NAD-dependent epimerase/dehydratase              79.7    2e-14   
ref|WP_038095738.1|  capsular biosynthesis protein CpsI               75.5    3e-14   
ref|XP_005538382.1|  probable nucleotide sugar epimerase              79.7    3e-14   
ref|WP_036997098.1|  UDP-glucuronate 5-epimerase                      79.0    4e-14   
ref|XP_001698020.1|  NAD-dependent epimerase/dehydratase              79.0    4e-14   
ref|WP_028143322.1|  MULTISPECIES: UDP-glucuronate 5-epimerase        78.2    6e-14   
ref|WP_012823883.1|  NAD-dependent epimerase/dehydratase              78.2    6e-14   
gb|EKE24914.1|  hypothetical protein ACD_5C00356G0001                 77.4    6e-14   
ref|WP_028032856.1|  hypothetical protein                             77.8    1e-13   
ref|XP_001416501.1|  predicted protein                                77.8    1e-13   
ref|WP_034152563.1|  UDP-glucuronate 5-epimerase                      77.4    1e-13   
gb|KDD74739.1|  NAD dependent epimerase/dehydratase                   77.4    2e-13   
ref|WP_038084328.1|  capsular biosynthesis protein CpsI               73.9    2e-13   
ref|WP_010226857.1|  UDP-glucuronate 5'-epimerase                     77.4    2e-13   
ref|WP_039742914.1|  capsular biosynthesis protein CpsI               77.0    2e-13   
ref|WP_043229797.1|  UDP-glucuronate 5-epimerase                      76.6    2e-13   
ref|WP_041245451.1|  capsular biosynthesis protein CpsI               76.6    2e-13   
ref|WP_019645719.1|  hypothetical protein                             76.6    2e-13   
gb|EPL07171.1|  NAD dependent epimerase/dehydratase family protein    76.6    2e-13   
gb|ABQ26775.1|  NAD-dependent epimerase/dehydratase                   77.0    2e-13   
ref|WP_035707943.1|  UDP-glucuronate 5-epimerase                      72.8    5e-13   
ref|WP_038995062.1|  UDP-glucuronate 5-epimerase                      75.9    5e-13   
ref|WP_009573440.1|  putatively exported UDP-glucuronate 4-epimerase  75.5    6e-13   
ref|WP_010150292.1|  nucleoside-diphosphate sugar epimerase           75.5    7e-13   
ref|XP_007512695.1|  predicted protein                                76.6    9e-13   
ref|WP_008990343.1|  3-beta hydroxysteroid dehydrogenase              74.7    1e-12   
ref|WP_026686095.1|  hypothetical protein                             74.7    1e-12   
ref|WP_004088268.1|  Nucleoside-diphosphate-sugar epimerase           74.7    1e-12   
ref|WP_028622110.1|  UDP-glucuronate 5-epimerase                      74.7    1e-12   
ref|WP_018878551.1|  hypothetical protein                             72.8    1e-12   
ref|WP_018881841.1|  hypothetical protein                             73.2    1e-12   
ref|WP_039008500.1|  protein CapI                                     74.3    1e-12   
ref|WP_012914671.1|  nucleoside-diphosphate-sugar epimerases protein  74.3    1e-12   
ref|WP_019584594.1|  hypothetical protein                             73.2    1e-12   
ref|WP_018941321.1|  NAD dependent epimerase/dehydratase              74.3    2e-12   
ref|WP_018864896.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  74.3    2e-12   
ref|WP_019592786.1|  hypothetical protein                             72.8    2e-12   
ref|WP_019025549.1|  hypothetical protein                             72.8    2e-12   
ref|WP_005995570.1|  nucleoside-diphosphate-sugar epimerase           73.9    2e-12   
ref|WP_020651173.1|  hypothetical protein                             74.3    2e-12   
ref|WP_042729731.1|  UDP-glucuronate 5-epimerase                      74.3    2e-12   
ref|WP_039423618.1|  protein CapI                                     73.9    2e-12   
ref|WP_019024820.1|  hypothetical protein                             73.2    2e-12   
ref|WP_034222141.1|  capsular biosynthesis protein CpsI               73.9    2e-12   
ref|WP_018138355.1|  hypothetical protein                             72.8    2e-12   
ref|WP_042129435.1|  UDP-glucuronate 5-epimerase                      74.3    2e-12   
ref|WP_009043797.1|  NAD dependent epimerase/dehydratase family p...  73.9    2e-12   
gb|EKE11344.1|  hypothetical protein ACD_15C00104G0022                73.9    2e-12   
ref|WP_026304200.1|  hypothetical protein                             73.9    2e-12   
ref|WP_013268553.1|  NAD-dependent epimerase/dehydratase              73.6    2e-12   
ref|WP_020083694.1|  hypothetical protein                             73.6    3e-12   
ref|WP_008311049.1|  nucleoside-diphosphate-sugar epimerase           73.9    3e-12   
ref|WP_027071813.1|  capsular biosynthesis protein CpsI               73.6    3e-12   
ref|WP_043743205.1|  protein CapI                                     73.6    3e-12   
ref|WP_013179120.1|  epimerase                                        73.6    3e-12   
ref|WP_004304270.1|  MULTISPECIES: NAD-dependent epimerase/dehydr...  73.6    3e-12   
ref|WP_007973829.1|  nucleoside-diphosphate-sugar epimerase           73.6    3e-12   
ref|WP_041227251.1|  capsular biosynthesis protein CpsI               73.6    3e-12   
ref|WP_007919479.1|  MULTISPECIES: nucleoside-diphosphate-sugar e...  73.6    3e-12   
ref|WP_018176093.1|  NAD dependent epimerase/dehydratase              73.6    4e-12   
ref|WP_018317382.1|  NAD-dependent epimerase                          73.2    4e-12   
ref|WP_026380427.1|  capsular biosynthesis protein CpsI               73.2    4e-12   
ref|WP_019612082.1|  NAD dependent epimerase/dehydratase              73.6    4e-12   
ref|WP_017165470.1|  NAD dependent epimerase/dehydratase              70.5    4e-12   
ref|WP_018144022.1|  NAD dependent epimerase/dehydratase              73.2    4e-12   
ref|WP_038228294.1|  protein CapI                                     73.2    4e-12   
ref|WP_025808992.1|  UDP-glucuronate 5-epimerase                      73.2    4e-12   
gb|KIA57531.1|  protein CapI                                          72.8    5e-12   
ref|WP_031336424.1|  hypothetical protein                             72.8    5e-12   
ref|WP_020852009.1|  NAD-dependent epimerase/dehydratase              72.8    5e-12   
gb|EJZ31449.1|  UDP-glucuronic acid epimerase                         70.5    5e-12   
ref|WP_018867566.1|  MULTISPECIES: NAD dependent epimerase/dehydr...  72.4    5e-12   
ref|WP_015094545.1|  UDP-glucuronate 5 -epimerase                     73.2    5e-12   
ref|WP_019592126.1|  NAD dependent epimerase/dehydratase              73.2    5e-12   
ref|WP_013417882.1|  NAD-dependent epimerase/dehydratase              72.8    5e-12   
ref|WP_017925880.1|  NAD dependent epimerase/dehydratase              73.2    5e-12   
ref|WP_007697851.1|  UDP-glucuronate 5'-epimerase                     72.8    5e-12   
ref|WP_009802664.1|  NAD-dependent epimerase/dehydratase family p...  72.8    5e-12   
ref|WP_020146287.1|  NAD dependent epimerase/dehydratase              72.8    5e-12   
ref|WP_029077107.1|  hypothetical protein                             72.8    5e-12   
ref|WP_028795903.1|  hypothetical protein                             72.8    5e-12   



>ref|XP_008222861.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Prunus mume]
Length=440

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 160/183 (87%), Gaps = 6/183 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL+E
Sbjct  1    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSE  60

Query  246  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  413
              GGG    +HTT H+ L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGFVG
Sbjct  61   HMGGGAHH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFVG  118

Query  414  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  593
            +HCSLALKKRGDGVLGLDNFN+YYDPSLKRARQ LL++H++F+VEGDLND PLL+KLFD+
Sbjct  119  THCSLALKKRGDGVLGLDNFNSYYDPSLKRARQALLKRHEVFVVEGDLNDEPLLTKLFDV  178

Query  594  VPF  602
            VPF
Sbjct  179  VPF  181



>ref|XP_009373545.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Pyrus x bretschneideri]
Length=465

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 6/183 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++
Sbjct  5    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSD  64

Query  246  SSGGGRRRALHTTGHSLLAATFSGGA----AWEKQVQSSATPRRQNGMSVLVTGAAGFVG  413
              GGG    +HTT H+ L++ F GG     AWEKQV+ SATPRR NGMSVLVTGAAGFVG
Sbjct  65   HVGGGANH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRKSATPRRPNGMSVLVTGAAGFVG  122

Query  414  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  593
            SHCSLALKKRGDGVLGLDNFN+YYDPSLKR+RQ LL+KH++F+VEGDLND PLL+KLFD+
Sbjct  123  SHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQALLKKHEVFVVEGDLNDEPLLTKLFDV  182

Query  594  VPF  602
            VPF
Sbjct  183  VPF  185



>ref|XP_007223132.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
 gb|EMJ24331.1| hypothetical protein PRUPE_ppa005434mg [Prunus persica]
Length=461

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 160/183 (87%), Gaps = 6/183 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LIFFFTINYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLIFFFTINYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  413
              GGG    +HTT H+ L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGFVG
Sbjct  61   HMGGGAHH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFVG  118

Query  414  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  593
            +HCSLALKKRGDGVLGLDNFN+YYDPSLKRARQ LL++H++F+VEGDLND PLL+KLFD+
Sbjct  119  THCSLALKKRGDGVLGLDNFNSYYDPSLKRARQALLKRHEVFVVEGDLNDEPLLTKLFDV  178

Query  594  VPF  602
            VPF
Sbjct  179  VPF  181



>ref|XP_008380476.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Malus domestica]
Length=465

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 159/183 (87%), Gaps = 6/183 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RRVNS+KL+ ASSKLLFRATL+VAL+LI FFT+NYPPL++
Sbjct  5    MASPPDTSKTIKLERYNSYLRRVNSTKLLNASSKLLFRATLLVALVLILFFTLNYPPLSD  64

Query  246  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  413
              GGG    +HTT H+ L++ F     GG AWEKQV+ SATPRR NGMSVLVTGAAGFVG
Sbjct  65   HVGGGANH-VHTT-HNFLSSAFYGGGVGGTAWEKQVRKSATPRRPNGMSVLVTGAAGFVG  122

Query  414  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  593
            SHCSLALKKRGDGVLGLDNFN+YYDPSLKR+RQ LL+KH++F+VEGDLND PLL+KLFD+
Sbjct  123  SHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQALLKKHEVFVVEGDLNDEPLLTKLFDV  182

Query  594  VPF  602
            VPF
Sbjct  183  VPF  185



>ref|XP_011084213.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Sesamum indicum]
Length=459

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 154/178 (87%), Gaps = 4/178 (2%)
 Frame = +3

Query  69   AFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAES  248
            A PPDTSK +KLERYNSYIRRVNS+KL+ ASSKLLFR TL+VALILIFFFT+NYPPL+ +
Sbjct  10   ASPPDTSKTTKLERYNSYIRRVNSTKLLQASSKLLFRVTLLVALILIFFFTLNYPPLSSA  69

Query  249  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  428
                    +H+T H L +A +  GAAWEKQV+ SATPRR NG SVLVTGAAGFVGSHCSL
Sbjct  70   D----NHHIHSTNHFLASAFYGSGAAWEKQVRHSATPRRPNGFSVLVTGAAGFVGSHCSL  125

Query  429  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            ALKKRGDGVLGLDNFN+YYDPSLKRARQKLL KH+IF+VEGD+NDA LL+KLFD+VPF
Sbjct  126  ALKKRGDGVLGLDNFNSYYDPSLKRARQKLLSKHEIFVVEGDINDAELLNKLFDVVPF  183



>ref|XP_009608204.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=450

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 155/180 (86%), Gaps = 2/180 (1%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA 
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRITLLVALLLIFFFTINYPPLA-  59

Query  246  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
            S        +HTT H+LL++ F  GGA+WEKQV+ SATP R NG SVLVTGAAGFVGSH 
Sbjct  60   SDNTNSHNNIHTTTHNLLSSAFYGGGASWEKQVRRSATPSRPNGFSVLVTGAAGFVGSHS  119

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLALKKRGDGVLGLDNFN+YYDPSLKRARQ LL KHQIFIVEGD+ND  LL+KLFDIVPF
Sbjct  120  SLALKKRGDGVLGLDNFNSYYDPSLKRARQNLLSKHQIFIVEGDINDVELLNKLFDIVPF  179



>ref|XP_004247883.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Solanum lycopersicum]
Length=452

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK +KLERYNSYIRRVNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL  
Sbjct  5    MASPPDTSKTTKLERYNSYIRRVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL--  62

Query  246  SSGGGRRRALHTTGHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
            +S       +HTT H+LL+ A + GGA+WEKQV+ S+TP R NG+SVLVTGAAGFVGSHC
Sbjct  63   TSEKSFNNNIHTTTHNLLSSAIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVGSHC  122

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLALKKRGDGVLGLDNFN+YYDPSLKRARQ  L KHQIFIVEGD+ND  LL KLFDIVPF
Sbjct  123  SLALKKRGDGVLGLDNFNSYYDPSLKRARQDQLSKHQIFIVEGDINDTELLKKLFDIVPF  182



>ref|XP_006360928.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=448

 Score =   259 bits (663),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPL  
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPL--  58

Query  246  SSGGGRRRALHTTGHSLLAAT-FSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
            +S       +HTT H+LL++T + GGA+WEKQV+ S+TP R NG+SVLVTGAAGFVGSHC
Sbjct  59   TSEKTFNNNIHTTTHNLLSSTIYGGGASWEKQVRHSSTPHRPNGLSVLVTGAAGFVGSHC  118

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLALKKRGDGVLGLDNFN+YYDPSLKRARQ  L KHQIFIVEGD+ND  LL KLFDIVPF
Sbjct  119  SLALKKRGDGVLGLDNFNSYYDPSLKRARQDQLTKHQIFIVEGDINDTELLKKLFDIVPF  178



>ref|XP_009768456.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=450

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LIFFFTINYPPLA 
Sbjct  1    MASPPDTSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLIFFFTINYPPLA-  59

Query  246  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
            S        +HTT H+L+++ F  GGA+WEKQV+ S+TP R NG SVLVTGAAGFVGSH 
Sbjct  60   SDNPNSHNNIHTTTHNLISSAFYGGGASWEKQVRRSSTPSRPNGFSVLVTGAAGFVGSHS  119

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLALKKRGDGVLGLDNFN+YYDPSLKRARQ LL KHQIFIVEGDLND  LL KLFDIVPF
Sbjct  120  SLALKKRGDGVLGLDNFNSYYDPSLKRARQNLLSKHQIFIVEGDLNDVELLRKLFDIVPF  179



>ref|XP_010093344.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
 gb|EXB53916.1| UDP-glucuronate 4-epimerase 6 [Morus notabilis]
Length=454

 Score =   257 bits (657),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 152/182 (84%), Gaps = 5/182 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL+LI FFT+NYPPL+ 
Sbjct  1    MASPPDTSKTMKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALVLILFFTLNYPPLSS  60

Query  246  SSGG-GRRRALHTTGHSLLAATF--SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  416
            SS       + H   H+ L++ F   GGA WEKQV+ SATPRRQNG SVLVTGAAGFVGS
Sbjct  61   SSDTPNTHHSFHH--HNFLSSAFYGGGGATWEKQVRHSATPRRQNGFSVLVTGAAGFVGS  118

Query  417  HCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIV  596
            HCSLALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIV+GDLND PLL KLFD+V
Sbjct  119  HCSLALKKRGDGVLGLDNFNNYYDPSLKRARQALLSKHQIFIVDGDLNDGPLLYKLFDVV  178

Query  597  PF  602
            PF
Sbjct  179  PF  180



>ref|XP_010023657.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Eucalyptus grandis]
 gb|KCW59958.1| hypothetical protein EUGRSUZ_H02683 [Eucalyptus grandis]
Length=459

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 155/181 (86%), Gaps = 6/181 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPD+SK +KLERYNSYIRRVNS+KL+ ASSKLLFRATL++AL L+ FFT+NYPPL+ 
Sbjct  1    MAPPPDSSKTAKLERYNSYIRRVNSTKLLNASSKLLFRATLLIALALVLFFTLNYPPLSS  60

Query  246  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  419
            SS      A H    S L++TFS  GGAAWEKQV+ S+TPRR NG SVLVTGAAGFVGSH
Sbjct  61   SSTSDH--APHR--RSFLSSTFSSAGGAAWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSH  116

Query  420  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  599
            CSLALKKRGDGVLGLDNFN YYDPSLKRARQ LL+KHQIFIVEGDLND PLL+KLFD+VP
Sbjct  117  CSLALKKRGDGVLGLDNFNDYYDPSLKRARQALLQKHQIFIVEGDLNDGPLLTKLFDVVP  176

Query  600  F  602
            F
Sbjct  177  F  177



>ref|XP_004502237.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cicer arietinum]
Length=451

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 152/180 (84%), Gaps = 7/180 (4%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++ALIL+F FT NYPPL+E
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALILVFLFTFNYPPLSE  60

Query  246  SSGGGRRRALHTTGHS-LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
            ++       LHT  HS  LA+ F GG AWE+QV+ SATPRR NG SVLVTGAAGFVGSHC
Sbjct  61   TA----NHHLHT--HSNFLASAFGGGGAWERQVRHSATPRRPNGFSVLVTGAAGFVGSHC  114

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLALKKRGDGV+GLDNFN YYDPSLKRARQ LL +HQIFI EGDLND PLL+KLFD+VPF
Sbjct  115  SLALKKRGDGVVGLDNFNTYYDPSLKRARQALLTQHQIFIAEGDLNDTPLLTKLFDLVPF  174



>ref|XP_004297013.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 154/183 (84%), Gaps = 6/183 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RRVNS+KLI ASSKLLFR TL+VAL+LIFFFT+NYPPL+ 
Sbjct  3    MASPPDTSKTIKLERYNSYLRRVNSTKLINASSKLLFRVTLLVALVLIFFFTLNYPPLSS  62

Query  246  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  413
            SS       LH T  + L++ F     GG AWEKQV+ S+TP+R NGMSVLVTGAAGF+G
Sbjct  63   SSDQNGSHRLHNT--NFLSSAFYGGGVGGTAWEKQVRHSSTPKRPNGMSVLVTGAAGFIG  120

Query  414  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  593
            SHCSLALKKRGDGVLGLDNFN+YYDPSLKRARQ +L+KH+IFIVE DLND P+L+KLFD+
Sbjct  121  SHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQAMLKKHEIFIVEADLNDGPMLTKLFDV  180

Query  594  VPF  602
            VPF
Sbjct  181  VPF  183



>ref|XP_010274074.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=456

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 153/179 (85%), Gaps = 2/179 (1%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK +KLERYNSY+RRVNS+KL+AASSKLLFR TL+VALILIFFFT+N+PPL  
Sbjct  1    MASPPDTSKTTKLERYNSYLRRVNSTKLLAASSKLLFRVTLLVALILIFFFTLNHPPL--  58

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
            SS       LH   + L +A +  GA WEKQV+ S+TPRR NG SVLVTGAAGFVG+HCS
Sbjct  59   SSDSPNHVPLHHHQNFLASAFYGNGATWEKQVRHSSTPRRSNGFSVLVTGAAGFVGTHCS  118

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LALKKRGDGVLGLDNFN+YYDPSLKRARQ LL KH+IFIV+GDLNDAPLLSKLFD+VPF
Sbjct  119  LALKKRGDGVLGLDNFNSYYDPSLKRARQALLSKHEIFIVKGDLNDAPLLSKLFDVVPF  177



>ref|XP_002265088.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Vitis vinifera]
Length=451

 Score =   254 bits (650),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 153/181 (85%), Gaps = 9/181 (5%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSD  60

Query  246  SSGGGRRRALHTTGHS--LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  419
            +         H   H   L +A +  GA+WEKQV+ S+TPRR NG SVLVTGA GFVG+H
Sbjct  61   NPH-------HVLTHQNFLSSAFYGSGASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTH  113

Query  420  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  599
            CSLALKKRGDGVLGLDNFN YYDPSLKRARQ +L KHQIFIVEGDLNDAPLLSKLFD+VP
Sbjct  114  CSLALKKRGDGVLGLDNFNDYYDPSLKRARQAMLSKHQIFIVEGDLNDAPLLSKLFDMVP  173

Query  600  F  602
            F
Sbjct  174  F  174



>ref|XP_003601662.1| UDP-D-glucuronic acid 4-epimerase [Medicago truncatula]
 gb|AES71913.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=447

 Score =   254 bits (648),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 151/179 (84%), Gaps = 5/179 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
            S+        HT  H L +A F GG AWE+ V+ SA PRR NG +VLVTGAAGFVGSHCS
Sbjct  61   ST----NHHFHTHSHFLTSA-FGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSHCS  115

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LALKKRGDGV+GLDNFN+YYDPSLKRARQ LL +HQIFIVEGDLNDAPLL+KLFD+VP 
Sbjct  116  LALKKRGDGVIGLDNFNSYYDPSLKRARQALLTQHQIFIVEGDLNDAPLLTKLFDVVPI  174



>gb|AFK49564.1| unknown [Medicago truncatula]
Length=447

 Score =   254 bits (648),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 151/178 (85%), Gaps = 5/178 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
            S+        HT  H L +A F GG AWE+ V+ SA PRR NG +VLVTGAAGFVGSHCS
Sbjct  61   ST----NHHFHTHSHFLTSA-FGGGGAWERHVRHSAIPRRPNGFTVLVTGAAGFVGSHCS  115

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  599
            LALKKRGDGV+GLDNFN+YYDPSLKRARQ LL +HQIFIVEGDLNDAPLL+KLFD+VP
Sbjct  116  LALKKRGDGVIGLDNFNSYYDPSLKRARQALLTQHQIFIVEGDLNDAPLLTKLFDVVP  173



>ref|XP_004138968.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 ref|XP_004166629.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Cucumis sativus]
 gb|KGN61492.1| hypothetical protein Csa_2G146400 [Cucumis sativus]
Length=463

 Score =   254 bits (649),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 154/183 (84%), Gaps = 5/183 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+R+VNS+KLI ASSKLLFRATL+VAL+L+F FT+NYPPL+ 
Sbjct  4    MASPPDTSKTLKLERYNSYLRKVNSTKLINASSKLLFRATLLVALVLVFIFTLNYPPLS-  62

