BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN037L16

Length=191
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU26294.1|  hypothetical protein MIMGU_mgv1a002474mg              69.3    2e-20   Erythranthe guttata [common monkey flower]
ref|XP_008451740.1|  PREDICTED: probable rhamnose biosynthetic en...  68.2    2e-20   Cucumis melo [Oriental melon]
ref|XP_004509959.1|  PREDICTED: probable rhamnose biosynthetic en...  68.2    3e-20   Cicer arietinum [garbanzo]
ref|XP_011098163.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  67.4    4e-20   Sesamum indicum [beniseed]
emb|CDY71423.1|  BnaCnng72830D                                        67.8    4e-20   Brassica napus [oilseed rape]
ref|XP_010093448.1|  putative rhamnose biosynthetic enzyme 1          67.4    5e-20   Morus notabilis
ref|NP_177978.1|  UDP-L-rhamnose synthase                             67.4    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003543185.1|  PREDICTED: probable rhamnose biosynthetic en...  67.8    8e-20   Glycine max [soybeans]
gb|KHN36936.1|  Putative rhamnose biosynthetic enzyme 1               67.4    8e-20   Glycine soja [wild soybean]
ref|XP_004137224.1|  PREDICTED: probable rhamnose biosynthetic en...  68.2    9e-20   Cucumis sativus [cucumbers]
gb|KHN19477.1|  Putative rhamnose biosynthetic enzyme 1               67.4    1e-19   Glycine soja [wild soybean]
ref|XP_003540514.1|  PREDICTED: probable rhamnose biosynthetic en...  67.4    1e-19   Glycine max [soybeans]
ref|XP_002887744.1|  RHM1/ROL1                                        67.4    1e-19   
ref|XP_003546628.1|  PREDICTED: probable rhamnose biosynthetic en...  66.2    1e-19   Glycine max [soybeans]
gb|EPS62084.1|  hypothetical protein M569_12709                       68.2    1e-19   Genlisea aurea
ref|XP_007022008.1|  Rhamnose biosynthesis 1                          65.9    1e-19   Theobroma cacao [chocolate]
ref|XP_006647099.1|  PREDICTED: probable rhamnose biosynthetic en...  67.4    1e-19   Oryza brachyantha
ref|XP_009377674.1|  PREDICTED: probable rhamnose biosynthetic en...  67.4    1e-19   Pyrus x bretschneideri [bai li]
gb|ACJ11756.1|  rhamnose synthase                                     65.9    1e-19   Gossypium hirsutum [American cotton]
gb|KJB12934.1|  hypothetical protein B456_002G046200                  65.9    1e-19   Gossypium raimondii
ref|XP_009610279.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    2e-19   Nicotiana tomentosiformis
ref|XP_009776312.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    2e-19   Nicotiana sylvestris
ref|XP_010035897.1|  PREDICTED: probable rhamnose biosynthetic en...  67.4    2e-19   Eucalyptus grandis [rose gum]
ref|XP_007149511.1|  hypothetical protein PHAVU_005G076400g           66.2    2e-19   Phaseolus vulgaris [French bean]
ref|XP_011082806.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  65.9    2e-19   Sesamum indicum [beniseed]
ref|XP_006370064.1|  hypothetical protein POPTR_0001s39210g           65.9    2e-19   Populus trichocarpa [western balsam poplar]
gb|EYU38237.1|  hypothetical protein MIMGU_mgv1a002436mg              65.1    2e-19   Erythranthe guttata [common monkey flower]
ref|XP_010537694.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  65.5    2e-19   Tarenaya hassleriana [spider flower]
gb|KHN18614.1|  Putative rhamnose biosynthetic enzyme 1               66.2    2e-19   Glycine soja [wild soybean]
ref|XP_004488984.1|  PREDICTED: probable rhamnose biosynthetic en...  66.2    2e-19   
ref|XP_011006811.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  66.2    2e-19   Populus euphratica
gb|KDO60921.1|  hypothetical protein CISIN_1g005818mg                 65.9    2e-19   Citrus sinensis [apfelsine]
ref|XP_009783771.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    2e-19   Nicotiana sylvestris
emb|CDP06058.1|  unnamed protein product                              67.4    2e-19   Coffea canephora [robusta coffee]
ref|XP_009590265.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    3e-19   Nicotiana tomentosiformis
ref|XP_003531412.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    3e-19   Glycine max [soybeans]
ref|XP_010462242.1|  PREDICTED: probable rhamnose biosynthetic en...  65.1    3e-19   Camelina sativa [gold-of-pleasure]
gb|KHG07031.1|  putative rhamnose biosynthetic enzyme 1 -like pro...  66.2    3e-19   Gossypium arboreum [tree cotton]