Query  246  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  413
            S  G     LHT  + L +A +     GGAAWEKQV+ S+TPRR NGMSVLVTGAAGFVG
Sbjct  63   SENGSSGNHLHTHRNFLSSAFYGGSDQGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFVG  122

Query  414  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  593
            SHCS+ALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIVEGDLNDA LLSKLFD+
Sbjct  123  SHCSMALKKRGDGVLGLDNFNNYYDPSLKRARQSLLLKHQIFIVEGDLNDAALLSKLFDV  182

Query  594  VPF  602
            VPF
Sbjct  183  VPF  185



>emb|CAN83418.1| hypothetical protein VITISV_041351 [Vitis vinifera]
Length=459

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 153/181 (85%), Gaps = 9/181 (5%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK +KLERYNSYIRRVNS+KL+AASSKLLFRATL+VAL+LIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYIRRVNSTKLMAASSKLLFRATLLVALVLIFFFTLNYPPLSD  60

Query  246  SSGGGRRRALHTTGHS--LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  419
            +         H   H   L +A +  GA+WEKQV+ S+TPRR NG SVLVTGA GFVG+H
Sbjct  61   NPH-------HVLTHQNFLSSAFYGSGASWEKQVRHSSTPRRPNGFSVLVTGAGGFVGTH  113

Query  420  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  599
            CSLALKKRGDGVLGLDNFN YYDPSLKRARQ +L KHQIFIVEGDLNDAPLLSKLFD+VP
Sbjct  114  CSLALKKRGDGVLGLDNFNDYYDPSLKRARQAMLSKHQIFIVEGDLNDAPLLSKLFDMVP  173

Query  600  F  602
            F
Sbjct  174  F  174



>ref|XP_008457221.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Cucumis melo]
Length=453

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 156/184 (85%), Gaps = 7/184 (4%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL-A  242
            MA PPDTSK  KLERYNSY+R+VNS+KL+ ASSKLLFRATL+VAL+L+F FT+NYPPL A
Sbjct  4    MASPPDTSKTLKLERYNSYLRKVNSTKLLNASSKLLFRATLLVALVLVFIFTLNYPPLSA  63

Query  243  ESSGGGRRRALHTTGHSLLAATFSG----GAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  410
            E++  G    LHT  + L +A + G    GAAWEKQV+ S+TPRR NGMSVLVTGAAGFV
Sbjct  64   ENASPGNH--LHTHRNFLSSAFYGGSDHGGAAWEKQVRHSSTPRRLNGMSVLVTGAAGFV  121

Query  411  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  590
            GSHCS+ALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIVEGDLNDA LLSKLFD
Sbjct  122  GSHCSMALKKRGDGVLGLDNFNNYYDPSLKRARQSLLLKHQIFIVEGDLNDAALLSKLFD  181

Query  591  IVPF  602
            +VPF
Sbjct  182  VVPF  185



>ref|XP_010243459.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nelumbo nucifera]
Length=455

 Score =   249 bits (636),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 151/180 (84%), Gaps = 5/180 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK +KLERYNSY+RRVNS+K +AASSKLLFR TL+VALILIFFFT+NYPPL++
Sbjct  1    MASPPDTSKTTKLERYNSYLRRVNSTKFLAASSKLLFRVTLLVALILIFFFTLNYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
            +              + +A+ F G GA WEK+V+ S+TPRR NG SVLVTGAAGFVG+HC
Sbjct  61   NP----HHVHLHHHQNFIASAFYGNGATWEKKVRHSSTPRRPNGFSVLVTGAAGFVGTHC  116

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +LALKKRGDGVLGLDNFN+YYDPSLKRARQ LL KHQIF+VE DLNDAPLLSKLFD+VPF
Sbjct  117  ALALKKRGDGVLGLDNFNSYYDPSLKRARQSLLSKHQIFVVEADLNDAPLLSKLFDVVPF  176



>dbj|BAE71216.1| putative NAD dependent epimerase [Trifolium pratense]
Length=451

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 148/179 (83%), Gaps = 5/179 (3%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSYIR+VNS+KL+ ASSKLLFRATL++AL+L+FFFT NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYIRKVNSTKLLNASSKLLFRATLLIALVLVFFFTFNYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
            ++          T    L + F GG AWE+QV+ SATPRR NG +VLVTGAAGFVGSHCS
Sbjct  61   TT-----SHHFHTHSHFLTSAFGGGGAWERQVRHSATPRRPNGFTVLVTGAAGFVGSHCS  115

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LALKKRGDGV+GLDNFN YYDPSLKRARQ LL +HQIFIVEGDLND PLLSKLFD+VP 
Sbjct  116  LALKKRGDGVIGLDNFNNYYDPSLKRARQDLLSQHQIFIVEGDLNDGPLLSKLFDVVPI  174



>gb|KDO42082.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=469

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 161/194 (83%), Gaps = 15/194 (8%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  246  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  380
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  381  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLN  560
            VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+YYDPSLKRARQKLL+KHQ+FIVEGDLN
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQKLLQKHQVFIVEGDLN  180

Query  561  DAPLLSKLFDIVPF  602
            DAPLL+KLFD+VPF
Sbjct  181  DAPLLTKLFDVVPF  194



>ref|XP_006421024.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
 gb|ESR34264.1| hypothetical protein CICLE_v10004881mg [Citrus clementina]
Length=476

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 161/194 (83%), Gaps = 15/194 (8%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  246  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  380
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  381  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLN  560
            VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+YYDPSLKRARQKLL+KHQ+FIVEGDLN
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQKLLQKHQVFIVEGDLN  180

Query  561  DAPLLSKLFDIVPF  602
            DAPLL+KLFD+VPF
Sbjct  181  DAPLLTKLFDVVPF  194



>ref|XP_006492536.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Citrus sinensis]
 gb|KDO42081.1| hypothetical protein CISIN_1g011841mg [Citrus sinensis]
Length=476

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 161/194 (83%), Gaps = 15/194 (8%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RR++ +K++ +SSKL FRAT+++AL+LI FFT+N+PPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHVTKMLHSSSKLFFRATILIALVLILFFTLNHPPLSD  60

Query  246  SSGGG---------RRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMS  380
            ++G             R L T  HSLL+++F      +GGA WEKQV+ SATPRR NGM+
Sbjct  61   NTGESGDNNSNNKNNPRNLFTHQHSLLSSSFFSSSFSTGGAEWEKQVRHSATPRRPNGMT  120

Query  381  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLN  560
            VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN+YYDPSLKRARQKLL+KHQ+FIVEGDLN
Sbjct  121  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNSYYDPSLKRARQKLLQKHQVFIVEGDLN  180

Query  561  DAPLLSKLFDIVPF  602
            DAPLL+KLFD+VPF
Sbjct  181  DAPLLTKLFDVVPF  194



>gb|KDP39331.1| hypothetical protein JCGZ_01088 [Jatropha curcas]
Length=458

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 154/185 (83%), Gaps = 9/185 (5%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFTINYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRIHSTKVLNASSKLLFRATLLIALVLILFFTINYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATF------SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGF  407
            +      +  H   H+ L+  F       GG+AWEKQV+ SATPRR NG SVLVTGAAGF
Sbjct  61   NP---HHQNHHIHHHNFLSTAFFARSSSVGGSAWEKQVRHSATPRRPNGFSVLVTGAAGF  117

Query  408  VGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLF  587
            VGSHCSLALKKRGDGVLG+DNFN YYDPSLKRARQKLL KHQ+FI+EGD+ND+PLLSKLF
Sbjct  118  VGSHCSLALKKRGDGVLGIDNFNDYYDPSLKRARQKLLSKHQVFIIEGDINDSPLLSKLF  177

Query  588  DIVPF  602
            D+VPF
Sbjct  178  DVVPF  182



>ref|XP_011003624.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   246 bits (629),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 155/183 (85%), Gaps = 8/183 (4%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATF----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVG  413
            +         H   H+ L+  F    +GGAAWEKQV+ S+TP+R+NG+SVLVTGAAGFVG
Sbjct  61   NI----PNHAHPPHHNFLSTAFFTSSAGGAAWEKQVRHSSTPKRRNGLSVLVTGAAGFVG  116

Query  414  SHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDI  593
            SHCSLALKKRGDGVLGLDNFN+YYDP+LKRARQKLL +H++FIVEGDLNDA LL KLFD+
Sbjct  117  SHCSLALKKRGDGVLGLDNFNSYYDPTLKRARQKLLLRHEVFIVEGDLNDASLLRKLFDV  176

Query  594  VPF  602
            VPF
Sbjct  177  VPF  179



>ref|XP_002298679.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
 gb|ABK93061.1| unknown [Populus trichocarpa]
 gb|EEE83484.1| UDP-D-GLUCURONATE 4-EPIMERASE 6 family protein [Populus trichocarpa]
Length=457

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 154/184 (84%), Gaps = 9/184 (5%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK  KLERYNSY+RR++S+K++ ASSKLLFRATL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPDTSKTIKLERYNSYLRRLHSTKVLNASSKLLFRATLLIALVLILFFTLNYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATF-----SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  410
            +         H   H+ L+  F      GGAAWEKQV+ S+TP+R+NG+SVLVTGAAGFV
Sbjct  61   NI----PNHAHLHHHNFLSTAFFTSSAGGGAAWEKQVRHSSTPKRRNGLSVLVTGAAGFV  116

Query  411  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  590
            GSHCSLALKKRGDGVLGLDNFN+YYDP+LKRARQKLL +H++FIVEGDLNDA LL KLFD
Sbjct  117  GSHCSLALKKRGDGVLGLDNFNSYYDPTLKRARQKLLLRHEVFIVEGDLNDASLLRKLFD  176

Query  591  IVPF  602
            +VPF
Sbjct  177  VVPF  180



>ref|XP_006349916.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=454

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 2/178 (1%)
 Frame = +3

Query  75   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  254
            P DTSK  KLERYNSYIRR+NS+KLI ASSKLLFR TL+VALILIFFF INYPP   S  
Sbjct  5    PIDTSKEMKLERYNSYIRRLNSTKLIVASSKLLFRVTLLVALILIFFFIINYPPFTSSEN  64

Query  255  GG-RRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  428
                   +HTT H+LL+++F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHCS+
Sbjct  65   SNPHHHNIHTTTHNLLSSSFYGGGAAWEKQVRHSSTPRRVNGLSVLVTGAAGFVGSHCSM  124

Query  429  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            ALKKRGDGVLG+DNFN+YYDPSLKR RQKLL +H++FIVEGD+NDA LLSKLFDIVPF
Sbjct  125  ALKKRGDGVLGIDNFNSYYDPSLKRGRQKLLAQHEVFIVEGDINDAELLSKLFDIVPF  182



>ref|XP_009783247.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana sylvestris]
Length=453

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA   DTSK  KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL  
Sbjct  1    MASSLDTSKVMKLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL--  58

Query  246  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
            SS       +HTT H+LL++ F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHC
Sbjct  59   SSENTSHHHIHTTTHNLLSSAFYGGGAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHC  118

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            S+ALKKRGDGVLG+DNFN+YYDPSLKR RQKLL +H+IFIVEGD+NDA LLSKLFDIVPF
Sbjct  119  SMALKKRGDGVLGIDNFNSYYDPSLKRGRQKLLAQHEIFIVEGDINDAELLSKLFDIVPF  178



>ref|XP_007034225.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
 gb|EOY05151.1| UDP-D-glucuronate 4-epimerase 6 [Theobroma cacao]
Length=453

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            M  PPDTSK  KLERYNSY+R+++S+KL+ ASSKLLFR TL++AL+LI FFTINYPPL++
Sbjct  1    MPTPPDTSKTVKLERYNSYLRKLHSTKLLNASSKLLFRVTLLIALVLILFFTINYPPLSD  60

Query  246  SSGGGRRRALHTTGHSL-LAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
            +         H +  S  L +   GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHC
Sbjct  61   NPHHVPPHQHHHSFLSTSLFSISPGGAAWEKQVRHSSTPRRPNGFSVLVTGAAGFIGSHC  120

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIVEGDLND PLL+KLFD+VPF
Sbjct  121  SLALKKRGDGVLGLDNFNNYYDPSLKRARQNLLSKHQIFIVEGDLNDGPLLTKLFDVVPF  180



>gb|KJB28115.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=409

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = +3

Query  72   FPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  251
             P DTSK  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++
Sbjct  1    MPTDTSKPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNT  60

Query  252  GGGRRRALHTT--GHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
                      +    SL + ++  GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHC
Sbjct  61   HSAPHHHHRHSFLSTSLFSGSSLVGGAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHC  120

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIVEGDLND PLL+KLFD+VPF
Sbjct  121  SLALKKRGDGVLGLDNFNDYYDPSLKRARQNLLSKHQIFIVEGDLNDGPLLTKLFDVVPF  180



>gb|ADB24770.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB28114.1| hypothetical protein B456_005G028000 [Gossypium raimondii]
Length=453

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 147/179 (82%), Gaps = 3/179 (2%)
 Frame = +3

Query  75   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  254
            P DTSK  KLERYNSYIR+V+S+KL+ ASSK LFR TL++AL+LI FFTINYPPL++++ 
Sbjct  2    PTDTSKPMKLERYNSYIRKVHSTKLLNASSKFLFRVTLLIALVLILFFTINYPPLSDNTH  61

Query  255  GGRRRALHTT--GHSLLA-ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
                     +    SL + ++  GGAAWEKQV+ S+TPRR NG SVLVTGAAGF+GSHCS
Sbjct  62   SAPHHHHRHSFLSTSLFSGSSLVGGAAWEKQVRHSSTPRRVNGFSVLVTGAAGFIGSHCS  121

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQIFIVEGDLND PLL+KLFD+VPF
Sbjct  122  LALKKRGDGVLGLDNFNDYYDPSLKRARQNLLSKHQIFIVEGDLNDGPLLTKLFDVVPF  180



>ref|XP_009616292.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Nicotiana tomentosiformis]
Length=453

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 154/180 (86%), Gaps = 3/180 (2%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA   DTSK  KLERYNSYIRRVNSSKLIAASSKLLFR TL+VAL+LIFFFTINY PL  
Sbjct  1    MASSLDTSKVMKLERYNSYIRRVNSSKLIAASSKLLFRVTLLVALLLIFFFTINYHPL--  58

Query  246  SSGGGRRRALHTTGHSLLAATF-SGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
            +S       +HTT HSLL++ F  GGAAWEKQV+ S+TPRR NG+SVLVTGAAGFVGSHC
Sbjct  59   NSENTPHHHIHTTTHSLLSSAFYGGGAAWEKQVRHSSTPRRANGLSVLVTGAAGFVGSHC  118

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            S+ALKKRGDGVLG+DNFN+YYDP LKR RQKLL +H+IFIVEGD+NDA LLSKLFDIVPF
Sbjct  119  SMALKKRGDGVLGIDNFNSYYDPLLKRGRQKLLAQHEIFIVEGDINDAELLSKLFDIVPF  178



>ref|XP_007163818.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
 gb|ESW35812.1| hypothetical protein PHAVU_001G267000g [Phaseolus vulgaris]
Length=437

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  261  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  440
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  441  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            RGDGVLGLDNFNAYYDPSLKRARQ +L KHQ+FIVEGDLND PLL KLFD+V F
Sbjct  114  RGDGVLGLDNFNAYYDPSLKRARQAMLAKHQVFIVEGDLNDTPLLQKLFDVVAF  167



>gb|AGV54436.1| UDP-D-glucuronic acid 4-epimerase [Phaseolus vulgaris]
Length=437

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  261  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  440
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  441  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            RGDGVLGLDNFNAYYDPSLKRARQ +L KHQ+FIVEGDLND PLL KLFD+V F
Sbjct  114  RGDGVLGLDNFNAYYDPSLKRARQAMLAKHQVFIVEGDLNDTPLLQKLFDVVAF  167



>ref|XP_006373087.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
 gb|ERP50884.1| hypothetical protein POPTR_0017s08580g [Populus trichocarpa]
Length=462

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PP TSK  KLERYNSY+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPHTSKTLKLERYNSYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
             +        H    + L  + +GG AWEKQV+ S+TP++ NG+SVLVTGAAGFVGSHCS
Sbjct  61   KNPNHAHLHHHNFLSAALFTSSAGGDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCS  120

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +ALKKRGDGVLGLDNFN+YYDPSLKRARQKLL K+Q+FIVEGDLNDA LL+KLFD+VPF
Sbjct  121  IALKKRGDGVLGLDNFNSYYDPSLKRARQKLLLKNQVFIVEGDLNDASLLTKLFDVVPF  179



>ref|XP_011042175.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
 ref|XP_011016239.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Populus euphratica]
Length=456

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PP TSK  KLERYN+Y+RR++S+K++ ASSKL+FR TL++AL+LI FFT+NYPPL++
Sbjct  1    MASPPHTSKTLKLERYNNYLRRLHSTKVLNASSKLIFRVTLLIALVLILFFTLNYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
             +        H    + L  + +GG AWEKQV+ S+TP++ NG+SVLVTGAAGFVGSHCS
Sbjct  61   KNPNHAHLHHHNFLSAALFTSSAGGDAWEKQVRHSSTPKKPNGLSVLVTGAAGFVGSHCS  120

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +ALKKRGDGVLGLDNFN+YYDPSLKRARQKLL K+Q+FIVEGDLNDA LL+KLFD+VPF
Sbjct  121  IALKKRGDGVLGLDNFNSYYDPSLKRARQKLLLKNQVFIVEGDLNDASLLTKLFDVVPF  179



>gb|AHA84281.1| UDP-glucuronate 4-epimerase 6 [Phaseolus vulgaris]
Length=444

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            +TSK+ KLERYNSYIRRVNS+KL+ ASSKLLFRATL+VALIL+F FT NYPPLA+S+   
Sbjct  2    ETSKSMKLERYNSYIRRVNSTKLLNASSKLLFRATLLVALILVFLFTFNYPPLADST---  58

Query  261  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  440
              R LH   H  L++ F    AWEKQ++ S+TPRR NG++VLVTGAAGFVGSHCSLALK+
Sbjct  59   -HRHLHAHSH-FLSSAF---GAWEKQLRHSSTPRRPNGLTVLVTGAAGFVGSHCSLALKR  113

Query  441  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            RGDGVLGLDNFNAYYDPSLKRARQ +L KHQ+FIVEGDLND PLL KLFD+V F
Sbjct  114  RGDGVLGLDNFNAYYDPSLKRARQAMLAKHQVFIVEGDLNDTPLLQKLFDVVAF  167



>emb|CDP21869.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 134/177 (76%), Positives = 152/177 (86%), Gaps = 6/177 (3%)
 Frame = +3

Query  75   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  254
            PPD SK +KLERYNSYIR+VNS+KLIAASSKLLFR TL+VAL+LI FFT+NYPPL+E+  
Sbjct  6    PPDFSKTTKLERYNSYIRKVNSTKLIAASSKLLFRVTLLVALLLILFFTLNYPPLSENP-  64

Query  255  GGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLA  431
                  +H T H+L ++ F G GA WEK+V+ SATPRR NG+SVLVTGAAGFVGSHCSLA
Sbjct  65   ----HHIHHTTHNLFSSAFYGSGAGWEKKVRHSATPRRPNGLSVLVTGAAGFVGSHCSLA  120

Query  432  LKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKKRGDGVLGLDNFN+YYDPSLKRAR+ LL KHQIF+VEGDLNDA LL KLFDIVPF
Sbjct  121  LKKRGDGVLGLDNFNSYYDPSLKRARRDLLTKHQIFVVEGDLNDAELLEKLFDIVPF  177



>ref|XP_003538527.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=462

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 146/176 (83%), Gaps = 4/176 (2%)
 Frame = +3

Query  75   PPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  254
            PPDTSK+ KLERYNSYIRR+NS+KL+ ASSKLLFRAT++VALIL+F FT NYPPLA    
Sbjct  20   PPDTSKSIKLERYNSYIRRLNSTKLLNASSKLLFRATILVALILVFLFTFNYPPLAPDF-  78

Query  255  GGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  434
                   H   HS   ++ S  A+WEKQV+ S+TPRR NG++VLVTGAAGFVGSHCSLAL
Sbjct  79   ---TSHRHLHSHSHFLSSSSSFASWEKQVRHSSTPRRPNGLTVLVTGAAGFVGSHCSLAL  135

Query  435  KKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            KKRGDGVLGLDNFN+YYDPSLKR+RQ +L KHQ+FIVEGDLND PLL KLFD+VPF
Sbjct  136  KKRGDGVLGLDNFNSYYDPSLKRSRQAMLWKHQVFIVEGDLNDTPLLEKLFDVVPF  191



>gb|KJB72008.1| hypothetical protein B456_011G153500 [Gossypium raimondii]
Length=454

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 147/181 (81%), Gaps = 2/181 (1%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            M  PPDTSK  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL++
Sbjct  1    MPTPPDTSKTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  419
            +               L  + FS  GGAAWEKQV+ S+TPRR NG SVLVTGA GFVGSH
Sbjct  61   TPHHVPPHHRLHHHSLLSTSLFSAGGGAAWEKQVRLSSTPRRTNGFSVLVTGAGGFVGSH  120

Query  420  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  599
            CSLALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQ+FIVEGDLND PLL+KLFD+VP
Sbjct  121  CSLALKKRGDGVLGLDNFNNYYDPSLKRARQNLLSKHQVFIVEGDLNDGPLLTKLFDVVP  180

Query  600  F  602
            F
Sbjct  181  F  181



>gb|ADB24769.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=454

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            M  PPDTSK  KLERYN+Y+R+++S+KLI ASSKLLFRATL++ALILI FFTINYPPL++
Sbjct  1    MPTPPDTSKTLKLERYNNYLRKIHSTKLITASSKLLFRATLLIALILILFFTINYPPLSD  60

Query  246  SSGGGRRRALHTTGHSLLAATFS--GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  419
            +               L  + FS  GGAAWEKQV+ S+TPRR NG SVLVTGAAGFVGSH
Sbjct  61   TPHHVPPHHRLHHHSLLSTSLFSAGGGAAWEKQVRLSSTPRRTNGFSVLVTGAAGFVGSH  120

Query  420  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  599
            CSLALKKRGDGVLGLDNFN YYDPSLKRARQ LL KHQ+FIV+GDLND PLL+KLFD+VP
Sbjct  121  CSLALKKRGDGVLGLDNFNNYYDPSLKRARQNLLSKHQVFIVKGDLNDGPLLTKLFDVVP  180

Query  600  F  602
            F
Sbjct  181  F  181



>ref|XP_009408344.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK +KLER N+Y+RRVNS+K+I+ASS+LLFRA+++  + LI  FT++YPPL  
Sbjct  1    MASPPDTSKTAKLERCNNYLRRVNSAKIISASSRLLFRASILATVALILLFTLHYPPLLL  60

Query  246  SSGGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
             S      A  ++  SLL++  + GGAAWE++V+SSATPRR +G++VLVTGAAGFVG+HC
Sbjct  61   LSHYSANAAARSSHRSLLSSDVTYGGAAWEREVRSSATPRRPSGLTVLVTGAAGFVGTHC  120

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLALKKRGDGV+GLDNFN+YYDPSLKRARQ LL +H + +V+GD+ND PLL+KL D+VPF
Sbjct  121  SLALKKRGDGVVGLDNFNSYYDPSLKRARQSLLSRHGVLVVDGDINDTPLLTKLLDVVPF  180



>ref|XP_008794651.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Phoenix dactylifera]
Length=468

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 143/179 (80%), Gaps = 1/179 (1%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPDTSK +KLERYNSYIRRVNS+KL+AAS+ LLFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPPPDTSKTTKLERYNSYIRRVNSTKLLAASTNLLFRATLLTAVVLILLFTLHYPPLLA  60

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
                    A H+    L + +  GGA WE++V+ SATPRR+ G+SVLVTGAAGFVG+HCS
Sbjct  61   GHHPSAASA-HSHRSLLSSYSSYGGATWEREVRRSATPRRRGGLSVLVTGAAGFVGTHCS  119

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LALK RGDGVLGLDNFN+YYDPSLKR+RQKLL  H I +++ D+ND+ LL KLFD+VPF
Sbjct  120  LALKXRGDGVLGLDNFNSYYDPSLKRSRQKLLSHHGILVIDADINDSKLLIKLFDVVPF  178



>ref|XP_010532756.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Tarenaya hassleriana]
Length=458

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 148/178 (83%), Gaps = 5/178 (3%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++SSK+I ASSKLLFRATL+VAL+L+  F +NYPPL+ SS   
Sbjct  8    DTSKTVKLERYNSYLRKIHSSKIINASSKLLFRATLLVALLLVLVFAVNYPPLSFSSSSD  67

Query  261  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  428
                 RR+  +TG    +++  GGAAWEK+V+ S+ PRR NG SVLVTGAAGFVGSHCS+
Sbjct  68   NHRLHRRSFLSTG-IFSSSSLGGGAAWEKRVRLSSAPRRPNGFSVLVTGAAGFVGSHCSI  126

Query  429  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            ALKKRGDGVLGLDNFN YYDPSLKRARQ LLEKHQ+FIVEGDLND PLL+KLFD+VPF
Sbjct  127  ALKKRGDGVLGLDNFNDYYDPSLKRARQNLLEKHQVFIVEGDLNDGPLLTKLFDVVPF  184



>ref|XP_010905148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=463

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 13/184 (7%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA PPD SK +KLERYNSY+RRVNS+KL+AASS +LFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPPPDNSKTTKLERYNSYLRRVNSTKLLAASSNILFRATLLTAVVLILLFTLHYPPLLA  60

Query  246  SSGGGRRRALHTTGHS-----LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFV  410
                      H   HS       +++  GGAAWE++V+ SATP R  G+ VLVTGAAGFV
Sbjct  61   GH--------HPPAHSHRSLLSPSSSSYGGAAWEREVRRSATPHRPGGLFVLVTGAAGFV  112

Query  411  GSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFD  590
            G+HCSLALKKRGDGVLGLDNFN+YYDPSLKR+RQ LL +H I +++ D+ND+ LL KLFD
Sbjct  113  GTHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQNLLSRHGILVIDADINDSNLLIKLFD  172

Query  591  IVPF  602
            +VPF
Sbjct  173  VVPF  176



>ref|XP_010906178.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Elaeis guineensis]
Length=467

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA  PDTSK +KLERYNSY+RRVN++KL+A +S LLFRATL+ A++LI  FT++YPPL  
Sbjct  1    MAPLPDTSKTTKLERYNSYLRRVNTTKLLATTSNLLFRATLLTAVVLILLFTLHYPPLLA  60

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
                    A          ++  GGAAWE+ V+ SATPR   G+SVLVTGAAGFVG+HCS
Sbjct  61   GHHLSPTSAHSHRSLLSSPSSSYGGAAWERNVRRSATPRHPGGLSVLVTGAAGFVGTHCS  120

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LALKKRGDGVLGLDNFN+YYDPSLKR+RQ LL +H I +++ D+ND+ LL KLFD+VPF
Sbjct  121  LALKKRGDGVLGLDNFNSYYDPSLKRSRQNLLSRHGILVLDADINDSDLLIKLFDVVPF  179



>ref|XP_010673389.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Beta vulgaris subsp. 
vulgaris]
Length=449

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 145/179 (81%), Gaps = 2/179 (1%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA   D SK++KLERYNSY+RRVN++KL+AASSKLLFRATL+VAL+L+FFFT+NYP    
Sbjct  1    MALSSDLSKSTKLERYNSYLRRVNNTKLLAASSKLLFRATLLVALLLVFFFTLNYP--IT  58

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
             +      ++HTT     +  +  GA WEKQV+ S+TPRR NG S+LVTGAAGFVG+HCS
Sbjct  59   GNDAQNNASIHTTSRFFSSGFYGSGATWEKQVRQSSTPRRPNGFSILVTGAAGFVGTHCS  118

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +ALKKRGDGVLGLDNFN YYDPSLKRARQKLL + QIFIVE DLND P+L KLFDIVPF
Sbjct  119  IALKKRGDGVLGLDNFNRYYDPSLKRARQKLLSRQQIFIVEADLNDNPMLMKLFDIVPF  177



>ref|XP_010527460.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 6-like 
[Tarenaya hassleriana]
Length=460

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 144/180 (80%), Gaps = 6/180 (3%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K+I ASSKLLFRATL++AL+L+  FT+NYPPL+ S+  G
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVINASSKLLFRATLLIALVLVLIFTLNYPPLSSSTDAG  67

Query  261  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
                 RR+  +TG   S  AA+  GG AWEK+       +  NG SVLVTGAAGFVGSHC
Sbjct  68   GHRVHRRSFLSTGIFSSSDAASLGGGPAWEKRXXXXXNXQYPNGFSVLVTGAAGFVGSHC  127

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            S+ALKKRGDGVLG DNFN YYDPSLKRARQKLL+KHQ+FIVEGDLND PLL+KLFD+VPF
Sbjct  128  SIALKKRGDGVLGFDNFNDYYDPSLKRARQKLLDKHQVFIVEGDLNDGPLLAKLFDVVPF  187



>ref|NP_189024.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 sp|Q9LIS3.1|GAE6_ARATH RecName: Full=UDP-glucuronate 4-epimerase 6; AltName: Full=UDP-glucuronic 
acid epimerase 6; Short=AtUGlcAE2 [Arabidopsis 
thaliana]
 gb|AAK44025.1|AF370210_1 putative NAD dependent epimerase [Arabidopsis thaliana]
 dbj|BAB03000.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07003.1| AT3g23820/F14O13_1 [Arabidopsis thaliana]
 gb|AAL32703.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM91705.1| putative NAD dependent epimerase [Arabidopsis thaliana]
 emb|CAI53858.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|AEE76818.1| UDP-D-glucuronate 4-epimerase 6 [Arabidopsis thaliana]
 gb|AFI41201.1| UDP-D-glucuronate 4-epimerase 6, partial [Arabidopsis thaliana]
Length=460

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 148/180 (82%), Gaps = 6/180 (3%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLIFAINYPPLSDSRAAA  67

Query  261  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
                 RR+  +TG   S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHC
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHC  127

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLAL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK Q+FIVEGDLND PLL KLFD+VPF
Sbjct  128  SLALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKQQVFIVEGDLNDGPLLRKLFDVVPF  187



>gb|AAN60250.1| unknown [Arabidopsis thaliana]
Length=460

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 147/180 (82%), Gaps = 6/180 (3%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKXLFRATLLVALVLVLIFAINYPPLSDSRAAA  67

Query  261  ----RRRALHTTG--HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
                 RR+  +TG   S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSHC
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHC  127

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLAL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK Q+FIVEGDLND PLL KLFD+VPF
Sbjct  128  SLALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKQQVFIVEGDLNDGPLLRKLFDVVPF  187



>ref|XP_002883465.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59724.1| hypothetical protein ARALYDRAFT_898926 [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 148/181 (82%), Gaps = 7/181 (4%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  261  ----RRRALHTTG---HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  419
                 RR+  +TG    S  +++  GGAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSSIGGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSH  127

Query  420  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  599
            CSLAL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK Q+FIVEGDLND PLL KLFD+VP
Sbjct  128  CSLALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKQQVFIVEGDLNDGPLLRKLFDVVP  187

Query  600  F  602
            F
Sbjct  188  F  188



>ref|XP_006297629.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
 gb|EOA30527.1| hypothetical protein CARUB_v10013650mg [Capsella rubella]
Length=462

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 147/182 (81%), Gaps = 8/182 (4%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  261  ----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  416
                 RR+  +TG     S  +++  GGAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGS
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGS  127

Query  417  HCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIV  596
            HCSL L+KRGDGVLG DNFN YYDP+LKRARQ LLEK Q+FIVEGDLND PLL KLFD+V
Sbjct  128  HCSLYLRKRGDGVLGFDNFNDYYDPALKRARQALLEKQQVFIVEGDLNDGPLLRKLFDVV  187

Query  597  PF  602
            PF
Sbjct  188  PF  189



>gb|KFK39681.1| hypothetical protein AALP_AA3G275400 [Arabis alpina]
Length=458

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 144/178 (81%), Gaps = 4/178 (2%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSDSRAAA  67

Query  261  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  428
                 RR+  +TG    +++   GAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH SL
Sbjct  68   AHHLHRRSFLSTGIFSSSSSLGEGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSHASL  127

Query  429  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            AL+KRGDGVLG DNFN YYDPSLKRARQ LLEK Q+FIVEGDLND PLL KLFD+VPF
Sbjct  128  ALRKRGDGVLGFDNFNDYYDPSLKRARQDLLEKQQVFIVEGDLNDGPLLRKLFDVVPF  185



>ref|XP_010421811.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=372

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 147/189 (78%), Gaps = 10/189 (5%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  246  SSGGG----RRRALHTTG------HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTG  395
            S         RR+  +TG       S  +++  GGAAWEK+V+ S+T +R  G+SVLVTG
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTG  122

Query  396  AAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLL  575
            AAGFVGSHCSL L+KRGDGVLG DNFN YYDP+LKRARQ LLEK Q+FIVEGDLND PLL
Sbjct  123  AAGFVGSHCSLYLRKRGDGVLGFDNFNDYYDPALKRARQALLEKQQVFIVEGDLNDGPLL  182

Query  576  SKLFDIVPF  602
             KLFD+VPF
Sbjct  183  RKLFDVVPF  191



>ref|XP_009106288.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=460

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 148/179 (83%), Gaps = 5/179 (3%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSAA  68

Query  261  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +AL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK+Q+FIVEGDLND PLL KLFD+VPF
Sbjct  129  IALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKNQVFIVEGDLNDGPLLRKLFDVVPF  187



>ref|XP_009102574.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Brassica rapa]
Length=454

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 144/174 (83%), Gaps = 0/174 (0%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHLH  67

Query  261  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  440
            RR  L T   S  +++   GAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+K
Sbjct  68   RRSFLSTGLFSSSSSSLGEGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRK  127

Query  441  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            RGDGVLG DNFN YYDPSLKRARQ LLEK+Q+FIVEGDLND PLL KLFDIVPF
Sbjct  128  RGDGVLGFDNFNDYYDPSLKRARQHLLEKNQVFIVEGDLNDGPLLRKLFDIVPF  181



>ref|XP_006418833.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
 gb|ESQ37269.1| hypothetical protein EUTSA_v10002521mg [Eutrema salsugineum]
Length=461

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 148/181 (82%), Gaps = 7/181 (4%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALLLVLLFAINYPPLSDSRAAA  67

Query  261  ----RRRALHTTG---HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSH  419
                 RR+  +TG    S  +++ S GAAWEK+V+ S+T +R +G+SVLVTGAAGFVGSH
Sbjct  68   AHHLHRRSFLSTGLFSSSSSSSSASLGAAWEKRVRQSSTAKRPHGLSVLVTGAAGFVGSH  127

Query  420  CSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVP  599
            CS+ALKKRGDGVLG DNFN YYDPSLKRARQ+LLEK Q+FIVEGDLND PLL KLFD+VP
Sbjct  128  CSIALKKRGDGVLGFDNFNDYYDPSLKRARQQLLEKQQVFIVEGDLNDGPLLRKLFDVVP  187

Query  600  F  602
            F
Sbjct  188  F  188



>emb|CDY18087.1| BnaA01g23480D [Brassica napus]
Length=460

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 148/179 (83%), Gaps = 5/179 (3%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSPA  68

Query  261  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +AL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK+Q+FIVEGDLND PLL KLFD+VPF
Sbjct  129  IALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKNQVFIVEGDLNDGPLLRKLFDVVPF  187



>emb|CDY64583.1| BnaCnng44170D [Brassica napus]
Length=460

 Score =   207 bits (528),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 148/179 (83%), Gaps = 5/179 (3%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYN+Y+R+++S+K++ ASSK+LFRATL+VAL+L+  F INY PL++S    
Sbjct  9    DTSKTVKLERYNNYLRKIHSTKVLKASSKVLFRATLLVALVLVLVFAINYHPLSDSHSAA  68

Query  261  ----RRRALHTTG-HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
                 RR+  +TG  S  +++   GAAWEK+V+ S+TP+R +G+SVLVTGAAGFVGSHCS
Sbjct  69   SHHLHRRSFLSTGIFSSSSSSLGEGAAWEKRVRQSSTPKRPHGLSVLVTGAAGFVGSHCS  128

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +AL+KRGDGVLG DNFN YYDPSLKRARQ+LLEK+Q+FIVEGDLND PLL KLFD+VPF
Sbjct  129  IALRKRGDGVLGFDNFNDYYDPSLKRARQELLEKNQVFIVEGDLNDGPLLRKLFDVVPF  187



>ref|XP_010468437.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Camelina sativa]
Length=456

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 147/187 (79%), Gaps = 8/187 (4%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  246  SSGGG----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAA  401
            S         RR+  +TG     S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAA
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAA  122

Query  402  GFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSK  581
            GFVGSHCSL L+KRGDGVLG DNFN YYDP+LKRARQ LLEK Q+FIVEGDLND PLL K
Sbjct  123  GFVGSHCSLYLRKRGDGVLGFDNFNDYYDPALKRARQALLEKQQVFIVEGDLNDGPLLRK  182

Query  582  LFDIVPF  602
            LFD+VPF
Sbjct  183  LFDVVPF  189



>ref|XP_010488461.1| PREDICTED: UDP-glucuronate 4-epimerase 6 [Camelina sativa]
Length=462

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 147/187 (79%), Gaps = 8/187 (4%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            M+   DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F INYPPL++
Sbjct  3    MSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLVLLFAINYPPLSD  62

Query  246  SSGGG----RRRALHTTG----HSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAA  401
            S         RR+  +TG     S  +++  GGAAWEK+V+ S+T +R  G+SVLVTGAA
Sbjct  63   SRAAAAHHLHRRSFLSTGLFSSSSSSSSSSIGGAAWEKRVRQSSTAKRPRGLSVLVTGAA  122

Query  402  GFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSK  581
            GFVGSHCSL L+KRGDGVLG DNFN YYDP+LKRARQ LLEK Q+FIVEGDLND PLL K
Sbjct  123  GFVGSHCSLYLRKRGDGVLGFDNFNDYYDPALKRARQALLEKQQVFIVEGDLNDGPLLRK  182

Query  582  LFDIVPF  602
            LFD+VPF
Sbjct  183  LFDVVPF  189



>ref|XP_008792930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Phoenix dactylifera]
Length=464

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 138/189 (73%), Gaps = 23/189 (12%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA   DTSK +KLERYNSY+RRVNS+KL+AAS   LFRATL+ A++LI  FT++YPPL  
Sbjct  1    MALLTDTSKTTKLERYNSYLRRVNSTKLLAASWNFLFRATLLTAIVLILLFTLHYPPL--  58

Query  246  SSGGGRRRALHTTGHSLLAAT----------FSGGAAWEKQVQSSATPRRQNGMSVLVTG  395
                         GH L AA+            GG+AWE+ V+ SATPRR  GM+VLVTG
Sbjct  59   -----------LAGHHLSAASAHSHRSLLSSSYGGSAWERDVRRSATPRRHGGMTVLVTG  107

Query  396  AAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLL  575
            AAGFVG+HCSLALKKRGDGVLGLDNFN+YYDPSLKR+RQ LL +  I +++ D+ND+ LL
Sbjct  108  AAGFVGTHCSLALKKRGDGVLGLDNFNSYYDPSLKRSRQNLLSRRGILVLDADINDSNLL  167

Query  576  SKLFDIVPF  602
             KLFD+VPF
Sbjct  168  IKLFDVVPF  176



>ref|XP_009386871.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 145/182 (80%), Gaps = 3/182 (2%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  242
            MA  PDTSK+ KLER+  Y+ RR+NS+K+IAASS LLFRA+++  ++LI  FT++YPPL 
Sbjct  1    MASAPDTSKSFKLERHGGYLLRRINSTKVIAASSHLLFRASILATVVLILLFTLHYPPLL  60

Query  243  ESSGGGRRRALHTTGH-SLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  416
                G    +   + H SLL++  + GGAAWE++V+ SATPR  +G++VLVTGAAGFVG+
Sbjct  61   LYHSGAAASSAAHSNHRSLLSSAVTYGGAAWEREVRRSATPRSPSGLTVLVTGAAGFVGT  120

Query  417  HCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIV  596
            HCSLALKKRGDGV+GLDNFN+YY+PSLKRARQ LL +H + +++ D+ND PLL+KLFD+V
Sbjct  121  HCSLALKKRGDGVVGLDNFNSYYNPSLKRARQSLLSRHGVLVLDADINDTPLLTKLFDVV  180

Query  597  PF  602
            PF
Sbjct  181  PF  182



>emb|CDX77481.1| BnaA07g06190D [Brassica napus]
Length=453

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 145/174 (83%), Gaps = 1/174 (1%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHL-  66

Query  261  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  440
             RR+  +TG    +++   GAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL+K
Sbjct  67   HRRSFLSTGLFSSSSSLGEGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIALRK  126

Query  441  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            RGDGVLG DNFN YYDPSLKRARQ LLEK+Q+FIVEGDLND PLL KLFDIVPF
Sbjct  127  RGDGVLGFDNFNDYYDPSLKRARQHLLEKNQVFIVEGDLNDGPLLRKLFDIVPF  180



>ref|XP_006848494.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
 gb|ERN10075.1| hypothetical protein AMTR_s00013p00257170 [Amborella trichopoda]
Length=446

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 131/168 (78%), Gaps = 6/168 (4%)
 Frame = +3

Query  99   KLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGGRRRALH  278
            KLERYNSYIR++NSSK +AASSKLLFRA++++AL L+FF T+   P         RR L 
Sbjct  9    KLERYNSYIRKMNSSKALAASSKLLFRASILIALFLVFFLTLTSYPTEV------RRRLS  62

Query  279  TTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVL  458
            +T     A+   GG  WEKQV+ S+TPRR NG SVLVTGAAGFVGSH SLALKKRGDGVL
Sbjct  63   STSSFGAASARWGGPLWEKQVRHSSTPRRPNGFSVLVTGAAGFVGSHSSLALKKRGDGVL  122

Query  459  GLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GLDNFN YYDPSLKRARQ LL K  IFIV+GD+N+A LL+KLFD+VPF
Sbjct  123  GLDNFNDYYDPSLKRARQALLAKQSIFIVDGDINNAYLLAKLFDVVPF  170



>emb|CDX85133.1| BnaC07g07730D [Brassica napus]
Length=456

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 145/176 (82%), Gaps = 2/176 (1%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL++AL+L+  F +NY P ++S    
Sbjct  8    DTSKTVKLERYNSYLRKIHSTKVLKASSKVLFRATLLIALVLVLLFAVNYHPHSDSHHLH  67

Query  261  RRRALHTT--GHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  434
            RR  L T     S  +++  GGAAWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+AL
Sbjct  68   RRSFLSTGLFSSSSASSSLGGGAAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSIAL  127

Query  435  KKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +KRGDGVLG DNFN YYDPSLKRARQ LLEK+Q+FIVEGDLND PLL KLFDIVPF
Sbjct  128  RKRGDGVLGFDNFNDYYDPSLKRARQHLLEKNQVFIVEGDLNDGPLLRKLFDIVPF  183



>ref|XP_006365466.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum tuberosum]
Length=434

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 136/178 (76%), Gaps = 10/178 (6%)
 Frame = +3

Query  72   FPPDTSKNSKLERYNSYIRRVNsskl-iaasskllFRATLMVALILIFFFTINYPPLAES  248
            F  DT+K++KL+RYN+YIR+VNSS   IAASSKLL+R T+++  +LI  F INY     +
Sbjct  5    FSVDTNKSTKLDRYNTYIRKVNSSTKFIAASSKLLYRITILIFALLICSFIINYFLFVSN  64

Query  249  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  428
            +     R L +         F GGA WEK+V+ S+ P++ NG  VLVTGAAGFVGSHC+L
Sbjct  65   NSNQHGRRLFS---------FGGGAGWEKKVRHSSIPKKINGKVVLVTGAAGFVGSHCAL  115

Query  429  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            ALKKRGDGV+G+DNFN+YYDPSLKRARQ+LL KH+IFIVEGD+ND  L++KLFDIVPF
Sbjct  116  ALKKRGDGVIGIDNFNSYYDPSLKRARQELLAKHEIFIVEGDINDIDLVNKLFDIVPF  173



>emb|CDX92990.1| BnaA03g37120D [Brassica napus]
Length=456

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 143/178 (80%), Gaps = 7/178 (4%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F  NY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLLLLFAFNYHPLSDSRAAA  68

Query  261  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  428
                 RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+
Sbjct  69   SHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSI  125