ref|XP_011045548.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  65.9    3e-19   Populus euphratica
emb|CDY20084.1|  BnaA01g29180D                                        64.7    3e-19   Brassica napus [oilseed rape]
ref|XP_010479911.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009394841.1|  PREDICTED: probable rhamnose biosynthetic en...  67.0    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP30504.1|  hypothetical protein JCGZ_17141                       65.9    3e-19   Jatropha curcas
gb|ADB24772.1|  rhamnose synthase                                     64.7    3e-19   Gossypium hirsutum [American cotton]
ref|XP_006437200.1|  hypothetical protein CICLE_v10030887mg           65.9    3e-19   
gb|KEH38548.1|  rhamnose biosynthetic-like enzyme                     65.9    3e-19   Medicago truncatula
ref|XP_006484833.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    3e-19   Citrus sinensis [apfelsine]
ref|XP_006585326.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    3e-19   Glycine max [soybeans]
ref|XP_006585327.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    3e-19   
ref|XP_003571828.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    3e-19   Brachypodium distachyon [annual false brome]
ref|XP_002531238.1|  NAD dependent epimerase/dehydratase, putative    65.9    3e-19   
ref|XP_008342373.1|  PREDICTED: probable rhamnose biosynthetic en...  67.4    3e-19   Malus domestica [apple tree]
ref|XP_004303854.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  67.4    4e-19   Fragaria vesca subsp. vesca
ref|XP_006442344.1|  hypothetical protein CICLE_v10019182mg           65.9    4e-19   Citrus clementina [clementine]
ref|XP_006477818.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    4e-19   Citrus sinensis [apfelsine]
gb|KDO49287.1|  hypothetical protein CISIN_1g005941mg                 65.9    4e-19   Citrus sinensis [apfelsine]
emb|CDY32340.1|  BnaC01g36590D                                        64.7    4e-19   Brassica napus [oilseed rape]
gb|KJB45831.1|  hypothetical protein B456_007G332000                  65.9    4e-19   Gossypium raimondii
ref|XP_010268536.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    4e-19   Nelumbo nucifera [Indian lotus]
ref|XP_002317559.2|  NAD-dependent epimerase/dehydratase family p...  66.2    5e-19   
ref|XP_004960685.1|  PREDICTED: probable rhamnose biosynthetic en...  65.5    5e-19   Setaria italica
ref|XP_004248232.1|  PREDICTED: probable rhamnose biosynthetic en...  65.1    5e-19   Solanum lycopersicum
ref|XP_010429684.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    5e-19   
ref|XP_006360030.1|  PREDICTED: probable rhamnose biosynthetic en...  65.1    5e-19   Solanum tuberosum [potatoes]
ref|XP_006301908.1|  hypothetical protein CARUB_v10022384mg           64.7    5e-19   Capsella rubella
emb|CDX88455.1|  BnaC06g38990D                                        64.7    5e-19   
ref|XP_006355193.1|  PREDICTED: probable rhamnose biosynthetic en...  68.2    5e-19   Solanum tuberosum [potatoes]
ref|XP_010417456.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_006392784.1|  hypothetical protein EUTSA_v10011290mg           63.5    5e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006389974.1|  hypothetical protein EUTSA_v10018232mg           64.7    6e-19   Eutrema salsugineum [saltwater cress]
ref|XP_010924680.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  67.0    6e-19   Elaeis guineensis
ref|XP_009147602.1|  PREDICTED: probable rhamnose biosynthetic en...  63.2    6e-19   Brassica rapa
ref|XP_010552134.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  64.7    6e-19   Tarenaya hassleriana [spider flower]
ref|XP_009144768.1|  PREDICTED: probable rhamnose biosynthetic en...  63.5    6e-19   Brassica rapa
emb|CDY60210.1|  BnaCnng35880D                                        63.5    6e-19   Brassica napus [oilseed rape]
ref|XP_010060763.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    7e-19   Eucalyptus grandis [rose gum]
emb|CDY24092.1|  BnaA06g00900D                                        63.2    7e-19   Brassica napus [oilseed rape]
ref|XP_002894444.1|  mucilage-modified 4                              64.7    7e-19   
emb|CDY45116.1|  BnaC06g06370D                                        63.2    7e-19   Brassica napus [oilseed rape]