Query  429  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            AL+KRGDGVLG DNFN YYD SLKRARQ LLEK Q+FIVEGDLND PLL KLFDIVPF
Sbjct  126  ALRKRGDGVLGFDNFNDYYDTSLKRARQNLLEKQQVFIVEGDLNDGPLLRKLFDIVPF  183



>ref|XP_009135867.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brassica rapa]
Length=456

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 143/178 (80%), Gaps = 7/178 (4%)
 Frame = +3

Query  81   DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGGG  260
            DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL+L+  F  NY PL++S    
Sbjct  9    DTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALVLLLLFAFNYHPLSDSRAAA  68

Query  261  ----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  428
                 RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGFVGSHCS+
Sbjct  69   SHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGFVGSHCSI  125

Query  429  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            AL+KRGDGVLG DNFN YYD SLKRARQ LLEK Q+FIVEGDLND PLL KLFDIVPF
Sbjct  126  ALRKRGDGVLGFDNFNDYYDTSLKRARQNLLEKQQVFIVEGDLNDGPLLRKLFDIVPF  183



>emb|CDY53207.1| BnaC03g74010D [Brassica napus]
Length=455

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 144/185 (78%), Gaps = 11/185 (6%)
 Frame = +3

Query  72   FPP----DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL  239
             PP    DTSK  KLERYNSY+R+++S+K++ ASSK+LFRATL+VAL L+  F  NY PL
Sbjct  1    MPPSATADTSKTVKLERYNSYLRKIHSTKVLNASSKVLFRATLLVALFLLLLFAFNYHPL  60

Query  240  AESSGGG----RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGF  407
            ++S         RR+  +TG   + ++ S  +AWEK+V+ S+T +RQ+G+SVLVTGAAGF
Sbjct  61   SDSRAAASHHLHRRSFLSTG---IFSSSSSSSAWEKRVRQSSTAKRQHGLSVLVTGAAGF  117

Query  408  VGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLF  587
            VGSHCS+AL+KRGDGVLG DNFN YYD SLKRARQ LLEK Q+FIVEGDLND PLL KLF
Sbjct  118  VGSHCSIALRKRGDGVLGFDNFNDYYDTSLKRARQNLLEKQQVFIVEGDLNDGPLLRKLF  177

Query  588  DIVPF  602
            DIVPF
Sbjct  178  DIVPF  182



>ref|XP_009412723.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYI-RRVNsskliaasskllFRATLMVALILIFFFTINYPPLA  242
            MA PPDTSK+SKLERYNSY+ RRV+S+KLIAASS LLFRAT++ ALILIF F ++YPPL 
Sbjct  2    MASPPDTSKSSKLERYNSYLLRRVSSAKLIAASSHLLFRATILAALILIFLFLLHYPPLL  61

Query  243  ESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHC  422
             SS      + H+   SLL++   GG  WE+ V+ SA PRR +G+SVLVTGAAGFVG+HC
Sbjct  62   LSSSHYSSSSPHSNHRSLLSSGSYGGGYWERDVRRSAAPRRPDGLSVLVTGAAGFVGTHC  121

Query  423  SLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            SLALK+RGDGV+GLDNFNAYYDP+LKR+RQ LL  H + ++E D+ND  LL+KLFD+VPF
Sbjct  122  SLALKRRGDGVVGLDNFNAYYDPALKRSRQALLSSHGVLVLEADINDGTLLAKLFDVVPF  181



>ref|XP_003532740.2| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Glycine max]
Length=493

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 122/179 (68%), Gaps = 30/179 (17%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA  PDTSK  KL RYNSY+RR+NS           F+      ++L+  +T+       
Sbjct  73   MASSPDTSKTIKLMRYNSYLRRLNS-----------FKLLKTSFILLLLLYTL-------  114

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
                       +T H LL++ F G  AWE QV+ SA PRR +GMSVLVTGAAGFVGSHCS
Sbjct  115  -----------STHHLLLSSAFHG-PAWENQVRHSALPRRPHGMSVLVTGAAGFVGSHCS  162

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            L+LKKRGDGVLGLDNFN+YYDPSLKRARQ LL KHQI I+E DLNDAPLL+K+FD+V F
Sbjct  163  LSLKKRGDGVLGLDNFNSYYDPSLKRARQHLLAKHQILIIEADLNDAPLLAKIFDVVSF  221



>ref|XP_002522810.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
 gb|EEF39661.1| UDP-glucuronate 5-epimerase, putative [Ricinus communis]
Length=401

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GGA+WEKQV+ S+TPRR +G+SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN YYDPS
Sbjct  31   GGASWEKQVRHSSTPRRPSGLSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNNYYDPS  90

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ+LL KHQ+FIVEGD+ND  LL+KLFD+VPF
Sbjct  91   LKRARQQLLLKHQVFIVEGDINDGQLLAKLFDVVPF  126



>ref|XP_006580148.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X2 [Glycine 
max]
Length=405

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 111/179 (62%), Gaps = 33/179 (18%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA  PDTSK  KL R NSY+RR+N                            I++  L  
Sbjct  1    MASSPDTSKTIKLVRNNSYLRRLN----------------------------ISFKILFL  32

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
                     L T  H L  ++     AWE QV+ SA PRR NGMSVLVTGAAGFVGSHCS
Sbjct  33   LLALLLLYTLSTHHHHLPLSS-----AWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCS  87

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LALKKRGDGVLGLDNFN YYDPSLKRARQ LL KH+I I+E DLNDAPLL+KLFD+V F
Sbjct  88   LALKKRGDGVLGLDNFNPYYDPSLKRARQHLLAKHRILIIEADLNDAPLLAKLFDVVSF  146



>ref|XP_003524930.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like isoform X1 [Glycine 
max]
Length=416

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 111/179 (62%), Gaps = 33/179 (18%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
            MA  PDTSK  KL R NSY+RR+N                            I++  L  
Sbjct  1    MASSPDTSKTIKLVRNNSYLRRLN----------------------------ISFKILFL  32

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
                     L T  H L  ++     AWE QV+ SA PRR NGMSVLVTGAAGFVGSHCS
Sbjct  33   LLALLLLYTLSTHHHHLPLSS-----AWENQVRHSALPRRPNGMSVLVTGAAGFVGSHCS  87

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LALKKRGDGVLGLDNFN YYDPSLKRARQ LL KH+I I+E DLNDAPLL+KLFD+V F
Sbjct  88   LALKKRGDGVLGLDNFNPYYDPSLKRARQHLLAKHRILIIEADLNDAPLLAKLFDVVSF  146



>ref|XP_004239852.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Solanum lycopersicum]
Length=433

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 123/178 (69%), Gaps = 11/178 (6%)
 Frame = +3

Query  72   FPPDTSKNSKLERYNSYIRRVNsskliaasskllFRA-TLMVALILIFFFTINYPPLAES  248
            F  DT K+ KL+R N+YI +VNSS  +  +   LF    ++++ +LI  F +N+     +
Sbjct  5    FSIDTKKSIKLDR-NTYIHKVNSSTKLIVAFIKLFYCIAILISALLIGLFILNHILFIST  63

Query  249  SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSL  428
                  R L +         F GGA WEK+V+ S+ P++ NG  VLVTGAAGFVGSHC L
Sbjct  64   DSNQHGRRLFS---------FGGGAGWEKKVRHSSIPKKINGKVVLVTGAAGFVGSHCGL  114

Query  429  ALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            ALKKRGDGV+G+DNFN+YYDPSLKRARQ+L+ KH+IFIV+GD+ND  L++KLFDIV F
Sbjct  115  ALKKRGDGVIGIDNFNSYYDPSLKRARQELMSKHEIFIVDGDINDIDLVNKLFDIVRF  172



>ref|NP_001147328.1| protein capI [Zea mays]
 gb|ACG26819.1| protein capI [Zea mays]
 tpg|DAA62203.1| TPA: protein capI [Zea mays]
Length=487

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 130/189 (69%), Gaps = 20/189 (11%)
 Frame = +3

Query  87   SKNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS-  251
            +K  KLERY S     +RR  S+KL++ASS LLFRAT++  L L+F FT++YP L   S 
Sbjct  13   AKGMKLERYASGGALLLRRATSAKLVSASSHLLFRATVLATLALVFLFTLHYPSLLSRSF  72

Query  252  -----------GGGRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTG  395
                        G R  A H    SLL ++ S GGAAWEK+V+ SA P R  G+SVLVTG
Sbjct  73   HLSAGGGGGADDGARSSASH---RSLLMSSASYGGAAWEKEVRRSARPSRDGGISVLVTG  129

Query  396  AAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLL  575
            AAGFVG+HCSLAL+ RGDGVLGLDNFN+YYDPSLKRARQ LL    + +++ D+NDAPLL
Sbjct  130  AAGFVGTHCSLALRARGDGVLGLDNFNSYYDPSLKRARQALLASRGVLVLDADINDAPLL  189

Query  576  SKLFDIVPF  602
             +LFD+  F
Sbjct  190  ERLFDVAAF  198



>ref|XP_009411848.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = +3

Query  66   MAFPPDTSKNSKLERYNSYIRR-VNsskliaasskllFRATLMVALILIFFFTINYPPL-  239
            MA PPDTSK SKLERYNSY+RR V+S+KLIAASS +LFRATL+ AL+LIF F ++ PPL 
Sbjct  1    MASPPDTSKASKLERYNSYLRRRVSSAKLIAASSYILFRATLLAALLLIFLFLLHSPPLL  60

Query  240  -AESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  416
             + S       + H +  S  +A + GGAAWE+ V+ SATPRR +G+SVLVTGAAGFVG+
Sbjct  61   FSGSHYYSSSHSNHRSLLSSSSAAY-GGAAWEQDVRRSATPRRADGLSVLVTGAAGFVGT  119

Query  417  HCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIV  596
            HCSLALK+RGDGV+G+DNFNAYYDP+LKR+RQ LL +H + +++ D+N+  LL+KLFD+V
Sbjct  120  HCSLALKRRGDGVVGVDNFNAYYDPALKRSRQVLLTRHGVLVLDADINNVALLAKLFDVV  179

Query  597  PF  602
            PF
Sbjct  180  PF  181



>dbj|BAC75426.1| putative type 1 capsule synthesis gene(CapI) [Oryza sativa Japonica 
Group]
Length=477

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 13/173 (8%)
 Frame = +3

Query  123  IRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRAL  275
            +RRV S KL++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA 
Sbjct  26   VRRVASGKLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAA  85

Query  276  HTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
              + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  86   SRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  145

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+GLDNFN+YYDPSLKRARQ+LL    + +++ D+NDA LL +LFD   F
Sbjct  146  GDGVVGLDNFNSYYDPSLKRARQRLLASRGVAVLDADINDAALLERLFDAARF  198



>ref|NP_001062295.1| Os08g0526100 [Oryza sativa Japonica Group]
 gb|ABC59070.1| UDP-glucuronic acid 4-epimerase isoform 3 [Oryza sativa Japonica 
Group]
 dbj|BAF24209.1| Os08g0526100 [Oryza sativa Japonica Group]
Length=478

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 13/173 (8%)
 Frame = +3

Query  123  IRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRAL  275
            +RRV S KL++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA 
Sbjct  27   VRRVASGKLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAA  86

Query  276  HTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
              + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ R
Sbjct  87   SRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRAR  146

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+GLDNFN+YYDPSLKRARQ+LL    + +++ D+NDA LL +LFD   F
Sbjct  147  GDGVVGLDNFNSYYDPSLKRARQRLLASRGVAVLDADINDAALLERLFDAARF  199



>gb|EEC83914.1| hypothetical protein OsI_29969 [Oryza sativa Indica Group]
Length=565

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 122/174 (70%), Gaps = 13/174 (7%)
 Frame = +3

Query  120  YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPL---------AESSGGGRRRA  272
            YI R+    L++ASS LLFRAT++  L L+  FT++YP L         A ++  G+ RA
Sbjct  113  YIDRIGEKTLLSASSHLLFRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRA  172

Query  273  LHTTGH-SLL---AATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  440
               + H SLL   AA   GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ 
Sbjct  173  ASRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRA  232

Query  441  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            RGDGV+GLDNFN+YYDPSLKRARQ+LL    + +++ D+NDA LL +LFD   F
Sbjct  233  RGDGVVGLDNFNSYYDPSLKRARQRLLASRGVAVLDADINDAALLERLFDAARF  286



>ref|XP_002965131.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
 gb|EFJ33969.1| hypothetical protein SELMODRAFT_266836 [Selaginella moellendorffii]
Length=445

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 121/175 (69%), Gaps = 9/175 (5%)
 Frame = +3

Query  78   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  257
            P T    K+ER N+Y  RV++    + S +  F   + VAL+   FF I+ PP  ++   
Sbjct  6    PSTPGKVKMER-NNYFGRVSNRWHSSGSGRYFFWMFVSVALMFYAFFHISAPPAVQTGLE  64

Query  258  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  437
             R       G+  LA    GG+ WEKQV+ SA  +R+NGM VLVTGAAGFVG+H SLALK
Sbjct  65   SRH-----FGNRALAW---GGSKWEKQVRHSARTKRENGMVVLVTGAAGFVGTHVSLALK  116

Query  438  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            KRGDGV+GLDNFN+YYDPSLKRARQ+LLEK  +FIV+GD+N++ LL+KLF +VPF
Sbjct  117  KRGDGVVGLDNFNSYYDPSLKRARQELLEKQSVFIVDGDVNNSELLAKLFSMVPF  171



>gb|EEC84839.1| hypothetical protein OsI_31939 [Oryza sativa Indica Group]
Length=498

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 132/201 (66%), Gaps = 24/201 (12%)
 Frame = +3

Query  72   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  230
             P D + K  KLERY S       +RR  S K+++ASS LLFRAT++  + L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASSAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHY  60

Query  231  PPLAESS--------GGGRRRALHTTGHSLL---------AATFSGGAAWEKQVQSSATP  359
            P L   S         G    A H +  SLL         AA+  GGAAWEK+V+ SA P
Sbjct  61   PSLLSRSFTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKP  120

Query  360  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIF  539
            R+  G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFNAYYDP LKRARQ+LL    + 
Sbjct  121  RKDGGIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNAYYDPELKRARQRLLAGRGVL  180

Query  540  IVEGDLNDAPLLSKLFDIVPF  602
            +++ D+NDA LL KLFD+VPF
Sbjct  181  VLDADINDALLLEKLFDLVPF  201



>ref|NP_001063595.1| Os09g0504000 [Oryza sativa Japonica Group]
 dbj|BAF25509.1| Os09g0504000 [Oryza sativa Japonica Group]
 gb|EEE70003.1| hypothetical protein OsJ_29922 [Oryza sativa Japonica Group]
Length=498

 Score =   171 bits (434),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 132/201 (66%), Gaps = 24/201 (12%)
 Frame = +3

Query  72   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  230
             P D + K  KLERY S       +RR  S K+++ASS LLFRAT++  + L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASGAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHY  60

Query  231  PPLAESS--------GGGRRRALHTTGHSLL---------AATFSGGAAWEKQVQSSATP  359
            P L   S         G    A H +  SLL         AA+  GGAAWEK+V+ SA P
Sbjct  61   PSLLSRSFTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKP  120

Query  360  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIF  539
            R+  G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFNAYYDP LKRARQ+LL    + 
Sbjct  121  RKDGGIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNAYYDPELKRARQRLLAGRGVL  180

Query  540  IVEGDLNDAPLLSKLFDIVPF  602
            +++ D+NDA LL KLFD+VPF
Sbjct  181  VLDADINDALLLEKLFDLVPF  201



>ref|XP_002962217.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
 gb|EFJ37477.1| hypothetical protein SELMODRAFT_77268 [Selaginella moellendorffii]
Length=450

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 119/175 (68%), Gaps = 9/175 (5%)
 Frame = +3

Query  78   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  257
            P T    K+ER N+Y  RV++    + S +  F   + VAL+   FF I+ PP  ++   
Sbjct  11   PSTPGKVKMER-NNYFGRVSNRWHSSGSGRYFFWMFVSVALMFYAFFHISAPPAVQTGLE  69

Query  258  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  437
             R        H    A   GG+ WEKQV+ SA  +R+NGM VLVTGAAGFVG+H SLALK
Sbjct  70   SR--------HFGNRALTWGGSKWEKQVRHSARTKRENGMVVLVTGAAGFVGTHVSLALK  121

Query  438  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            KRGDGV+GLDNFN+YYDPSLKRARQ+LLEK  +FIV+GD+N++ LL+KLF +VPF
Sbjct  122  KRGDGVVGLDNFNSYYDPSLKRARQELLEKQSVFIVDGDVNNSELLAKLFSMVPF  176



>gb|EAZ43405.1| hypothetical protein OsJ_28010 [Oryza sativa Japonica Group]
Length=623

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 110/156 (71%), Gaps = 13/156 (8%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPL---------AESSGGGRRRALHTTGH-SLL---AATFS  314
            FRAT++  L L+  FT++YP L         A ++  G+ RA   + H SLL   AA   
Sbjct  189  FRATILATLCLVCLFTVHYPSLLSHSFHLSSAAAAANGKHRAASRSSHRSLLGSSAAVAY  248

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GGAAWEK+V+ SA PRR  G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFN+YYDPS
Sbjct  249  GGAAWEKEVRRSAAPRRDGGLSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNSYYDPS  308

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ+LL    + +++ D+NDA LL +LFD   F
Sbjct  309  LKRARQRLLASRGVAVLDADINDAALLERLFDAARF  344



>gb|ABK25339.1| unknown [Picea sitchensis]
Length=430

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 118/179 (66%), Gaps = 16/179 (9%)
 Frame = +3

Query  72   FPP--DTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAE  245
             PP  D +   K+ER   Y  R  +S+  + S++L F A  ++AL+ IFF  +  P    
Sbjct  1    MPPSMDGALKGKMERNGGYFGRPANSRCCSPSARLFFWAATLIALLFIFFMGMTSPSEP-  59

Query  246  SSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCS  425
                 RRR        +L +   GG  WEKQV+ S   +R+NG+ VLVTGAAGFVGSH S
Sbjct  60   -----RRR--------VLGSYSWGGPDWEKQVRHSCKLKRENGIVVLVTGAAGFVGSHVS  106

Query  426  LALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LALKKRGDGVLG+DNFN YYDPSLKR+RQ++LE H IFIVEGD+ND  LL KLFD+VPF
Sbjct  107  LALKKRGDGVLGIDNFNNYYDPSLKRSRQRVLENHGIFIVEGDINDRYLLKKLFDVVPF  165



>dbj|BAJ86203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 124/182 (68%), Gaps = 10/182 (5%)
 Frame = +3

Query  87   SKNSKLERYNS-----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS  251
            +K  KLERY S      +RR  SSK++AASS LLFRAT++  L L+  F ++YP L   S
Sbjct  18   AKGVKLERYASGGGALLMRRAGSSKIVAASSHLLFRATVLATLALVCLFAVHYPTLLSRS  77

Query  252  ---GGGRRRALHTTGHSLLAATFSG--GAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGS  416
                        T+ H  L  + S   GAAWE++V+ SATPRR  GMSVLVTGAAGFVG+
Sbjct  78   FRLSAASSPPRPTSRHRNLLGSSSAYAGAAWEREVRRSATPRRDGGMSVLVTGAAGFVGA  137

Query  417  HCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIV  596
            HC+LAL+ RGDGVLGLDNFNAYY+P+LKRARQ+LL    + ++  D+NDA LL +LF  V
Sbjct  138  HCALALRARGDGVLGLDNFNAYYEPALKRARQRLLASRGVVVLGADINDAALLERLFAAV  197

Query  597  PF  602
            PF
Sbjct  198  PF  199



>ref|XP_002444715.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
 gb|EES14210.1| hypothetical protein SORBIDRAFT_07g026520 [Sorghum bicolor]
Length=479

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 123/185 (66%), Gaps = 13/185 (7%)
 Frame = +3

Query  87   SKNSKLERYNSYIRRV-NsskliaasskllFRATLMVALILIFFFTINYPPL--------  239
            +K  KLER+   +RR   +  L++ASS LLFRAT++  L L+  F ++YP L        
Sbjct  10   AKGVKLERHAVLLRRAAGAKHLVSASSHLLFRATVLATLALVVLFAVHYPSLLSHSFTLS  69

Query  240  ---AESSGGGRRRALHTTGHSLLAATFSG-GAAWEKQVQSSATPRRQNGMSVLVTGAAGF  407
               A  S   R R  H +     A++  G GAAWE++V+ SATPRR   +SVLVTGAAGF
Sbjct  70   AAPASPSSTPRSRHSHRSLLGSGASSSYGRGAAWEREVRRSATPRRDGALSVLVTGAAGF  129

Query  408  VGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLF  587
            VG+HCSLAL+ RGDGV+GLDNFNAYYDPSLKRARQ+LL    + +++ D+NDA LL +L 
Sbjct  130  VGAHCSLALRARGDGVVGLDNFNAYYDPSLKRARQRLLASRGVVVLDADINDAALLERLL  189

Query  588  DIVPF  602
              VPF
Sbjct  190  SAVPF  194



>ref|XP_009397005.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 100/139 (72%), Gaps = 9/139 (6%)
 Frame = +3

Query  186  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  365
            L +AL++ FFF     P + S+ G R         SL  A   GG AWEK V+SSA  RR
Sbjct  49   LAIALLVAFFFLSPTTPNSSSTSGRR---------SLRNAAPWGGPAWEKCVRSSARVRR  99

Query  366  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIV  545
              G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LL++  +F+V
Sbjct  100  SGGISVLVTGAAGFVGTHVSTALKRRGDGVLGLDNFNDYYDPSLKRARQALLDRAGVFVV  159

Query  546  EGDLNDAPLLSKLFDIVPF  602
            EGD+ND PLL KLFD+VPF
Sbjct  160  EGDVNDGPLLHKLFDVVPF  178



>ref|XP_004957272.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=488

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 124/194 (64%), Gaps = 29/194 (15%)
 Frame = +3

Query  87   SKNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSG  254
            +K  KLERY S     +RR  S+K+++ASS LLFRAT++  L L+F FT++YP L     
Sbjct  13   AKGMKLERYASGGALMLRRATSAKIVSASSHLLFRATVLATLALVFLFTLHYPSLL----  68

Query  255  GGRRRALHTTG--------HSLLAATFS----------GGAAWEKQVQSSATPRRQNGMS  380
                R+ H +         HS    +            GGAAWEK+++ SA P R  G+S
Sbjct  69   ---FRSFHLSAGGGGPGGAHSASHRSLLMSSSSTSASYGGAAWEKEMRQSARPSRDGGIS  125

Query  381  VLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLN  560
            VLVTGAAGFVG+HCSLALK RGDGV+GLDNFN+YYDPSLKRARQ LL    + +V+ D+N
Sbjct  126  VLVTGAAGFVGTHCSLALKARGDGVVGLDNFNSYYDPSLKRARQALLASRGVAVVDADIN  185

Query  561  DAPLLSKLFDIVPF  602
            D  LL KLFD+  F
Sbjct  186  DGLLLEKLFDVAAF  199



>gb|EMT02349.1| UDP-glucuronate 4-epimerase 6 [Aegilops tauschii]
Length=705

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 127/199 (64%), Gaps = 25/199 (13%)
 Frame = +3

Query  72   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPP  236
             P D + K  KLERY S     +RRV S K ++ASS LLFRAT++  L L+F F ++YP 
Sbjct  1    MPSDAAAKGVKLERYASGGALLLRRVASGKFVSASSHLLFRATVLATLALVFLFALHYPS  60

Query  237  LAESS-------------GGGRRRALHTTGHSLLAATFS----GGAAWEKQVQSSATPRR  365
            L   S             G  R  A H    SLLA+T +    G   W+K+++ SA P R
Sbjct  61   LLSRSFSLASDGSSSSVPGASRSHASH---RSLLASTSAAATYGSERWQKEIRRSAKPGR  117

Query  366  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIV  545
              G+SVLVTGA GFVG+HCSLALK RGDGV+GLDNFN+YYDP+LKR RQ+LL    + ++
Sbjct  118  DGGLSVLVTGAGGFVGAHCSLALKARGDGVVGLDNFNSYYDPALKRGRQQLLADRGVVVL  177

Query  546  EGDLNDAPLLSKLFDIVPF  602
            + D+NDA LL KLF+ VPF
Sbjct  178  DADINDALLLEKLFEAVPF  196



>ref|XP_002320057.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
 gb|EEE98372.1| UDP-D-GLUCURONATE 4-EPIMERASE 3 family protein [Populus trichocarpa]
Length=431

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 104/139 (75%), Gaps = 11/139 (8%)
 Frame = +3

Query  186  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  365
            L +A+I +FF+    PP + +S   RR         L +AT+ GGAAWEK+V++SA  R 
Sbjct  40   LFIAVIFVFFY--RSPPSSSNSDLSRRY--------LTSATW-GGAAWEKRVRTSARIRS  88

Query  366  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIV  545
            +NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDP+LKRARQ LLE+  +FIV
Sbjct  89   RNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPTLKRARQALLERSGVFIV  148

Query  546  EGDLNDAPLLSKLFDIVPF  602
            EGD+ND  LL KLF++VPF
Sbjct  149  EGDINDVSLLKKLFEVVPF  167



>ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
 gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum]
Length=437

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 103/143 (72%), Gaps = 8/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI IFF+    P     S    RR+L T  ++       GG AWEK+V+SSA
Sbjct  39   FWSLVFVGLIFIFFY--RSPSSNPVSSDPSRRSLRTYAYTW------GGPAWEKRVRSSA  90

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  91   RVRTRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  150

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+V+GD+NDA LL KLF++VPF
Sbjct  151  VFVVQGDINDAALLKKLFEVVPF  173



>ref|NP_191922.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
 sp|O81312.1|GAE3_ARATH RecName: Full=UDP-glucuronate 4-epimerase 3; AltName: Full=UDP-glucuronic 
acid epimerase 3 [Arabidopsis thaliana]
 gb|AAC19298.1| contains similarity to nucleotide sugar epimerases [Arabidopsis 
thaliana]
 emb|CAB80769.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|ABH04594.1| At4g00110 [Arabidopsis thaliana]
 gb|AEE81824.1| UDP-D-glucuronate 4-epimerase 3 [Arabidopsis thaliana]
Length=430

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 101/143 (71%), Gaps = 11/143 (8%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI IFF+     P++ +     RR+L T           GG AWEK+V+SSA
Sbjct  35   FWSLVFVGLIFIFFYR---SPVSSNPADPSRRSLRTYSW--------GGPAWEKRVRSSA  83

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  84   RLRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  143

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+VEGD+NDA LL KLF++VPF
Sbjct  144  VFVVEGDINDAALLKKLFEVVPF  166



>gb|ABR16292.1| unknown [Picea sitchensis]
Length=437

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 115/175 (66%), Gaps = 16/175 (9%)
 Frame = +3

Query  78   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  257
            P T    K+ER N Y  R  S++  ++ +KL F   ++V LI+IFF       +  SS  
Sbjct  14   PSTPGKVKMERSNIYFGR-GSTRWQSSVAKLFFWTVVVVGLIVIFF-------MRSSSPV  65

Query  258  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  437
              RR        LL+    GG  WEK+V+ S   + + G+ VLVTGAAGFVGSH SLALK
Sbjct  66   ETRR--------LLSTPHWGGHDWEKRVRYSCRVKTEKGIVVLVTGAAGFVGSHVSLALK  117

Query  438  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +RGDGVLGLDNFN YYD SLKRARQ LL+K  +F+VEGD+NDAPLL KLFD+VPF
Sbjct  118  RRGDGVLGLDNFNDYYDQSLKRARQGLLDKQGVFVVEGDINDAPLLKKLFDVVPF  172



>ref|XP_009591830.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009591831.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
 ref|XP_009802117.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana sylvestris]
Length=435

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 104/143 (73%), Gaps = 9/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + + LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSFVFLGLIFVFFYRSPAS-SSPVSSDLSRRSLRTSSY--------GGPAWEKRIKASA  88

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  89   KVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDPSLKRARQALLERTG  148

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            ++IVEGD+NDA LL KLFDIVPF
Sbjct  149  VYIVEGDINDATLLKKLFDIVPF  171



>ref|XP_009399578.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQ+++SATPRR  G+SVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN+YYDPS
Sbjct  71   GGMHWEKQIRASATPRRPGGVSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H +F+VEGD+NDA LL+KLFD+VPF
Sbjct  131  LKKARKALLTSHGVFVVEGDINDARLLAKLFDVVPF  166



>gb|KFK30589.1| hypothetical protein AALP_AA6G001300 [Arabis alpina]
Length=432

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 101/143 (71%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI IFF+    P     S    RR+L T           GG AWEK+V+SSA
Sbjct  36   FWSLVFVGLIFIFFY--RSPSSNPVSSDPSRRSLRTYSW--------GGPAWEKRVRSSA  85

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  86   RVRTRHGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  145

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+VEGD+NDA LL KLF++VPF
Sbjct  146  VFVVEGDINDAALLKKLFEVVPF  168



>ref|XP_009417460.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Musa acuminata subsp. 
malaccensis]
Length=444

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQ+++SAT RR  GMSVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN+YYDPS
Sbjct  72   GGMHWEKQIRASATVRRPGGMSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDPS  131

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LLE H +F+VEGD++DA LL+KLFD+VPF
Sbjct  132  LKKAREALLESHGVFVVEGDIDDARLLAKLFDVVPF  167



>ref|XP_003578376.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Brachypodium distachyon]
Length=485

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 132/202 (65%), Gaps = 27/202 (13%)
 Frame = +3

Query  72   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYP-  233
             P D + K  KLERY S     +RRV S KL++ASS LLFRAT++  + L+F FT++YP 
Sbjct  1    MPADAAAKGVKLERYASGGALLLRRVASGKLVSASSHLLFRATVLATIALVFLFTLHYPS  60

Query  234  ------------------PLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  359
                              PL  +S   R   + ++  +  AA+  G   W+K+++ SA P
Sbjct  61   LLSRSFSLSSSSSSSSPTPLQHASH--RSLLMSSSTPAASAASVYGSEKWQKEIKKSAKP  118

Query  360  RRQNG-MSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQI  536
            R+ +G MSVLVTGAAGFVG+HC+LAL+ RGDGVLGLDNFN+YYDPSLKRARQ +L    +
Sbjct  119  RKADGGMSVLVTGAAGFVGTHCALALRARGDGVLGLDNFNSYYDPSLKRARQGVLAARGV  178

Query  537  FIVEGDLNDAPLLSKLFDIVPF  602
             +++ D+NDAPLL+ LF+ VPF
Sbjct  179  VVLDADINDAPLLAALFEAVPF  200



>gb|ACN26174.1| unknown [Zea mays]
Length=249

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 90/108 (83%), Gaps = 7/108 (6%)
 Frame = +3

Query  297  LAATFSGGAAWEKQVQSSATPRRQNG------MSVLVTGAAGFVGSHCSLALKKRGDGVL  458
            LAA++ GG  WE+Q+++SA PRR  G      MSVLVTGAAGFVG+HCSLAL+KRGDGV+
Sbjct  19   LAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRGDGVV  77

Query  459  GLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            G+DNFNAYYDPSLK+AR+ LL  H +FIVEGD+ND  LL+KLFD+VPF
Sbjct  78   GVDNFNAYYDPSLKKARRALLASHGVFIVEGDINDGRLLAKLFDVVPF  125



>ref|XP_004229804.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Solanum lycopersicum]
Length=435

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 104/143 (73%), Gaps = 9/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + + LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSFVFLGLIFVFFYRSPAS-SSPVSSDLSRRSLRTSSY--------GGPAWEKRIKASA  88

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  89   KVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDPSLKRARQALLERTG  148

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +++VEGD+NDA LL KLFDIVPF
Sbjct  149  VYVVEGDINDATLLKKLFDIVPF  171



>ref|XP_002301280.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
 gb|EEE80553.2| hypothetical protein POPTR_0002s14750g [Populus trichocarpa]
Length=435

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 98/141 (70%), Gaps = 7/141 (5%)
 Frame = +3

Query  180  ATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  359
            ++L VALI +FF+                R         LA+   GGAAWEK+V++SA  
Sbjct  38   SSLFVALIFLFFYRSPSSSSNNPPSSDPSR-------RYLASANWGGAAWEKRVRTSARI  90

Query  360  RRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIF  539
            R +NG SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN YYDP+LKRARQ LLE+  +F
Sbjct  91   RSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGIDNFNDYYDPTLKRARQALLERSGVF  150

Query  540  IVEGDLNDAPLLSKLFDIVPF  602
            IVEGD+ND  LL KLFDIVPF
Sbjct  151  IVEGDINDVALLKKLFDIVPF  171



>ref|XP_008351675.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + + LILIFFF    P    S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFFHSPSPNSLPSDPS--RRSLRTYNW--------GGXAWEKRVRSSA  91

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN YYDPSLKRARQ LLE+  
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSG  151

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+NDAPLLSKLF++V F
Sbjct  152  VFIVEGDINDAPLLSKLFEVVAF  174



>ref|XP_002462620.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
 gb|EER99141.1| hypothetical protein SORBIDRAFT_02g029130 [Sorghum bicolor]
Length=494

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 125/190 (66%), Gaps = 19/190 (10%)
 Frame = +3

Query  90   KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESS--  251
            K  KLERY S     +RR  S+KL++ASS LLFRAT++  L L+F FT++YP L   S  
Sbjct  14   KGMKLERYASGGALLLRRATSAKLVSASSHLLFRATVLATLALVFLFTLHYPSLLSRSFH  73

Query  252  ------GGGRRRALHTTG---HSLL----AATFSGGAAWEKQVQSSATPRRQNGMSVLVT  392
                          H+T     SLL    A+   GGAAWEK+V+ SA P R  G+SVLVT
Sbjct  74   LSAGAGDDSAGGGAHSTSASHRSLLMSSSASASYGGAAWEKEVRRSARPSRDGGISVLVT  133

Query  393  GAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPL  572
            GAAGFVG+HCSLALK RGDGVLGLDNFN+YYDPSLKRARQ LL    + +++ D+ND  L
Sbjct  134  GAAGFVGTHCSLALKARGDGVLGLDNFNSYYDPSLKRARQALLASRGVVVLDADINDGLL  193

Query  573  LSKLFDIVPF  602
            L KLFD+  F
Sbjct  194  LEKLFDVAAF  203



>ref|XP_009342752.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Pyrus x bretschneideri]
Length=438

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 102/143 (71%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + + LILIFFF    P    S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFFHSPSPNSLPSDPS--RRSLRTYNW--------GGPAWEKRVRSSA  91

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN YYDPSLKRARQ LLE+  
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSG  151

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+NDAPLLSKLF++V F
Sbjct  152  VFIVEGDINDAPLLSKLFEVVAF  174



>ref|XP_006660806.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Oryza brachyantha]
Length=492

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 128/197 (65%), Gaps = 20/197 (10%)
 Frame = +3

Query  72   FPPDTS-KNSKLERYNS------YIRRVNsskliaasskllFRATLMVALILIFFFTINY  230
             P D + K  KLERY S       +RR +  K+++ASS LLFRAT++  L L+F FT +Y
Sbjct  1    MPADAAAKGMKLERYASGGAMLLLLRRASGGKIVSASSHLLFRATVLATLGLVFLFTFHY  60

Query  231  PPLAESSGGGRRRAL-----HTTGHSLL--------AATFSGGAAWEKQVQSSATPRRQN  371
            P L   S             H +  SLL        A+   GGAAWEK+V+ SA PR+  
Sbjct  61   PSLLSRSFSLSGGGGDGGPAHASHRSLLMSSSSSYSASAAYGGAAWEKEVRKSAKPRKDG  120

Query  372  GMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEG  551
            G++VLVTGAAGFVG+HCSLAL+ RGDGVLGLDNFN+YYDP LKRARQ+LL    + +++ 
Sbjct  121  GIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNSYYDPELKRARQRLLADRGVLVLDA  180

Query  552  DLNDAPLLSKLFDIVPF  602
            D+ND  LL KLFD+VPF
Sbjct  181  DINDGLLLEKLFDLVPF  197



>ref|XP_003519171.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+G
Sbjct  61   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ LL KH +FIV+GDLNDA LL+KLFD+V F
Sbjct  120  LDNFNDYYDPSLKKARKSLLAKHDVFIVDGDLNDAKLLAKLFDVVAF  166



>dbj|BAJ99315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 123/188 (65%), Gaps = 11/188 (6%)
 Frame = +3

Query  72   FPPDTS-KNSKLERYNS----YIRRVNsskliaasskllFRATLMVALILIFFFTINYPP  236
             P D + K  KLERY S     +RRV S K ++ASS LLFRAT++  L L+F F ++YP 
Sbjct  1    MPSDAAAKGVKLERYASGSALLLRRVASGKFVSASSHLLFRATVLATLALVFLFALHYPS  60

Query  237  LAESSGGGRR------RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGA  398
            L   S           R+  +   S  AA   GG  W+K+++ SA PRR  G+SVLVTGA
Sbjct  61   LLSRSFSLASSSSVPPRSHRSLLASSSAAATYGGERWQKEIRRSAKPRRDGGLSVLVTGA  120

Query  399  AGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLS  578
             GFVG+HCSLALK RGDGV+GLDNFN+YYDP+LKR RQ LL    + +++ D+NDA LL 
Sbjct  121  GGFVGAHCSLALKARGDGVVGLDNFNSYYDPALKRGRQALLADRGVVVLDADINDALLLE  180

Query  579  KLFDIVPF  602
            +LF+ VPF
Sbjct  181  RLFEAVPF  188



>ref|XP_002872971.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49230.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 99/143 (69%), Gaps = 12/143 (8%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI IFF    Y     S+    RR+L T           GG AWEK+V+SSA
Sbjct  35   FWSLVFVGLIFIFF----YRSPVSSNPDPSRRSLRTYSW--------GGPAWEKRVRSSA  82

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  83   RVRTRRGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  142

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+VEGD+NDA LL KLF++VPF
Sbjct  143  VFVVEGDINDAALLKKLFEVVPF  165



>ref|XP_008364369.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=438

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 101/143 (71%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + + LILIFFF    P          RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSFVFLGLILIFFF--RSPSSNSLPSDPXRRSLRTYNW--------GGPAWEKRVRSSA  91

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN YYDPSLKRARQ LLE+  
Sbjct  92   KVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSG  151

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+NDAPLLSKLF++V F
Sbjct  152  VFIVEGDINDAPLLSKLFEVVAF  174



>gb|KJB41101.1| hypothetical protein B456_007G090500 [Gossypium raimondii]
Length=437

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 103/144 (72%), Gaps = 12/144 (8%)
 Frame = +3

Query  174  FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  350
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFIFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  351  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKH  530
            A  R  NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+ 
Sbjct  90   ARVRSHNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERS  149

Query  531  QIFIVEGDLNDAPLLSKLFDIVPF  602
             +FIVEGD+ND+ LL KLF++V F
Sbjct  150  GVFIVEGDINDSALLRKLFEVVAF  173



>ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
 gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao]
Length=437

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 104/144 (72%), Gaps = 12/144 (8%)
 Frame = +3

Query  174  FRATLMVALILIFFF-TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  350
            F + + + LILIFFF + +  PL +      RR+L T           GG AWEK+V+SS
Sbjct  41   FWSFIFLGLILIFFFRSPSSNPLPQDPS---RRSLRTYNW--------GGPAWEKRVRSS  89

Query  351  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKH  530
            A  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+ 
Sbjct  90   ARVRSRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERT  149

Query  531  QIFIVEGDLNDAPLLSKLFDIVPF  602
             +FIVEGD+ND+ LL KLF++V F
Sbjct  150  GVFIVEGDINDSALLRKLFEVVAF  173



>ref|XP_007154841.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
 gb|ESW26835.1| hypothetical protein PHAVU_003G152300g [Phaseolus vulgaris]
Length=431

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+G
Sbjct  61   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ LL  H++FIVEGD+NDA LL+KLFD+V F
Sbjct  120  LDNFNDYYDPSLKKARKSLLNTHEVFIVEGDVNDAKLLAKLFDVVAF  166



>ref|XP_003605138.1| UDP-glucuronate 4-epimerase [Medicago truncatula]
 gb|AES87335.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=440

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 110/175 (63%), Gaps = 13/175 (7%)
 Frame = +3

Query  78   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  257
            P T    K+E+  SY  RV      A      F   +  A ILIFFF    P  +     
Sbjct  15   PSTPGKFKMEK-ASYFNRVRWHASPAKLCLWSF---VFSAAILIFFF--RSPASSPLPAD  68

Query  258  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  437
              RR+L +  +        GG  WEK+V+SSA  R +NG SVLVTGAAGFVG+H S ALK
Sbjct  69   PSRRSLRSPSNW-------GGPVWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSAALK  121

Query  438  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +RGDGVLG+DNFN YYDPSLKRARQ LLE+  +FIVEGD+NDA LL KLF++VPF
Sbjct  122  RRGDGVLGIDNFNDYYDPSLKRARQALLERTGVFIVEGDINDAALLRKLFEVVPF  176



>ref|XP_004506538.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cicer arietinum]
Length=440

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 110/175 (63%), Gaps = 13/175 (7%)
 Frame = +3

Query  78   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  257
            P T    K+E+  SY  RV      A      F   +  A ILIFFF    P  +     
Sbjct  15   PSTPGKFKMEK-ASYFNRVRWHASPAKLILWSF---VFSAAILIFFF--RSPATSPLPAD  68

Query  258  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  437
              RR+L +  +        GG  WEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK
Sbjct  69   PSRRSLRSPSNW-------GGPIWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSAALK  121

Query  438  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +RGDGVLG+DNFN YYDPSLKRARQ LLE+  IFIVEGD+ND  LL KLF++VPF
Sbjct  122  RRGDGVLGIDNFNDYYDPSLKRARQALLERTGIFIVEGDINDGALLRKLFEVVPF  176



>ref|XP_010914055.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQ+++SA PRR  G SVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN+YYDPS
Sbjct  71   GGLHWEKQIRASAEPRRSQGFSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNFNSYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H IF+VEGD+ND  LL+KLFD+VPF
Sbjct  131  LKKARKSLLASHGIFVVEGDINDGRLLAKLFDVVPF  166



>ref|XP_006347877.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG AWEK++++SA  R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYDPS
Sbjct  76   GGPAWEKRIKASAKVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNDYYDPS  135

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +++VEGD+NDA LL KLFDIVPF
Sbjct  136  LKRARQALLERTGVYVVEGDINDATLLKKLFDIVPF  171



>ref|XP_006287814.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
 gb|EOA20712.1| hypothetical protein CARUB_v10001027mg [Capsella rubella]
Length=426

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 99/143 (69%), Gaps = 12/143 (8%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI IFF    Y     S+    RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFF----YRSPVSSNPDPSRRSLRTYSW--------GGPAWEKRVRSSA  79

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  80   RLRFRRGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  139

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+VEGD+NDA LL KLF++VPF
Sbjct  140  VFVVEGDINDAALLKKLFEVVPF  162



>ref|XP_011017483.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Populus euphratica]
Length=435

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +3

Query  297  LAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  476
            LA+   GGAAWEK+V++SA  R +NG SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN
Sbjct  70   LASATWGGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGIDNFN  129

Query  477  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
             YYDP+LKRARQ LLE+  +FIVEGD+ND  LL KLFDIVPF
Sbjct  130  DYYDPTLKRARQALLERGGVFIVEGDINDVALLKKLFDIVPF  171



>ref|XP_003549520.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Glycine max]
Length=431

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV++SA   RQ GMSVLVTGAAGFVGSH SLALK+RGDGV+G
Sbjct  61   SGSRYLTASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGAAGFVGSHVSLALKRRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ LL  H +FIVEGD+NDA LL+KLFD+V F
Sbjct  120  LDNFNDYYDPSLKKARKSLLATHDVFIVEGDVNDAKLLAKLFDVVAF  166



>ref|XP_009586623.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana tomentosiformis]
Length=426

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            TG+   +AT+ GG  WEKQV++SA   R NGMSVLVTGAAGFVGSH SLALKKRGDGV+G
Sbjct  56   TGNRYFSATW-GGHHWEKQVRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVG  114

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ LL  H IFI+EGD+ND  +L+KLF+IV F
Sbjct  115  LDNFNNYYDPSLKKARKNLLNNHNIFIIEGDINDMRMLTKLFEIVRF  161



>ref|XP_010523080.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523081.1| PREDICTED: UDP-glucuronate 4-epimerase 3 isoform X2 [Tarenaya 
hassleriana]
Length=435

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 98/143 (69%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + +   LI IFF+    P     S    RR+L T           GG  WEK+V+SSA
Sbjct  39   FWSLVFTGLIFIFFY--RSPSSNPISSAPSRRSLRTYSW--------GGPDWEKRVRSSA  88