ref|XP_010487282.1|  PREDICTED: probable rhamnose biosynthetic en...  63.2    7e-19   Camelina sativa [gold-of-pleasure]
ref|XP_003551160.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    8e-19   
emb|CDX98494.1|  BnaC05g38810D                                        63.2    8e-19   
ref|XP_009146324.1|  PREDICTED: probable rhamnose biosynthetic en...  63.2    8e-19   Brassica rapa
ref|XP_009376726.1|  PREDICTED: probable rhamnose biosynthetic en...  64.3    8e-19   Pyrus x bretschneideri [bai li]
ref|XP_009421279.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    9e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010501002.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    9e-19   Camelina sativa [gold-of-pleasure]
ref|NP_001152718.1|  LOC100286359                                     65.9    9e-19   Zea mays [maize]
emb|CDX97601.1|  BnaA05g24780D                                        63.2    9e-19   
ref|XP_007215006.1|  hypothetical protein PRUPE_ppa002417mg           67.4    9e-19   Prunus persica
ref|XP_008229395.1|  PREDICTED: probable rhamnose biosynthetic en...  67.4    9e-19   Prunus mume [ume]
ref|XP_006407044.1|  hypothetical protein EUTSA_v10020227mg           63.2    9e-19   
ref|XP_010465388.1|  PREDICTED: probable rhamnose biosynthetic en...  63.2    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008380229.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    1e-18   Malus domestica [apple tree]
ref|XP_009356652.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_010062770.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    1e-18   Eucalyptus grandis [rose gum]
ref|XP_004294169.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  63.9    1e-18   Fragaria vesca subsp. vesca
ref|XP_006297150.1|  hypothetical protein CARUB_v10013153mg           63.2    1e-18   Capsella rubella
ref|XP_008226345.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    1e-18   Prunus mume [ume]
ref|XP_010502125.1|  PREDICTED: probable rhamnose biosynthetic en...  63.2    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009586858.1|  PREDICTED: probable rhamnose biosynthetic en...  66.6    1e-18   Nicotiana tomentosiformis
gb|ACG28244.1|  dTDP-4-dehydrorhamnose reductase                      65.9    1e-18   Zea mays [maize]
ref|XP_010533730.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  65.1    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_001779703.1|  predicted protein                                65.1    1e-18   
gb|KHG22077.1|  putative rhamnose biosynthetic enzyme 1 -like pro...  62.4    1e-18   Gossypium arboreum [tree cotton]
ref|XP_010273412.1|  PREDICTED: probable rhamnose biosynthetic en...  64.3    1e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008791880.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    1e-18   Phoenix dactylifera
gb|KHN44082.1|  Putative rhamnose biosynthetic enzyme 1               62.0    2e-18   Glycine soja [wild soybean]
ref|XP_002454480.1|  hypothetical protein SORBIDRAFT_04g031900        64.3    2e-18   Sorghum bicolor [broomcorn]
ref|XP_004953442.1|  PREDICTED: probable rhamnose biosynthetic en...  65.5    2e-18   Setaria italica
ref|XP_002882893.1|  hypothetical protein ARALYDRAFT_478892           63.2    2e-18   
ref|XP_010053354.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    2e-18   Eucalyptus grandis [rose gum]
emb|CDY35137.1|  BnaA06g11470D                                        64.7    2e-18   Brassica napus [oilseed rape]
ref|XP_009149137.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    2e-18   Brassica rapa
gb|ADB24773.1|  rhamnose synthase                                     63.9    2e-18   Gossypium hirsutum [American cotton]
emb|CDY40003.1|  BnaC05g13120D                                        64.7    2e-18   Brassica napus [oilseed rape]
ref|XP_010915435.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  65.9    2e-18   Elaeis guineensis
ref|NP_188097.1|  rhamnose biosynthetic enzyme 3                      63.2    2e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010325193.1|  PREDICTED: probable rhamnose biosynthetic en...  66.6    2e-18   
gb|KCW77625.1|  hypothetical protein EUGRSUZ_D01934                   64.7    2e-18   Eucalyptus grandis [rose gum]
ref|XP_008792282.1|  PREDICTED: probable rhamnose biosynthetic en...  67.0    2e-18   Phoenix dactylifera
ref|XP_002282339.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...  64.7    2e-18   Vitis vinifera