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKR RQ LLE+  
Sbjct  89   RVRTRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRTRQALLERSG  148

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+ND+ LL K+F++VPF
Sbjct  149  VFIVEGDINDSALLKKIFEVVPF  171



>ref|NP_001142515.1| hypothetical protein [Zea mays]
 gb|ACG24575.1| hypothetical protein [Zea mays]
 gb|ACN27084.1| unknown [Zea mays]
 gb|AFW73831.1| hypothetical protein ZEAMMB73_770166 [Zea mays]
Length=439

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 91/113 (81%), Gaps = 7/113 (6%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  443
            T    LAA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYLAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +FIVEGD+ND  LL+KLFD+VPF
Sbjct  120  GDGVVGVDNFNAYYDPSLKKARRALLASHGVFIVEGDINDGRLLAKLFDVVPF  172



>gb|KDP28767.1| hypothetical protein JCGZ_14538 [Jatropha curcas]
Length=435

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 98/143 (69%), Gaps = 9/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V +I +FF+               RR+L T+          GG+ WEK+V+SSA
Sbjct  37   FWSLVFVGVIFLFFYRSPSSSTNPLPSDPSRRSLRTSW---------GGSDWEKRVRSSA  87

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  88   RIRSRNGFSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  147

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+ND  LL KLF++VPF
Sbjct  148  VFIVEGDINDVALLKKLFEVVPF  170



>ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis]
 gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina]
 gb|KDO85806.1| hypothetical protein CISIN_1g013602mg [Citrus sinensis]
Length=439

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 105/146 (72%), Gaps = 15/146 (10%)
 Frame = +3

Query  174  FRATLMVALILIFFF---TINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQ  344
            F + + +A+ILIFFF   + N  P A+ S    RR+L T           GG A+EK+V+
Sbjct  42   FWSFIFLAVILIFFFRSPSSNPLPSADPS----RRSLRTYDW--------GGPAFEKRVR  89

Query  345  SSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLE  524
            SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLK+ARQ LLE
Sbjct  90   SSARVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKKARQALLE  149

Query  525  KHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +  IFIVEGD+ND  LL KLFD+V F
Sbjct  150  RSGIFIVEGDINDMALLKKLFDVVSF  175



>ref|XP_004973970.1| PREDICTED: UDP-glucuronate 4-epimerase 6-like [Setaria italica]
Length=485

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/158 (52%), Positives = 104/158 (66%), Gaps = 15/158 (9%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESS--------------GGGRRRALHTTGHSLLAATF  311
            FRAT++  L L+  F ++YP L   S              G        ++  SLL +  
Sbjct  44   FRATVLATLALVVLFAVHYPSLLSRSFTLSSASPSSSSSSGSSSSPRSRSSHRSLLGSGA  103

Query  312  S-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYD  488
            S GGAAWE++V+ SATPRR  G+SVLVTGAAGFVG+HCSLAL+ RGDGV+GLDNFNAYYD
Sbjct  104  SYGGAAWEREVRRSATPRRDGGLSVLVTGAAGFVGAHCSLALRGRGDGVVGLDNFNAYYD  163

Query  489  PSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            PSLKRARQ+LL    + +++ D+ND  LL +LF   PF
Sbjct  164  PSLKRARQRLLASRGVAVLDADINDGALLERLFAAAPF  201



>ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
 ref|XP_008232642.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Prunus mume]
 gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica]
Length=435

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 100/143 (70%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + + LILIFFF    P          RR+L T           GG AWEK+V+SSA
Sbjct  39   FWSFIFLGLILIFFF--RSPSSNSLPSDPSRRSLRTYNW--------GGPAWEKRVRSSA  88

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R ++GMSVLVTGAAGFVG+H S ALK+RGDGVLGLD FN YYDPSLKRARQ LLE+  
Sbjct  89   RVRSRHGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSG  148

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+ND+ LLSKLF++V F
Sbjct  149  VFIVEGDINDSALLSKLFEVVAF  171



>ref|XP_011069826.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  303  ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAY  482
            +T  GG  WEKQV+ SA   RQNG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN Y
Sbjct  68   STAWGGIHWEKQVRDSAQIHRQNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNNY  127

Query  483  YDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            YDPSLK+AR+ LL  H +FIVEGD+NDA LL+KLF+IV F
Sbjct  128  YDPSLKKARKHLLNSHNVFIVEGDVNDARLLAKLFEIVAF  167



>ref|XP_010909513.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glucuronate 4-epimerase 3-like 
[Elaeis guineensis]
Length=469

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 102/158 (65%), Gaps = 23/158 (15%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAES--------------SGGGRRRALHTTGHSLLAATF  311
            F A L +A+    F     PP AE+              +GG  RR+L T          
Sbjct  47   FWAFLAIAVFAALFLLSPXPPSAEADPPPSSSLGGAASGNGGQHRRSLRTASW-------  99

Query  312  SGGAAWEKQVQSSATPRRQ-NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYD  488
             GG AWEK+V+SSA  RRQ  G SVLVTGAAGFVG+H S ALKKRGDGVLGLD FN YYD
Sbjct  100  -GGPAWEKRVRSSARIRRQLGGFSVLVTGAAGFVGTHVSAALKKRGDGVLGLDCFNDYYD  158

Query  489  PSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            PSLKRARQ LL++  +F+VEGD+NDA LL KLFD+VPF
Sbjct  159  PSLKRARQALLQRAGVFVVEGDVNDALLLRKLFDVVPF  196



>ref|XP_004513504.1| PREDICTED: UDP-glucuronate 4-epimerase 2-like [Cicer arietinum]
Length=426

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 101/143 (71%), Gaps = 12/143 (8%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + L V +I   FF       +++S    RR+L T  +        GG+AWEK+V+SSA
Sbjct  33   FWSILFVGIIFFLFFRTPSSFSSDTS----RRSLRTYNY--------GGSAWEKKVRSSA  80

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
                +NG++VLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYDPSLKR RQ LLE + 
Sbjct  81   RVTSKNGVTVLVTGAAGFVGTHTSIALKQRGDGVLGLDNFNDYYDPSLKRGRQALLEHNG  140

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+NDA LL KLF++V F
Sbjct  141  VFIVEGDINDATLLKKLFEVVSF  163



>ref|XP_006345514.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 101/143 (71%), Gaps = 9/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI +FF+       +  S    RR+L T+ +        GG AWEK++++SA
Sbjct  38   FWSLVFVGLIFVFFYRSPSS-SSHVSSDLFRRSLRTSSY--------GGPAWEKKIKASA  88

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
             PR  NGM VLVTGAAGFVG+H S ALK+RG+GVLGLDNFN YYDPSLKRARQ+LLE+  
Sbjct  89   KPRSSNGMCVLVTGAAGFVGTHVSAALKRRGNGVLGLDNFNDYYDPSLKRARQELLERSG  148

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            ++IVE D+NDA LL KLF+IV F
Sbjct  149  VYIVEADINDATLLKKLFEIVAF  171



>ref|XP_009800153.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nicotiana sylvestris]
Length=426

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            TG+   +AT+ GG  WEKQV++SA   R NGMSVLVTGAAGFVGSH SLALKKRGDGV+G
Sbjct  56   TGNRYFSATW-GGHHWEKQVRTSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVG  114

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDP+LK+AR+ LL  H IFI+EGD+ND  +L+KLF+IV F
Sbjct  115  LDNFNNYYDPTLKKARKNLLNDHNIFIIEGDINDMRMLAKLFEIVRF  161



>ref|XP_009596624.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nicotiana tomentosiformis]
Length=435

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 100/143 (70%), Gaps = 9/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F A + V LI +FF+         SS   RR +L T+ +        GG  WEK+++SSA
Sbjct  38   FWALVFVGLIFVFFYRSPNSVSNVSSDLSRR-SLRTSSY--------GGPVWEKKIKSSA  88

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+ VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPSLKRARQ+LLE+  
Sbjct  89   KIRSKNGICVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLKRARQELLERTG  148

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            ++IVEGD+ND  LL KLFDIV F
Sbjct  149  VYIVEGDINDVALLKKLFDIVAF  171



>ref|XP_011079342.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Sesamum indicum]
Length=432

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 83/100 (83%), Gaps = 0/100 (0%)
 Frame = +3

Query  303  ATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAY  482
            +T  GG  WEKQV+SSA   RQNG SVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN Y
Sbjct  68   STAWGGIQWEKQVRSSAQIHRQNGFSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNY  127

Query  483  YDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            YDP LKRAR+ LL  H +FIVEGD+NDA +L+KLF+IV F
Sbjct  128  YDPVLKRARRDLLSSHNVFIVEGDVNDARMLAKLFEIVAF  167



>ref|XP_011034154.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Populus euphratica]
Length=431

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = +3

Query  294  LLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNF  473
            L +AT+ GGAAWEK+V++SA  R +NG SVLVTGAAGFVG+H S ALK+RGDGVLGLDNF
Sbjct  66   LTSATW-GGAAWEKRVRTSARIRSRNGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNF  124

Query  474  NAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            N YYDP+LKRARQ LLE+  +FIVEGD+ND  LL KLF++VPF
Sbjct  125  NDYYDPTLKRARQALLERSGVFIVEGDINDVSLLKKLFEVVPF  167



>ref|XP_006853046.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
 gb|ERN14513.1| hypothetical protein AMTR_s00038p00035160 [Amborella trichopoda]
Length=439

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 84/109 (77%), Gaps = 1/109 (1%)
 Frame = +3

Query  276  HTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGV  455
            H  G +  AA++ GG AWEKQ++ S   RR N   VLVTGAAGF+G+H SLALKKRGDGV
Sbjct  66   HARGATTAAASW-GGPAWEKQLRRSCETRRANAQVVLVTGAAGFIGTHVSLALKKRGDGV  124

Query  456  LGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LGLDNFN YYDPSLKRARQ LL +H IF+ EGD+ND  LLSKL D VPF
Sbjct  125  LGLDNFNDYYDPSLKRARQSLLARHGIFVAEGDINDGALLSKLLDFVPF  173



>ref|XP_004954186.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=439

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 7/113 (6%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  443
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  120  GDGVVGIDNFNAYYDPSLKKARKALLSSHGVFVVEGDINDGRLLAKLFDVVPF  172



>ref|XP_010929207.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Elaeis guineensis]
Length=432

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            T    L+A++ GG  WEKQ++ SA  RR +G+SVLVTGAAGFVGSH S+AL KRGDGV+G
Sbjct  61   TSSKYLSASW-GGLHWEKQIRVSAEVRRAHGISVLVTGAAGFVGSHVSIALHKRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN+YYDPSLK+AR+ LL  H IF+VEGD+ND  LLSKLFD+VPF
Sbjct  120  LDNFNSYYDPSLKKARKSLLASHGIFVVEGDINDGRLLSKLFDVVPF  166



>ref|XP_010278008.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Nelumbo nucifera]
Length=433

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            TG   L A++ GG  WEKQV++SA  RR  G SVLVTG AGFVG+H SLALKKRGDGV+G
Sbjct  61   TGSRYLTASW-GGIQWEKQVRTSAEIRRSGGFSVLVTGGAGFVGTHVSLALKKRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR+ LL  H IF+VEGD+NDA LL+KLFD+V F
Sbjct  120  LDNFNNYYDPSLKRARKTLLNNHGIFVVEGDINDARLLAKLFDVVAF  166



>ref|XP_010053904.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Eucalyptus grandis]
 gb|KCW78281.1| hypothetical protein EUGRSUZ_D02464 [Eucalyptus grandis]
Length=436

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GGAAWEK+V+SSA  R +NGMSVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  77   GGAAWEKRVRSSARIRSRNGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPS  136

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +FIVEGD+ND  LL KLF++V F
Sbjct  137  LKRARQALLERAGVFIVEGDINDEALLRKLFEVVAF  172



>ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
Length=438

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 101/143 (71%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + +++  ILIFFF         S     RR+L T           GG AWEK+V+SSA
Sbjct  42   FWSLVILGSILIFFFRSPSSSPLPSDHS--RRSLSTYDW--------GGPAWEKRVRSSA  91

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYD SLKRARQ LLE+  
Sbjct  92   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYDQSLKRARQALLERTG  151

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+VEGD+ND+ LL KLF++VPF
Sbjct  152  VFVVEGDINDSALLKKLFEVVPF  174



>ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus]
 gb|KGN56607.1| UDP-glucuronate 4-epimerase 3 [Cucumis sativus]
Length=432

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 101/143 (71%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + +++  ILIFFF         S     RR+L T           GG AWEK+V+SSA
Sbjct  36   FWSLVILGSILIFFFRSPSSSPLPSDHS--RRSLSTYDW--------GGPAWEKRVRSSA  85

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYD SLKRARQ LLE+  
Sbjct  86   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYDQSLKRARQALLERTG  145

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+VEGD+ND+ LL KLF++VPF
Sbjct  146  VFVVEGDINDSALLKKLFEVVPF  168



>ref|XP_002452964.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
 gb|EES05940.1| hypothetical protein SORBIDRAFT_04g035630 [Sorghum bicolor]
Length=439

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 7/113 (6%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  443
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  120  GDGVVGVDNFNAYYDPSLKKARKALLASHGVFVVEGDINDGRLLAKLFDVVPF  172



>gb|EPS60141.1| hypothetical protein M569_14661, partial [Genlisea aurea]
Length=429

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  267  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  446
            +A   +G    + T+ GG  WE+QV++SA  RRQNG SVLVTGAAGFVGSH SLALKKRG
Sbjct  55   KACVDSGSRYFSTTW-GGGHWERQVRASAQIRRQNGFSVLVTGAAGFVGSHVSLALKKRG  113

Query  447  DGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            DGV+GLDNFN+YYDPSLKRAR+++L   +IF+VEGD+ND  +L+KLF+I  F
Sbjct  114  DGVVGLDNFNSYYDPSLKRARKRILNSREIFVVEGDINDGRMLAKLFEIADF  165



>ref|XP_004162690.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
Length=431

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQV+ SA P R NG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN+YYDPS
Sbjct  71   GGIQWEKQVRISAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H IFIV+GD+ND  LL KLFD+V F
Sbjct  131  LKKARKSLLSNHGIFIVDGDINDVRLLDKLFDVVVF  166



>ref|XP_010424029.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like, partial [Camelina 
sativa]
Length=256

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 101/143 (71%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI IFF+    P +++      RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFFY--RSPLVSDDPTSTSRRSLRTYSW--------GGPAWEKRVRSSA  81

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  82   RLRSRRGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  141

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+VEGD+NDA LL KLF++VPF
Sbjct  142  VFVVEGDINDAALLKKLFEVVPF  164



>ref|XP_004240046.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 100/143 (70%), Gaps = 9/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI +FF+       +  S    RR+L T+ +        GG AWEK++++S 
Sbjct  38   FWSLVFVGLIFVFFYRSPSS-SSHVSSDLFRRSLRTSSY--------GGPAWEKKIKAST  88

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
             PR  NG+ VLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ+LLE+  
Sbjct  89   KPRSSNGLCVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQELLERSG  148

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            ++IVE D+NDA LL KLF+IV F
Sbjct  149  VYIVEADINDATLLKKLFEIVAF  171



>ref|XP_010268405.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nelumbo nucifera]
Length=431

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQV++SA  RR  GMSVLVTG AGFVG+H SLALKKRGDGV+GLDNFN YYDPS
Sbjct  69   GGIQWEKQVRTSAQIRRSGGMSVLVTGGAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPS  128

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H IF+VEGD+NDA LL+KLFDIV F
Sbjct  129  LKKARKALLNNHGIFVVEGDINDARLLAKLFDIVAF  164



>ref|XP_008649176.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Zea mays]
Length=440

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 86/102 (84%), Gaps = 6/102 (6%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  476
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGVLGLDNFN
Sbjct  71   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVLGLDNFN  130

Query  477  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  131  SYYDPSLKKARRALLGSHGVFVVEGDINDGRLLAKLFDVVPF  172



>ref|XP_006286788.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
 gb|EOA19686.1| hypothetical protein CARUB_v10003353mg [Capsella rubella]
Length=438

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +3

Query  264  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
            RR L+ +  S+ AA + GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  61   RRNLNDSSSSVSAAKY-GGSHWEKQVRKSARPRTHGGLTVLVTGASGFVGTHVSIALRRR  119

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V F
Sbjct  120  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLFDVVLF  172



>ref|XP_008465609.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Cucumis melo]
Length=431

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQV+ SA P R NG SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN+YYDPS
Sbjct  71   GGIQWEKQVRVSAQPHRTNGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H IF+V+GD+ND  LL KLFD+V F
Sbjct  131  LKKARKSLLSNHGIFVVDGDINDVRLLDKLFDVVVF  166



>dbj|BAJ85817.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96031.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96148.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88803.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08139.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 7/113 (6%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  443
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGA+GFVG+HCSLAL+KR
Sbjct  62   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGASGFVGAHCSLALRKR  120

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  121  GDGVVGIDNFNAYYDPSLKKARKALLSSHGVFVVEGDINDGRLLAKLFDVVPF  173



>emb|CDX94504.1| BnaC09g23320D [Brassica napus]
Length=435

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 3/113 (3%)
 Frame = +3

Query  264  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
            RR+L+ +  SL AA + GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSAAKY-GGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V F
Sbjct  118  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLFDVVLF  170



>ref|NP_001105911.1| LOC732831 [Zea mays]
 gb|ABB51650.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 7/113 (6%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  443
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL++R
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRR  119

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  120  GDGVVGVDNFNAYYDPSLKKARRALLASHGVFVVEGDINDGRLLAKLFDVVPF  172



>ref|XP_008438174.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Cucumis melo]
Length=432

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 101/143 (71%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + +++  ILIFFF         S     RR+L T           GG +WEK+V+SSA
Sbjct  36   FWSLVILGSILIFFFRSPSSSPLPSDHS--RRSLSTYDW--------GGPSWEKRVRSSA  85

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S+ALK+RGDGVLGLDNFN YYD SLKRARQ LLE+  
Sbjct  86   RVRSRNGISVLVTGAAGFVGTHVSVALKRRGDGVLGLDNFNNYYDQSLKRARQALLERTG  145

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+VEGD+ND+ LL KLF++VPF
Sbjct  146  VFVVEGDINDSALLKKLFEVVPF  168



>ref|XP_002309376.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
 gb|EEE92899.1| hypothetical protein POPTR_0006s19240g [Populus trichocarpa]
Length=431

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            TG   L A++ GG  WEKQ++ SA   R NGMSVLVTGAAGFVGSH SLALKKRGDGV+G
Sbjct  61   TGSRYLTASW-GGIQWEKQIRHSAQIHRSNGMSVLVTGAAGFVGSHVSLALKKRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +DNFN YYDPSLKRAR+ LL    IFIVEGD+NDA L++KLFD V F
Sbjct  120  IDNFNNYYDPSLKRARKSLLNNQGIFIVEGDINDARLIAKLFDTVAF  166



>ref|XP_007134861.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
 gb|ESW06855.1| hypothetical protein PHAVU_010G082300g [Phaseolus vulgaris]
Length=432

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 110/175 (63%), Gaps = 14/175 (8%)
 Frame = +3

Query  78   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  257
            P T    K+E+  SY  RV     +A  +   F   + +  ILIFFF    P  +     
Sbjct  8    PSTPGKFKMEK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFFF--RSPASSPVPAD  61

Query  258  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  437
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  62   LSRRSLRTYNW--------GGPVWEKRVRASARVRSRNGFAVLVTGAAGFVGTHVSAALK  113

Query  438  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +RGDGVLG+DNFN YYDPSLKRARQ LLE+  ++IVEGD+ND  LL KLF++VPF
Sbjct  114  RRGDGVLGIDNFNEYYDPSLKRARQLLLERTGVYIVEGDINDEALLRKLFEVVPF  168



>ref|XP_010692224.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Beta vulgaris subsp. 
vulgaris]
Length=450

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 113/176 (64%), Gaps = 2/176 (1%)
 Frame = +3

Query  78   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  257
            P T    K+E+    I      +L    +KL F   + V LIL+F    +      +S  
Sbjct  11   PSTPGKFKMEKSGYNIHHQYHHRLRWPVAKLTFWCCIFVGLILVFMLRSSSSSSYSASDY  70

Query  258  GRRRALHTTGHSLLAATFS-GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLAL  434
              + ++ +T HS    TFS GG +WEK+V++S   R  NG SVLVTGAAGFVG+H S AL
Sbjct  71   RDKDSI-STRHSRSLRTFSWGGPSWEKRVRNSGRVRAPNGFSVLVTGAAGFVGTHVSAAL  129

Query  435  KKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            K+RGDGVLGLDNFN YYDPSLKRARQ LL++  +FIV+GD+ND PLL KLF +VPF
Sbjct  130  KRRGDGVLGLDNFNDYYDPSLKRARQALLDRSGVFIVQGDINDEPLLKKLFQLVPF  185



>ref|XP_008677814.1| PREDICTED: LOC732831 isoform X1 [Zea mays]
 gb|ACF78800.1| unknown [Zea mays]
 gb|ACN28799.1| unknown [Zea mays]
 gb|ACR36221.1| unknown [Zea mays]
 gb|AFW64179.1| UDP-glucuronic acid 4-epimerase [Zea mays]
Length=440

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 7/113 (6%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  443
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL++R
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRR  119

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+G+DNFNAYYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  120  GDGVVGVDNFNAYYDPSLKKARRALLASHGVFVVEGDINDGRLLAKLFDVVPF  172



>ref|XP_004144711.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis sativus]
 gb|KGN61076.1| UDP-glucuronate 5-epimerase [Cucumis sativus]
Length=431

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQV+ SA P R NG SV+VTGAAGFVGSH SLALKKRGDGV+GLDNFN+YYDPS
Sbjct  71   GGIQWEKQVRISAQPHRTNGFSVVVTGAAGFVGSHVSLALKKRGDGVVGLDNFNSYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H IFIV+GD+ND  LL KLFD+V F
Sbjct  131  LKKARKSLLSNHGIFIVDGDINDVRLLDKLFDVVVF  166



>ref|NP_001048359.1| Os02g0791500 [Oryza sativa Japonica Group]
 dbj|BAD19123.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 dbj|BAD19172.1| putative nucleotide sugar epimerase [Oryza sativa Japonica Group]
 gb|ABC59069.1| UDP-glucuronic acid 4-epimerase isoform 2 [Oryza sativa Japonica 
Group]
 dbj|BAF10273.1| Os02g0791500 [Oryza sativa Japonica Group]
 gb|EAY87821.1| hypothetical protein OsI_09239 [Oryza sativa Indica Group]
 gb|EAZ24901.1| hypothetical protein OsJ_08679 [Oryza sativa Japonica Group]
Length=437