ref|XP_007213598.1|  hypothetical protein PRUPE_ppa002453mg           64.3    2e-18   Prunus persica
ref|NP_001151455.1|  RHM1                                             67.0    2e-18   Zea mays [maize]
ref|XP_010933909.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...  66.2    2e-18   
ref|XP_004244296.1|  PREDICTED: probable rhamnose biosynthetic en...  62.8    2e-18   Solanum lycopersicum
ref|XP_010671686.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  66.2    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006348335.1|  PREDICTED: probable rhamnose biosynthetic en...  62.8    2e-18   Solanum tuberosum [potatoes]
ref|XP_009106565.1|  PREDICTED: probable rhamnose biosynthetic en...  67.8    2e-18   Brassica rapa
gb|KHG29785.1|  putative rhamnose biosynthetic enzyme 1 -like pro...  63.5    3e-18   Gossypium arboreum [tree cotton]
ref|XP_006306947.1|  hypothetical protein CARUB_v10008513mg           63.2    3e-18   Capsella rubella
gb|EMT23371.1|  Putative rhamnose biosynthetic enzyme 1               64.3    3e-18   
ref|XP_008776517.1|  PREDICTED: probable rhamnose biosynthetic en...  64.3    3e-18   Phoenix dactylifera
ref|XP_007048831.1|  Rhamnose biosynthesis 1 isoform 1                65.5    3e-18   
gb|KJB61502.1|  hypothetical protein B456_009G362500                  63.9    3e-18   Gossypium raimondii
ref|XP_002285634.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  64.3    3e-18   Vitis vinifera
ref|XP_002965630.1|  hypothetical protein SELMODRAFT_439393           63.9    3e-18   Selaginella moellendorffii
ref|XP_002440852.1|  hypothetical protein SORBIDRAFT_09g008220        62.8    3e-18   
ref|XP_006647684.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    3e-18   Oryza brachyantha
ref|XP_010272587.1|  PREDICTED: probable rhamnose biosynthetic en...  64.3    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010255576.1|  PREDICTED: probable rhamnose biosynthetic en...  64.3    4e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010535018.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  63.2    4e-18   Tarenaya hassleriana [spider flower]
ref|XP_007040092.1|  Nucleotide-rhamnose synthase/epimerase-reduc...  63.5    4e-18   
gb|AAK82539.1|  At1g53500/F22G10_13                                   63.2    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564633.2|  putative NDP-L-rhamnose synthase                    63.2    4e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDP18722.1|  unnamed protein product                              65.5    4e-18   Coffea canephora [robusta coffee]
ref|XP_010497682.1|  PREDICTED: probable rhamnose biosynthetic en...  63.5    4e-18   Camelina sativa [gold-of-pleasure]
ref|NP_001049724.1|  Os03g0278200                                     65.9    4e-18   
ref|XP_006649857.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    4e-18   Oryza brachyantha
gb|KFK23178.1|  hypothetical protein AALP_AAs48438U000100             63.5    4e-18   Arabis alpina [alpine rockcress]
dbj|BAJ97692.1|  predicted protein                                    64.3    4e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAN79484.1|  hypothetical protein VITISV_006441                   64.3    4e-18   Vitis vinifera
ref|XP_007161328.1|  hypothetical protein PHAVU_001G060400g           60.8    5e-18   Phaseolus vulgaris [French bean]
gb|KHN09737.1|  Putative rhamnose biosynthetic enzyme 1               66.2    5e-18   Glycine soja [wild soybean]
gb|EMT13548.1|  Putative rhamnose biosynthetic enzyme 1               64.3    5e-18   
ref|XP_004515790.1|  PREDICTED: probable rhamnose biosynthetic en...  65.1    5e-18   Cicer arietinum [garbanzo]
gb|KFK24330.1|  hypothetical protein AALP_AAs39635U000100             63.5    5e-18   Arabis alpina [alpine rockcress]
gb|EMS50143.1|  putative rhamnose biosynthetic enzyme 1               64.3    5e-18   Triticum urartu
ref|XP_009395981.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI20105.3|  unnamed protein product                              64.3    5e-18   Vitis vinifera
ref|XP_010553490.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  64.7    5e-18   Tarenaya hassleriana [spider flower]
gb|AFK41450.1|  unknown                                               65.1    5e-18   Medicago truncatula
ref|XP_003570100.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    6e-18   Brachypodium distachyon [annual false brome]
ref|XP_008654228.1|  PREDICTED: probable rhamnose biosynthetic en...  65.5    6e-18   
dbj|BAJ95321.1|  predicted protein                                    64.3    6e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS68271.1|  hypothetical protein M569_06499                       65.1    6e-18   Genlisea aurea
ref|XP_006477360.1|  PREDICTED: probable rhamnose biosynthetic en...  63.2    6e-18   Citrus sinensis [apfelsine]
ref|XP_006857961.1|  hypothetical protein AMTR_s00069p00173700        64.7    6e-18   Amborella trichopoda
ref|XP_009389578.1|  PREDICTED: probable rhamnose biosynthetic en...  62.8    6e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007155573.1|  hypothetical protein PHAVU_003G213400g           64.7    7e-18   Phaseolus vulgaris [French bean]
ref|XP_004984749.1|  PREDICTED: probable rhamnose biosynthetic en...  67.0    7e-18   Setaria italica
ref|XP_001775697.1|  predicted protein                                62.4    7e-18   
ref|XP_009803668.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    7e-18   Nicotiana sylvestris
ref|XP_011072055.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...  63.2    7e-18   Sesamum indicum [beniseed]
ref|XP_008437195.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    7e-18   Cucumis melo [Oriental melon]
gb|KHG15836.1|  putative rhamnose biosynthetic enzyme 1 -like pro...  65.9    7e-18   Gossypium arboreum [tree cotton]
ref|XP_006440508.1|  hypothetical protein CICLE_v10021340mg           63.2    8e-18   Citrus clementina [clementine]
gb|KJB75445.1|  hypothetical protein B456_012G042300                  65.9    8e-18   Gossypium raimondii
ref|XP_004143938.1|  PREDICTED: probable rhamnose biosynthetic en...  64.3    8e-18   Cucumis sativus [cucumbers]
gb|KJB20764.1|  hypothetical protein B456_003G163300                  63.5    8e-18   Gossypium raimondii
ref|XP_007011619.1|  Rhamnose biosynthesis 1                          67.0    8e-18   
ref|XP_010933908.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...  64.7    9e-18   
dbj|BAJ86835.1|  predicted protein                                    65.5    9e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009394163.1|  PREDICTED: probable rhamnose biosynthetic en...  64.3    9e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADB24764.1|  UDP-L-rhamnose synthase                               63.5    9e-18   Gossypium hirsutum [American cotton]
gb|EMS45937.1|  putative rhamnose biosynthetic enzyme 1               65.5    9e-18   Triticum urartu
emb|CDP05404.1|  unnamed protein product                              65.1    9e-18   Coffea canephora [robusta coffee]
gb|ACJ11713.1|  UDP-L-rhamnose synthase                               63.5    1e-17   Gossypium hirsutum [American cotton]
ref|XP_001781616.1|  predicted protein                                63.9    1e-17   
gb|KHG05296.1|  putative rhamnose biosynthetic enzyme 1 -like pro...  63.5    1e-17   Gossypium arboreum [tree cotton]
ref|XP_004298763.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...  62.4    1e-17   Fragaria vesca subsp. vesca
gb|ADB24774.1|  rhamnose synthase                                     65.9    1e-17   Gossypium hirsutum [American cotton]
ref|XP_004245662.1|  PREDICTED: probable rhamnose biosynthetic en...  63.9    1e-17   Solanum lycopersicum
gb|ABK22031.1|  unknown                                               62.0    1e-17   Picea sitchensis
emb|CDY57072.1|  BnaCnng31530D                                        64.7    1e-17   Brassica napus [oilseed rape]
ref|XP_010675264.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  62.8    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006845495.1|  hypothetical protein AMTR_s00019p00150410        62.4    1e-17   Amborella trichopoda
ref|XP_007158451.1|  hypothetical protein PHAVU_002G153500g           63.5    1e-17   Phaseolus vulgaris [French bean]
gb|EMS59810.1|  putative rhamnose biosynthetic enzyme 1               62.0    1e-17   Triticum urartu
gb|KJB27003.1|  hypothetical protein B456_004G271200                  60.8    1e-17   Gossypium raimondii
ref|XP_010676576.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...  62.4    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010675265.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  62.8    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004984748.1|  PREDICTED: probable rhamnose biosynthetic en...  64.3    1e-17   Setaria italica