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 7/113 (6%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  443
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+G+DNFN+YYDPSLK+AR+ LL  H +F++EGD+ND  LL+KLFD+VPF
Sbjct  120  GDGVVGIDNFNSYYDPSLKKARRSLLASHGVFVIEGDINDGRLLAKLFDVVPF  172



>ref|XP_010433651.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Camelina sativa]
Length=436

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +3

Query  264  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
            RR L+ +  S+ AA + GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  62   RRNLNDSSSSVSAAKY-GGSHWEKQVRKSARPRSPGGLTVLVTGASGFVGTHVSIALRRR  120

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V F
Sbjct  121  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLF  173



>ref|XP_004507780.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cicer arietinum]
Length=432

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTG+A FVGSH SLALK+RGDGV+G
Sbjct  64   SGSRYLSASW-GGIQWEKQVRTSAQIHRQGGMSVLVTGSACFVGSHVSLALKRRGDGVVG  122

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ LL  H +FIVEGD+NDA LL+KLFD+V F
Sbjct  123  LDNFNDYYDPSLKKARKTLLSSHGVFIVEGDINDAKLLAKLFDVVAF  169



>ref|XP_006648037.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Oryza brachyantha]
Length=437

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 7/113 (6%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  443
            T     AA++ GG  WE+Q+++SA PRR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  61   TSSKYFAASW-GGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  119

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+G+DNFN+YYDPSLK+AR+ LL  H +F++EGD+ND  LL+KLFD+VPF
Sbjct  120  GDGVVGIDNFNSYYDPSLKKARRSLLASHGVFVIEGDINDGRLLAKLFDVVPF  172



>emb|CDY63064.1| BnaAnng18570D [Brassica napus]
Length=430

 Score =   151 bits (382),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG AWEK+V+SSA  R + G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  71   GGPAWEKRVRSSAHVRTRRGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +F+VEGD+NDA LL KLF++VPF
Sbjct  131  LKRARQALLERSGVFVVEGDINDAALLKKLFEVVPF  166



>ref|XP_009409770.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WE+Q+++SA  RR++G++VLVTGAAGFVG+H SLAL++RGDGV+GLDNFNAYYDPS
Sbjct  73   GGLHWERQIRASAAVRREDGIAVLVTGAAGFVGTHVSLALRRRGDGVVGLDNFNAYYDPS  132

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H +F+VEGD+NDA LL+KLFD VPF
Sbjct  133  LKKARKALLASHGVFVVEGDVNDARLLAKLFDTVPF  168



>ref|XP_009111519.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Brassica rapa]
Length=430

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG AWEK+V+SSA  R + G+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  71   GGPAWEKRVRSSAHVRTRRGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +F+VEGD+NDA LL KLF++VPF
Sbjct  131  LKRARQALLERSGVFVVEGDINDAALLKKLFEVVPF  166



>emb|CDO97699.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 100/144 (69%), Gaps = 9/144 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAES-SGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSS  350
            F + + + LI +FFF        ES +    RR+L T+ +        GG  WEK++++S
Sbjct  38   FWSFVFLGLIFVFFFRSPSSSSPESLTADPSRRSLRTSSY--------GGPDWEKRIKAS  89

Query  351  ATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKH  530
            A  R +NGMSVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYD SLKRARQ LLE+ 
Sbjct  90   AKVRSRNGMSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDQSLKRARQALLERS  149

Query  531  QIFIVEGDLNDAPLLSKLFDIVPF  602
             ++IVEGD+ND  LL KLFDIV F
Sbjct  150  GVYIVEGDINDVALLKKLFDIVQF  173



>gb|KEH32594.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=434

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L+A++ GG  WEKQV++SA   RQ GMSVLVTGAAGF+GSH SLALK+RGDGV+G
Sbjct  65   SGSRYLSASW-GGIQWEKQVRASAQIHRQGGMSVLVTGAAGFIGSHVSLALKRRGDGVVG  123

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ LL+   +FIV GDLNDA LL+KLFD+V F
Sbjct  124  LDNFNDYYDPSLKKARKALLQSRGVFIVHGDLNDAKLLAKLFDVVAF  170



>emb|CDX86716.1| BnaA09g21060D [Brassica napus]
Length=434

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = +3

Query  264  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
            RR+L+ +  SL +A   GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSSAAKYGGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  118

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KL+D+V F
Sbjct  119  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLYDVVLF  171



>ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 110/175 (63%), Gaps = 14/175 (8%)
 Frame = +3

Query  78   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  257
            P T    K+E+  SY  RV     +A  +   F   + +  ILIFF  +  P  +     
Sbjct  14   PSTPGKFKMEK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFF--LRSPASSPVPAD  67

Query  258  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  437
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  68   LSRRSLRTYNW--------GGPVWEKRVRASAQIRSRNGFAVLVTGAAGFVGTHVSAALK  119

Query  438  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +RGDGVLGLDNFN YYDPSLKRARQ LLE+  ++IVEGD+ND  LL KLF++VPF
Sbjct  120  RRGDGVLGLDNFNDYYDPSLKRARQGLLERSGVYIVEGDINDEALLRKLFEVVPF  174



>ref|XP_002281007.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=433

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPS
Sbjct  74   GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPS  133

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +FIVEGD+ND+ LL KLFD+V F
Sbjct  134  LKRARQALLERTGVFIVEGDINDSELLKKLFDVVTF  169



>gb|KJB24820.1| hypothetical protein B456_004G162700 [Gossypium raimondii]
Length=433

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  74   GGPAWEKRVRSSARIRSRNGISVLVTGAAGFVGTHVSTALKRRGDGVLGLDNFNDYYDPS  133

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LL++  +F+VEGD+ND+ LL KLF++VPF
Sbjct  134  LKRARQALLDRTGVFVVEGDINDSTLLRKLFEVVPF  169



>ref|XP_004248561.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum lycopersicum]
Length=435

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 97/143 (68%), Gaps = 8/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + + LI I FF       +  S    RR+L T+ +         G AWEK++++SA
Sbjct  37   FWSFVFLGLIFICFFKSTSSSSSPVSSDLSRRSLRTSSYD--------GPAWEKRIKASA  88

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R  NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPSLKRARQ LLE   
Sbjct  89   KIRSTNGISVLVTGAAGFVGTHVSSALKRRGDGVVGLDNFNDYYDPSLKRARQTLLESAG  148

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            ++IVEGD+ND  LL KLFDIV F
Sbjct  149  VYIVEGDINDVALLKKLFDIVQF  171



>ref|XP_008354844.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Malus domestica]
Length=432

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 98/143 (69%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + + +ILIFFF    P          RR+L T           GG AWEK V+SSA
Sbjct  36   FWSFVFLGMILIFFF--RSPSSNSLPSDPSRRSLRTYNW--------GGPAWEKXVRSSA  85

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R ++G+SVLVTGAAGFVG+H S ALK+RGDGVLGLD FN YYDPSLKRARQ LLE+  
Sbjct  86   RVRSRHGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDCFNDYYDPSLKRARQALLERSG  145

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+ND  LLSKLF++V F
Sbjct  146  VFIVEGDINDVTLLSKLFEVVAF  168



>gb|AAM61323.1| nucleotide sugar epimerase, putative [Arabidopsis thaliana]
Length=419

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 100/143 (70%), Gaps = 13/143 (9%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + +   L+ IFF+     P+  S+    RR+L T           GG AWEK+V+SSA
Sbjct  23   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPAWEKRVRSSA  69

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYD SLKR+RQ LLE+  
Sbjct  70   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLKRSRQALLERSG  129

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+ND  LL KLF++VPF
Sbjct  130  VFIVEGDINDLSLLKKLFEVVPF  152



>gb|ADB24771.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
 gb|KJB22312.1| hypothetical protein B456_004G040600 [Gossypium raimondii]
Length=435

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG AWEK+V+SSA  R +NG SVLVTGAAGFVG+H S ALKKRGDGVLGLDNFN YYDPS
Sbjct  76   GGPAWEKRVRSSARVRSRNGFSVLVTGAAGFVGTHVSSALKKRGDGVLGLDNFNDYYDPS  135

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ+LLE+  +FIVEGD+ND+ LL KLF++V F
Sbjct  136  LKRARQELLERSGVFIVEGDINDSALLMKLFEVVAF  171



>gb|ACJ11754.1| UDP-D-glucuronic acid 4-epimerase [Gossypium hirsutum]
Length=431

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = +3

Query  261  RRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKK  440
            R ++   +G    +A++ GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKK
Sbjct  54   RFQSFVDSGSRYFSASW-GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKK  112

Query  441  RGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            RGDGV+GLDNFN YYDPSLK+AR+ LL  H I +VEGDLNDA LL+KLFD+V F
Sbjct  113  RGDGVVGLDNFNNYYDPSLKKARKSLLNSHGILVVEGDLNDAKLLAKLFDVVAF  166



>ref|XP_009784108.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nicotiana sylvestris]
Length=435

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 100/143 (70%), Gaps = 9/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI +FF+         SS   RR +L T+ +        GG  WEK+++SSA
Sbjct  38   FWSLVFVGLIFVFFYRSPNSVSNVSSDLSRR-SLRTSSY--------GGPVWEKKIKSSA  88

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+ VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPSLKRARQ+LLE+  
Sbjct  89   KIRSKNGICVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPSLKRARQELLERSG  148

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            ++IVEGD+ND  LL KLF++V F
Sbjct  149  VYIVEGDINDVALLKKLFEVVAF  171



>ref|NP_171702.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
 sp|Q9LPC1.1|GAE2_ARATH RecName: Full=UDP-glucuronate 4-epimerase 2; AltName: Full=UDP-glucuronic 
acid epimerase 2 [Arabidopsis thaliana]
 gb|AAF76478.1|AC020622_12 Contains similarity to CAPI protein from Staphylococcus aureus 
gi|P39858 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain. ESTs gb|N97076, gb|AI997010 come from this 
gene [Arabidopsis thaliana]
 gb|AAG50112.1|AF334734_1 putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE27364.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis thaliana]
Length=434

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 100/143 (70%), Gaps = 13/143 (9%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + +   L+ IFF+     P+  S+    RR+L T           GG AWEK+V+SSA
Sbjct  38   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPAWEKRVRSSA  84

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYD SLKR+RQ LLE+  
Sbjct  85   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLKRSRQALLERSG  144

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+ND  LL KLF++VPF
Sbjct  145  VFIVEGDINDLSLLKKLFEVVPF  167



>dbj|BAK06545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=443

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 85/102 (83%), Gaps = 6/102 (6%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  476
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN
Sbjct  74   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFN  133

Query  477  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
             YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  134  KYYDPSLKKARRALLASHGVFVVEGDINDGRLLTKLFDVVPF  175



>gb|AFW85530.1| hypothetical protein ZEAMMB73_797483 [Zea mays]
Length=413

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 88/102 (86%), Gaps = 6/102 (6%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQN------GMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  476
            GG  WE+Q+++SA+PRR++      G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+D+FN
Sbjct  49   GGLHWERQIRASASPRRRSAPGAPAGLSVLVTGAAGFVGAHCSLALRKRGDGVVGIDSFN  108

Query  477  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  109  SYYDPSLKKARRALLGSHGVFVVEGDINDGRLLAKLFDVVPF  150



>ref|XP_010661665.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Vitis vinifera]
Length=427

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 8/113 (7%)
 Frame = +3

Query  264  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
            RR+L T  HS       GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+R
Sbjct  59   RRSLRT--HSW------GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRR  110

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+GLDNFN YYDPSLKRARQ LLE+  +FIVEGD+ND+ LL KLF++V F
Sbjct  111  GDGVIGLDNFNDYYDPSLKRARQALLERTGVFIVEGDINDSKLLKKLFEVVAF  163



>gb|KJB76605.1| hypothetical protein B456_012G096800 [Gossypium raimondii]
Length=431

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G    +A++ GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  61   SGSRYFSASW-GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ LL  H I +VEGDLNDA LL+KLFD+V F
Sbjct  120  LDNFNNYYDPSLKKARKSLLNSHGILVVEGDLNDAKLLAKLFDVVAF  166



>ref|XP_011090565.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
 ref|XP_011090567.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=432

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 99/143 (69%), Gaps = 9/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + + LI +FF+       +  S   RR          L  ++ GG  +E++V++SA
Sbjct  35   FWSLVFLGLIFVFFYRSPSSSSSAPSDLSRRS---------LRTSYYGGPNFERRVRASA  85

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  86   KIRSRNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  145

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            ++IVEGD+ND  LL KLFDIVPF
Sbjct  146  VYIVEGDINDVSLLKKLFDIVPF  168



>ref|XP_009786918.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana sylvestris]
Length=431

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  61   SGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ LL    IFIVEGD+NDA +L+KLFDIV F
Sbjct  120  LDNFNNYYDPSLKKARKNLLNSQNIFIVEGDINDARMLAKLFDIVAF  166



>ref|XP_009789635.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana sylvestris]
Length=445

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 98/139 (71%), Gaps = 7/139 (5%)
 Frame = +3

Query  186  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  365
            L +  I++FFF   + P    + G  RR+L  T    ++   + G  WE++V++SA PR 
Sbjct  50   LFICFIVLFFF---FSPPTSPAAGNNRRSLKNT----VSPPAALGPNWERRVRASARPRS  102

Query  366  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIV  545
            + G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN YYD  LK+AR  LLE+  I+IV
Sbjct  103  KTGFTVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNHYYDVGLKKARMGLLERSGIYIV  162

Query  546  EGDLNDAPLLSKLFDIVPF  602
            +GD+NDA LL KLFD VPF
Sbjct  163  DGDINDAVLLKKLFDAVPF  181



>ref|XP_003521958.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max]
Length=438

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 111/175 (63%), Gaps = 14/175 (8%)
 Frame = +3

Query  78   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  257
            P T    K+++  SY  RV     +A  +   F   + +  ILIFF  +  P  +     
Sbjct  14   PPTPGKFKMDK-ASYFNRVRWHTSLAKLAVWSF---VFLGAILIFF--LRSPASSPVPAD  67

Query  258  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  437
              RR+L T           GG  WEK+V++SA  R +NG +VLVTGAAGFVG+H S ALK
Sbjct  68   LSRRSLRTYNW--------GGPVWEKRVRASAQVRSRNGFAVLVTGAAGFVGTHVSAALK  119

Query  438  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +RGDGVLGLDNFN YYDPSLKRARQ LLE++ ++IVEGD+ND  LL KLF++VPF
Sbjct  120  RRGDGVLGLDNFNDYYDPSLKRARQGLLERNGVYIVEGDINDEALLRKLFEVVPF  174



>ref|XP_003564175.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Brachypodium distachyon]
Length=441

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 85/102 (83%), Gaps = 6/102 (6%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  476
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN
Sbjct  72   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFN  131

Query  477  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
             YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  132  KYYDPSLKKARRALLASHGVFVVEGDINDGRLLAKLFDVVPF  173



>emb|CDP21367.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQV+SSA   R NG SVLVTGAAGFVGSH SLALKKRGDGV+G DNFN YYDP 
Sbjct  72   GGHHWEKQVKSSAQIHRANGFSVLVTGAAGFVGSHVSLALKKRGDGVVGFDNFNNYYDPL  131

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H +FIVEGD+NDA L++KLFDIV F
Sbjct  132  LKKARKALLNSHNVFIVEGDVNDAKLIAKLFDIVEF  167



>ref|XP_010539945.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Tarenaya hassleriana]
Length=437

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 1/112 (1%)
 Frame = +3

Query  267  RALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRG  446
            R L+ +  S+  AT+ GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL +RG
Sbjct  62   RNLNKSSSSVSPATY-GGSQWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALHRRG  120

Query  447  DGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            DGVLGLDNFN YYDP LKRARQ LLE+  +F+V+GD+NDA LL KLFD+V F
Sbjct  121  DGVLGLDNFNHYYDPKLKRARQGLLERTGVFVVDGDINDAVLLRKLFDVVLF  172



>ref|XP_008781382.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Phoenix dactylifera]
Length=432

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQ+++SA  RR  G+SVLVTGAAGFVGSH SLAL+KRGDGV+GLDNFN YYDPS
Sbjct  71   GGLHWEKQIRASAEVRRPQGISVLVTGAAGFVGSHVSLALRKRGDGVVGLDNFNTYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H I +VEGD+ND  LL+KLFD+VPF
Sbjct  131  LKKARKSLLVSHGIVVVEGDINDGRLLAKLFDVVPF  166



>ref|XP_007013947.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
 gb|EOY31566.1| UDP-D-glucuronate 4-epimerase 1 [Theobroma cacao]
Length=433

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV+SS+   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  63   SGSRYLTASW-GGIQWEKQVRSSSQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  121

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ LL  H I ++EGDLNDA LL+KLFD+V F
Sbjct  122  LDNFNNYYDPSLKKARKSLLISHGILVIEGDLNDAKLLAKLFDVVAF  168



>ref|XP_006396783.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
 gb|ESQ38236.1| hypothetical protein EUTSA_v10028672mg [Eutrema salsugineum]
Length=435

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 3/113 (3%)
 Frame = +3

Query  264  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
            RR L+ +  S+ AA + GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRNLYDS--SVSAAKY-GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V F
Sbjct  118  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLF  170



>ref|XP_010276827.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Nelumbo nucifera]
Length=438

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG +WEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  78   GGPSWEKRVRSSARVRSRNGLSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPS  137

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +F+VEGD+ND+ LL KLFD+V F
Sbjct  138  LKRARQALLERTGVFVVEGDINDSALLRKLFDVVAF  173



>ref|XP_010103125.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
 gb|EXB94890.1| UDP-glucuronate 4-epimerase 1 [Morus notabilis]
Length=432

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G    +A++ GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  61   SGSRYFSASW-GGIQWEKQVRTSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ +L  H IFIVEGD+ND+ LL KLFD+V F
Sbjct  120  LDNFNNYYDPSLKKARKSMLNGHGIFIVEGDINDSRLLDKLFDVVAF  166



>ref|XP_010264164.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Nelumbo nucifera]
Length=438

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLG+DNFN YYDPS
Sbjct  78   GGPAWEKRVRSSARVRARNGLSVLVTGAAGFVGTHVSAALKRRGDGVLGVDNFNDYYDPS  137

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +F+VEGD+ND+ LL KLFD+V F
Sbjct  138  LKRARQALLERTGVFVVEGDINDSALLRKLFDVVAF  173



>ref|XP_009348282.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Pyrus x bretschneideri]
Length=432

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQV++SA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+G+DNFN+YYDPS
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGIDNFNSYYDPS  131

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LLE H +FIVEGD+ND  LL KLFD V F
Sbjct  132  LKKARRSLLETHGVFIVEGDINDNRLLDKLFDTVAF  167



>ref|XP_002437985.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
 gb|EER89352.1| hypothetical protein SORBIDRAFT_10g005920 [Sorghum bicolor]
Length=440

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 85/102 (83%), Gaps = 6/102 (6%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  476
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DNFN
Sbjct  71   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGTHCSLALRKRGDGVVGIDNFN  130

Query  477  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
             YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  131  NYYDPSLKKARRALLGSHGVFVVEGDINDGRLLAKLFDVVPF  172



>ref|XP_009600710.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Nicotiana tomentosiformis]
Length=431

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L++T+ G   WEKQV+ SA   R NGMSVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  61   SGTRYLSSTW-GSLHWEKQVRDSAQIHRVNGMSVLVTGAAGFVGTHVSLALKKRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDP+LK+AR+ LL    IFIVEGD+NDA +L+KLFDIV F
Sbjct  120  LDNFNNYYDPTLKKARKNLLNSQNIFIVEGDINDARMLAKLFDIVAF  166



>ref|XP_002280967.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Vitis vinifera]
Length=433

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPS
Sbjct  74   GGPAWEKRVRSSAKVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVVGLDNFNDYYDPS  133

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +FIVEGD+ND+ LL KLF++V F
Sbjct  134  LKRARQALLERTGVFIVEGDINDSELLRKLFEVVAF  169



>ref|XP_010413058.1| PREDICTED: UDP-glucuronate 4-epimerase 4-like, partial [Camelina 
sativa]
Length=234

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQ--NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYD  488
            GG AWEK+++SSA  R    NG++VLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYD
Sbjct  78   GGPAWEKRIRSSARIRTSTTNGITVLVTGAAGFVGTHVSAALKRRGDGVIGLDNFNDYYD  137

Query  489  PSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            PSLKRARQ LLE+  IFIVEGD+ND  LL KLF IV F
Sbjct  138  PSLKRARQALLERSSIFIVEGDINDVELLRKLFKIVSF  175



>ref|XP_009390535.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQ+++SAT RR  G SVLVTGAAGFVG+H SLAL+KRGDGV+GLDN N+YYDPS
Sbjct  71   GGMQWEKQIRASATVRRPGGFSVLVTGAAGFVGTHVSLALRKRGDGVVGLDNLNSYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR  LL+   +F+VEGD+NDA LL+KLFD+VPF
Sbjct  131  LKKARVALLDSRGVFVVEGDINDARLLAKLFDVVPF  166



>ref|XP_008794398.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Phoenix dactylifera]
Length=432

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            T    L+A++ GG  WEKQ++ SA  RR  G+SVLVTGAAGFVGSH S+AL KRGDGV+G
Sbjct  61   TSSKYLSASW-GGLHWEKQIRVSAEVRRPQGISVLVTGAAGFVGSHVSIALHKRGDGVVG  119

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN+YYDPSLK+AR+ LL+   IF+VEGD+ND  LL+KLFD+VPF
Sbjct  120  LDNFNSYYDPSLKKARKSLLDSQGIFVVEGDVNDGRLLAKLFDVVPF  166



>emb|CDY04398.1| BnaC02g28500D [Brassica napus]
Length=429

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG+ WEKQV+ SA PR   G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN YYDP 
Sbjct  69   GGSHWEKQVRKSACPRSSGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPK  128

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V F
Sbjct  129  LKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLF  164



>ref|XP_004966666.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Setaria italica]
Length=440

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 86/102 (84%), Gaps = 6/102 (6%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  476
            GG  WE+Q++SSA+PRR        G+SVLVTGAAGFVG+HC+LAL++RGDGV+G+DNFN
Sbjct  71   GGLHWERQIRSSASPRRPPGSAEGAGLSVLVTGAAGFVGTHCALALRRRGDGVVGIDNFN  130

Query  477  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  131  SYYDPSLKKARRALLGSHGVFVVEGDVNDGRLLAKLFDVVPF  172



>ref|XP_010525760.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Tarenaya hassleriana]
Length=431

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L+A++ GG  WEKQV++SA   R  G+SVLVTGAAGFVGSH SLALKKRGDG +G
Sbjct  58   SGSKYLSASW-GGIQWEKQVRTSAEIHRSGGISVLVTGAAGFVGSHVSLALKKRGDGAVG  116

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLND+ LL+KLFD+V F
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDSKLLAKLFDVVAF  163



>gb|KGN65261.1| hypothetical protein Csa_1G277970 [Cucumis sativus]
Length=432

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L+A++ GG  WEKQV++SA   R  GMSVLVTGA+GFVG+H SLALK+RGDGV+G
Sbjct  62   SGTRYLSASW-GGLQWEKQVRTSAEITRSGGMSVLVTGASGFVGTHVSLALKRRGDGVVG  120

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ L+ +H +F++EGD+NDA LL KLFDIV F
Sbjct  121  LDNFNNYYDPSLKKARKALVNRHGVFVIEGDINDARLLDKLFDIVAF  167



>ref|XP_008372097.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Malus domestica]
Length=432

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQV++SA   R  GMSVL+TGAAGFVGSH SLALKKRGDGV+G+DNFN+YYDPS
Sbjct  72   GGIQWEKQVRNSAQIHRSGGMSVLITGAAGFVGSHVSLALKKRGDGVVGIDNFNSYYDPS  131

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK AR+ LL+ H IFIVEGD+ND  LL KLFD V F
Sbjct  132  LKEARRSLLKTHDIFIVEGDINDNRLLDKLFDTVAF  167



>ref|XP_002874760.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51019.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = +3

Query  264  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
            RR L+ +  S ++A   GG+ WEKQV+ SA PR + G++VLVTGA+GFVG+H S+AL++R
Sbjct  61   RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSRGGLTVLVTGASGFVGTHVSIALRRR  118

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V F
Sbjct  119  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLF  171



>ref|XP_006359203.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Solanum tuberosum]
Length=435

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 99/143 (69%), Gaps = 8/143 (6%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + + LI + FF       + +S    RR+L T+ +         G AWEK++++SA
Sbjct  37   FWSFVFLGLIFVCFFRSPSSSSSPASSDLSRRSLRTSSYD--------GPAWEKRIKASA  88

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGV+GLDNFN YYDPSLKRARQ LLE   
Sbjct  89   KIRSRNGISVLVTGAAGFVGTHVSSALKRRGDGVVGLDNFNDYYDPSLKRARQTLLEGAG  148

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            ++IVEGD+ND  LL KLFD+V F
Sbjct  149  VYIVEGDINDVTLLKKLFDVVQF  171



>ref|XP_010047879.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Eucalyptus grandis]
 gb|KCW79891.1| hypothetical protein EUGRSUZ_C01241 [Eucalyptus grandis]
Length=432

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G+    A++ GG  WEK+V+ SA   R +G+SVLVTGAAGFVG+H SLALKKRGDGV+G
Sbjct  62   SGNRYFTASW-GGIQWEKRVRDSAQVHRPDGLSVLVTGAAGFVGTHVSLALKKRGDGVVG  120

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN+YYDPSLK+AR+ LL+ H +FIVEGD+NDA LL+KLFD+V F
Sbjct  121  LDNFNSYYDPSLKKARKALLQGHGVFIVEGDVNDARLLAKLFDVVAF  167



>ref|NP_192962.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
 sp|Q9STI6.1|GAE5_ARATH RecName: Full=UDP-glucuronate 4-epimerase 5; AltName: Full=UDP-glucuronic 
acid epimerase 5 [Arabidopsis thaliana]
 emb|CAB45972.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 emb|CAB78268.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN12948.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AEE83108.1| UDP-D-glucuronate 4-epimerase 5 [Arabidopsis thaliana]
Length=436

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +3

Query  264  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
            RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  61   RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFVGTHVSIALRRR  118

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V F
Sbjct  119  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLF  171



>ref|XP_009593138.1| PREDICTED: UDP-glucuronate 4-epimerase 5 [Nicotiana tomentosiformis]
Length=445

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 98/139 (71%), Gaps = 7/139 (5%)
 Frame = +3

Query  186  LMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRR  365
            L +  I++FFF   + P   S+ G  RR+L  T    ++   + G  WE++V++SA PR 
Sbjct  50   LFICFIVLFFF---FSPPTNSAAGNNRRSLKNT----VSPPAALGPNWERRVRASARPRS  102

Query  366  QNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIV  545
            + G +VLVTGAAGFVGSH SLALK+RGDGVLGLDNFN YYD  LK+AR  LLE+  I+IV
Sbjct  103  KTGFTVLVTGAAGFVGSHVSLALKRRGDGVLGLDNFNHYYDVGLKKARMGLLERSGIYIV  162

Query  546  EGDLNDAPLLSKLFDIVPF  602
            +GD+NDA LL KLFD V F
Sbjct  163  DGDINDAVLLKKLFDAVAF  181



>gb|KEH16056.1| UDP-D-glucuronate 4-epimerase [Medicago truncatula]
Length=421

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 98/143 (69%), Gaps = 12/143 (8%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + L   +I   FF       +++S    RR+L T  +        GGAAWEK+V+SSA
Sbjct  27   FWSILFFGVIYFLFFRTPSSFSSDTS----RRSLRTYNY--------GGAAWEKKVRSSA  74

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
                +NG+SVLVTGAAGFVGSH S+ALK+RGDGV+G+DNFN YYDP LK  RQ LLE+  
Sbjct  75   KVTSKNGVSVLVTGAAGFVGSHVSIALKRRGDGVVGIDNFNDYYDPMLKLGRQALLERTG  134

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+ND  LL KLF++VPF
Sbjct  135  VFIVEGDINDPTLLKKLFEVVPF  157



>ref|XP_004298689.1| PREDICTED: UDP-glucuronate 4-epimerase 4 [Fragaria vesca subsp. 
vesca]
Length=437

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 108/175 (62%), Gaps = 17/175 (10%)
 Frame = +3

Query  78   PDTSKNSKLERYNSYIRRVNsskliaasskllFRATLMVALILIFFFTINYPPLAESSGG  257
            P T    KLE+   YI R+     ++       + TL  +  L+F     Y     S   
Sbjct  14   PSTPGKFKLEKSQPYIHRLRFHASLS-------KLTLWSSFFLVFIL-FYYVLSPPSPSL  65

Query  258  GRRRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALK  437
              RRAL+ +          GG  WEK+V  SA     +G++VLVTGAAGFVG+H S+ALK
Sbjct  66   PSRRALNDSSW--------GGPDWEKRVTRSAR-TSPHGLTVLVTGAAGFVGTHVSMALK  116

Query  438  KRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +RGDGVLG+DNFN YYDP LKR RQKLLE++ +F+VEGD+NDAPLL KLFD+VPF
Sbjct  117  RRGDGVLGIDNFNHYYDPRLKRDRQKLLERNGVFVVEGDINDAPLLRKLFDVVPF  171



>ref|XP_002892033.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68292.1| UDP-D-glucuronate 4-epimerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 99/143 (69%), Gaps = 13/143 (9%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + +   L+ IFF+     P+  S+    RR+L T           GG  WEK+V+SSA
Sbjct  38   FWSLVFFGLLFIFFYR---SPI--SNPDSSRRSLRTYSW--------GGPHWEKRVRSSA  84

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYD SLKR+RQ LLE+  
Sbjct  85   RVRTRNGVSVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDTSLKRSRQALLERSG  144

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +FIVEGD+ND  LL KLF++VPF
Sbjct  145  VFIVEGDINDLSLLKKLFEVVPF  167



>gb|AAK93670.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
Length=436

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +3

Query  264  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
            RR L+ +  S ++A   GG+ WEKQV+ SA PR   G++VLVTGA+GFVG+H S+AL++R
Sbjct  61   RRNLNDS--SSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFVGTHVSIALQRR  118

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V F
Sbjct  119  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLF  171



>gb|KDO62346.1| hypothetical protein CISIN_1g043169mg [Citrus sinensis]
Length=421

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEK V+SSA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN YYDPS
Sbjct  71   GGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H +F++EGD+NDA LL+KLFD V F
Sbjct  131  LKKARKALLNNHGVFVIEGDINDAKLLAKLFDAVAF  166



>ref|XP_011018096.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Populus euphratica]
Length=431

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQ+++SA   R  GMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN YYDPS
Sbjct  71   GGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL    IFIVEGD+NDA L++KLFDIV F
Sbjct  131  LKKARKSLLNNQGIFIVEGDINDARLIAKLFDIVAF  166



>ref|XP_002324510.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
 gb|EEF03075.1| UDP-D-GLUCURONATE 4-EPIMERASE 1 family protein [Populus trichocarpa]
Length=431

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQ+++SA   R  GMSVLVTGAAGFVGSH SLALKKRGDGV+G+DNFN YYDPS
Sbjct  71   GGIQWEKQIRNSAQIHRSKGMSVLVTGAAGFVGSHVSLALKKRGDGVVGIDNFNNYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL    IFIVEGD+NDA L++KLFDIV F
Sbjct  131  LKKARKSLLNNQGIFIVEGDINDARLIAKLFDIVAF  166



>ref|XP_008443815.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Cucumis melo]
Length=432

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L+A++ GG  WEKQV++SA   R  GMSVLVTGA+GFVG+H SLALK+RGDGV+G
Sbjct  62   SGTRYLSASW-GGLQWEKQVRTSAEISRSGGMSVLVTGASGFVGTHVSLALKRRGDGVVG  120

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLK+AR+ L+ +H +F++EGD+NDA LL KLFDIV F
Sbjct  121  LDNFNNYYDPSLKKARKALVNRHGVFVIEGDINDARLLDKLFDIVAF  167



>ref|XP_003570280.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brachypodium distachyon]
Length=441

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 7/113 (6%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKR  443
            T     AA++ GG  WE+Q+++SA  RR        GMSVLVTGAAGFVG+HCSLAL+KR
Sbjct  65   TSSKYFAASW-GGLHWERQIRASAAVRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKR  123

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGV+G+DNFN+YYDPSLK+AR+ LL  H +F+VEGD+ND  LL+KLFD+VPF
Sbjct  124  GDGVVGIDNFNSYYDPSLKKARKALLTSHGVFVVEGDINDGRLLAKLFDVVPF  176



>ref|XP_006453511.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
 ref|XP_006474082.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Citrus sinensis]
 gb|ESR66751.1| hypothetical protein CICLE_v10008355mg [Citrus clementina]
Length=431

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEK V+SSA   R  GMSVLVTGAAGFVG+H SLALKKRGDGV+GLDNFN YYDPS
Sbjct  71   GGIQWEKHVRSSAQIHRSGGMSVLVTGAAGFVGTHVSLALKKRGDGVVGLDNFNNYYDPS  130

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H +F++EGD+NDA LL+KLFD V F
Sbjct  131  LKKARKALLNNHGVFVIEGDINDAKLLAKLFDAVAF  166



>emb|CDX97356.1| BnaA02g21470D [Brassica napus]
Length=429

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN YYDP 
Sbjct  69   GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPK  128

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V F
Sbjct  129  LKRARQGLLERSGVFVVEGDVNDAVLLRKLFDVVLF  164



>emb|CDY70926.1| BnaCnng70410D [Brassica napus]
 emb|CDY28188.1| BnaA01g06610D [Brassica napus]
Length=429

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V F
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAF  163



>ref|XP_009128629.1| PREDICTED: UDP-glucuronate 4-epimerase 5-like [Brassica rapa]
Length=429

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN YYDP 
Sbjct  69   GGSHWEKQVRKSARPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPK  128

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +F+VEGD+NDA LL KLFD+V F
Sbjct  129  LKRARQGLLERSGVFVVEGDVNDAVLLRKLFDVVLF  164



>ref|NP_194773.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis thaliana]
 ref|XP_002867348.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis lyrata subsp. lyrata]
 sp|Q9M0B6.1|GAE1_ARATH RecName: Full=UDP-glucuronate 4-epimerase 1; AltName: Full=UDP-glucuronic 
acid epimerase 1; Short=AtUGlcAE3 [Arabidopsis 
thaliana]
 emb|CAB79762.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAL07152.1| putative nucleotide sugar epimerase [Arabidopsis thaliana]
 gb|AAM20706.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAM62729.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAN15627.1| nucleotide sugar epimerase-like protein [Arabidopsis thaliana]
 gb|AAT77233.1| UDP-D-glucuronate 4-epimerase [Arabidopsis thaliana]
 gb|EFH43607.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE85765.1| UDP-D-glucuronate 4-epimerase 1 [Arabidopsis thaliana]
 gb|AFI41204.1| UDP-D-glucuronate 4-epimerase 1, partial [Arabidopsis thaliana]
Length=429

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V F
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAF  163



>ref|XP_009114629.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X1 [Brassica 
rapa]
Length=435

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 93/113 (82%), Gaps = 3/113 (3%)
 Frame = +3

Query  264  RRALHTTGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKR  443
            RR+L+ +  SL +A + GG+ WEK+V+ SA PR + G++VLVTGAAGFVG+H S+AL++R
Sbjct  61   RRSLNDS--SLSSAKY-GGSQWEKKVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRR  117

Query  444  GDGVLGLDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            GDGVLGLDNFN YYDP LKRARQ LLE+  +F+VEGD+NDA LL KL+D+V F
Sbjct  118  GDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLKKLYDVVLF  170



>ref|XP_010432987.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Camelina sativa]
Length=429

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V F
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAF  163



>ref|XP_010047039.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Eucalyptus grandis]
 gb|KCW78789.1| hypothetical protein EUGRSUZ_C00223 [Eucalyptus grandis]
Length=442

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 103/145 (71%), Gaps = 15/145 (10%)
 Frame = +3

Query  180  ATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSATP  359
            AT M AL L+   T +Y  L         + L ++G+ LLAA++ GG  WEKQV+ SA P
Sbjct  43   ATFMWALFLLAL-TASYLSL---------QGLLSSGNRLLAASW-GGIQWEKQVRVSARP  91

Query  360  RRQNGM----SVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEK  527
            RR  G     SVLVTGAAGFVG+H SLAL+KRGDGV+GLDNFN YYDPSLKR+R  LL  
Sbjct  92   RRPAGAGAGHSVLVTGAAGFVGAHVSLALRKRGDGVVGLDNFNPYYDPSLKRSRASLLRA  151

Query  528  HQIFIVEGDLNDAPLLSKLFDIVPF  602
             ++F+V+GD+NDA LL+KLFD+V F
Sbjct  152  QKVFVVDGDVNDARLLAKLFDVVAF  176



>ref|XP_006282616.1| hypothetical protein CARUB_v10004864mg [Capsella rubella]
 gb|EOA15514.1| hypothetical protein CARUB_v10004864mg [Capsella rubella]
Length=429

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V F
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAF  163



>ref|XP_009127808.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Brassica rapa]
Length=429

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V F
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAF  163



>ref|XP_010438178.1| PREDICTED: UDP-glucuronate 4-epimerase 1 [Camelina sativa]
Length=430

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V F
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAF  163



>ref|XP_010426564.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
 ref|XP_010456322.1| PREDICTED: UDP-glucuronate 4-epimerase 3 [Camelina sativa]
Length=428

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 101/143 (71%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI IFF+    P +++      RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFFY--RSPLVSDDPTSTSRRSLRTYSW--------GGPAWEKRVRSSA  81

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  82   RLRSRRGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  141

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+VEGD+NDA LL KLF++VPF
Sbjct  142  VFVVEGDINDAALLKKLFEVVPF  164



>ref|XP_009380772.1| PREDICTED: UDP-glucuronate 4-epimerase 1-like [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WE+Q+++SA  RR +G++VLVTGAAGFVG+H SLAL++RGDGV+G+DNFNAYYDPS
Sbjct  73   GGLHWERQIRASAAVRRDDGIAVLVTGAAGFVGTHVSLALRRRGDGVVGIDNFNAYYDPS  132

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK+AR+ LL  H +F+V+GD+NDA LL KLFD VPF
Sbjct  133  LKKARKALLAGHGVFVVDGDINDARLLEKLFDTVPF  168



>ref|XP_010419541.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Camelina sativa]
Length=428

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 101/143 (71%), Gaps = 10/143 (7%)
 Frame = +3

Query  174  FRATLMVALILIFFFTINYPPLAESSGGGRRRALHTTGHSLLAATFSGGAAWEKQVQSSA  353
            F + + V LI IFF+    P +++      RR+L T           GG AWEK+V+SSA
Sbjct  32   FWSLVFVGLIFIFFY--RSPLVSDDPTSTSRRSLRTYSW--------GGPAWEKRVRSSA  81

Query  354  TPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPSLKRARQKLLEKHQ  533
              R + G SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPSLKRARQ LLE+  
Sbjct  82   RLRSRRGFSVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPSLKRARQALLERSG  141

Query  534  IFIVEGDLNDAPLLSKLFDIVPF  602
            +F+VEGD+NDA LL KLF++VPF
Sbjct  142  VFVVEGDINDAALLKKLFEVVPF  164



>ref|XP_011093361.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Sesamum indicum]
Length=434

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  +EK+V++SA  R +NG+SVLVTGAAGFVGSH S ALK+RGDGVLG+DNFN YYDPS
Sbjct  75   GGPNFEKRVRASAKIRSRNGISVLVTGAAGFVGSHVSAALKRRGDGVLGIDNFNNYYDPS  134

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  ++IVEGD+ND+ LL KLFDIVPF
Sbjct  135  LKRARQALLERSGVYIVEGDINDSALLKKLFDIVPF  170



>gb|KFK29619.1| hypothetical protein AALP_AA7G157500 [Arabis alpina]
Length=430

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLND  LLSKLFD+V F
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDGKLLSKLFDVVAF  163



>ref|XP_006412706.1| hypothetical protein EUTSA_v10025193mg [Eutrema salsugineum]
 gb|ESQ54159.1| hypothetical protein EUTSA_v10025193mg [Eutrema salsugineum]
Length=449

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  58   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  116

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR+ LL    IF+VEGDLNDA LL+KLFD+V F
Sbjct  117  LDNFNNYYDPSLKRARRSLLSSRGIFVVEGDLNDAKLLAKLFDVVAF  163



>gb|EYU37123.1| hypothetical protein MIMGU_mgv1a006776mg [Erythranthe guttata]
Length=432

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG  WEKQV+SSA  RRQ G SVLVTGAAGFVGSH SLALKKRGDGV+GLDNFN YYDPS
Sbjct  72   GGIQWEKQVRSSAQIRRQGGFSVLVTGAAGFVGSHVSLALKKRGDGVVGLDNFNDYYDPS  131

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LK++R+ LL    +F+V+GD+NDA LL+KLF+I P 
Sbjct  132  LKKSRKNLLSSQGVFVVDGDINDARLLAKLFEIAPL  167



>ref|XP_009114630.1| PREDICTED: UDP-glucuronate 4-epimerase 5 isoform X2 [Brassica 
rapa]
Length=436

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG+ WEKQV+ SA PR + G++VLVTGAAGFVG+H S+AL++RGDGVLGLDNFN YYDP 
Sbjct  76   GGSQWEKQVRKSAHPRSRGGLTVLVTGAAGFVGTHVSIALRRRGDGVLGLDNFNRYYDPK  135

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LLE+  +F+VEGD+NDA LL KL+D+V F
Sbjct  136  LKRARQGLLERSGVFVVEGDINDAVLLKKLYDVVLF  171



>dbj|BAD36515.1| putative uridine diphosphate galacturonate 4-epimerase [Oryza 
sativa Japonica Group]
 dbj|BAD72456.1| putative uridine diphosphate galacturonate 4-epimerase [Oryza 
sativa Japonica Group]
Length=453

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 86/102 (84%), Gaps = 6/102 (6%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  476
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DN+N
Sbjct  83   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGAHCSLALRKRGDGVVGIDNYN  142

Query  477  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +YYDPSLK+AR+ LL  H +F+V+GD+ND  LL+KLFD+VPF
Sbjct  143  SYYDPSLKKARRALLGSHGVFVVDGDINDGRLLAKLFDVVPF  184



>emb|CDX72242.1| BnaC07g42640D [Brassica napus]
Length=430

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +3

Query  282  TGHSLLAATFSGGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLG  461
            +G   L A++ GG  WEKQV++SA   R  G+SVLVTGA GFVGSH SLAL+KRGDGV+G
Sbjct  59   SGSRYLTASW-GGIQWEKQVRTSAQIHRSGGISVLVTGATGFVGSHVSLALRKRGDGVVG  117

Query  462  LDNFNAYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LDNFN YYDPSLKRAR  LL    IF+VEGDLND  LLSKLFD+V F
Sbjct  118  LDNFNNYYDPSLKRARMSLLSSRGIFVVEGDLNDGKLLSKLFDVVAF  164



>gb|EAY99954.1| hypothetical protein OsI_21957 [Oryza sativa Indica Group]
Length=453

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 86/102 (84%), Gaps = 6/102 (6%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQ------NGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFN  476
            GG  WE+Q+++SA+PRR        G+SVLVTGAAGFVG+HCSLAL+KRGDGV+G+DN+N
Sbjct  83   GGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFVGAHCSLALRKRGDGVVGIDNYN  142

Query  477  AYYDPSLKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            +YYDPSLK+AR+ LL  H +F+V+GD+ND  LL+KLFD+VPF
Sbjct  143  SYYDPSLKKARRALLGSHGVFVVDGDINDGRLLAKLFDVVPF  184



>ref|XP_010098924.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
 gb|EXB76226.1| UDP-glucuronate 4-epimerase 3 [Morus notabilis]
Length=445

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +3

Query  315  GGAAWEKQVQSSATPRRQNGMSVLVTGAAGFVGSHCSLALKKRGDGVLGLDNFNAYYDPS  494
            GG AWEK+V+SSA  R +NG+SVLVTGAAGFVG+H S ALK+RGDGVLGLDNFN YYDPS
Sbjct  86   GGPAWEKRVRSSARVRSRNGISVLVTGAAGFVGTHVSSALKRRGDGVLGLDNFNDYYDPS  145

Query  495  LKRARQKLLEKHQIFIVEGDLNDAPLLSKLFDIVPF  602
            LKRARQ LL++  +F+VEGD+ND+ LL KLF++V F
Sbjct  146  LKRARQALLDRTGVFVVEGDINDSALLKKLFEVVAF  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940