emb|CDP09826.1|  unnamed protein product                              63.5    1e-17   Coffea canephora [robusta coffee]
ref|XP_011029152.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...  62.4    1e-17   Populus euphratica
gb|KDP25530.1|  hypothetical protein JCGZ_20686                       63.5    2e-17   Jatropha curcas
ref|XP_009148579.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    2e-17   Brassica rapa
ref|XP_006391796.1|  hypothetical protein EUTSA_v10023613mg           63.2    2e-17   Eutrema salsugineum [saltwater cress]
emb|CDY45969.1|  BnaA09g12970D                                        63.2    2e-17   Brassica napus [oilseed rape]
emb|CDY45471.1|  BnaC09g12890D                                        63.2    2e-17   Brassica napus [oilseed rape]
ref|XP_002509687.1|  NAD dependent epimerase/dehydratase, putative    63.5    2e-17   Ricinus communis
gb|AAC32137.1|  hypothetical protein                                  61.6    2e-17   Picea mariana [black spruce]
ref|XP_009620292.1|  PREDICTED: probable rhamnose biosynthetic en...  63.9    2e-17   Nicotiana tomentosiformis
ref|XP_001766894.1|  predicted protein                                62.0    2e-17   
ref|XP_004169238.1|  PREDICTED: probable rhamnose biosynthetic en...  61.2    2e-17   
ref|XP_006358852.1|  PREDICTED: probable rhamnose biosynthetic en...  62.8    2e-17   Solanum tuberosum [potatoes]
ref|XP_010108054.1|  putative rhamnose biosynthetic enzyme 1          61.6    2e-17   Morus notabilis
gb|EYU36941.1|  hypothetical protein MIMGU_mgv1a010842mg              62.8    3e-17   Erythranthe guttata [common monkey flower]
ref|XP_009400458.1|  PREDICTED: probable rhamnose biosynthetic en...  60.8    3e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010473526.1|  PREDICTED: probable rhamnose biosynthetic en...  62.0    3e-17   Camelina sativa [gold-of-pleasure]
gb|KFK40550.1|  hypothetical protein AALP_AA2G010500                  62.0    3e-17   Arabis alpina [alpine rockcress]
ref|XP_010430376.1|  PREDICTED: probable rhamnose biosynthetic en...  62.0    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_002299567.1|  hypothetical protein POPTR_0001s08570g           62.4    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_008393937.1|  PREDICTED: probable rhamnose biosynthetic en...  64.7    3e-17   
ref|XP_006302532.1|  hypothetical protein CARUB_v10020632mg           62.0    3e-17   
ref|XP_002887985.1|  hypothetical protein ARALYDRAFT_893174           62.0    3e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_003549868.1|  PREDICTED: probable rhamnose biosynthetic en...  63.2    4e-17   Glycine max [soybeans]
ref|XP_001775602.1|  predicted protein                                62.4    4e-17   
gb|AAK62450.1|AF387005_1  Unknown protein                             62.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDP22060.1|  unnamed protein product                              62.0    4e-17   Coffea canephora [robusta coffee]
ref|XP_010418304.1|  PREDICTED: probable rhamnose biosynthetic en...  62.0    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009113029.1|  PREDICTED: probable rhamnose biosynthetic en...  63.2    4e-17   Brassica rapa
ref|XP_008776518.1|  PREDICTED: probable rhamnose biosynthetic en...  60.8    4e-17   
ref|NP_564806.1|  UDP-4-keto-6-deoxy-d-glucose-3,5-epimerase-4-re...  62.0    5e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ACU23112.1|  unknown                                               61.6    5e-17   Glycine max [soybeans]
ref|XP_002303557.1|  hypothetical protein POPTR_0003s12000g           60.1    6e-17   Populus trichocarpa [western balsam poplar]
ref|XP_007209407.1|  hypothetical protein PRUPE_ppa009264mg           61.2    6e-17   Prunus persica
ref|XP_009766426.1|  PREDICTED: probable rhamnose biosynthetic en...  62.4    6e-17   Nicotiana sylvestris
ref|XP_008365831.1|  PREDICTED: probable rhamnose biosynthetic en...  61.2    7e-17   
gb|KFK43526.1|  hypothetical protein AALP_AA1G137100                  62.0    7e-17   Arabis alpina [alpine rockcress]
ref|XP_011033826.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...  61.2    7e-17   Populus euphratica
ref|XP_008445073.1|  PREDICTED: probable rhamnose biosynthetic en...  60.1    8e-17   Cucumis melo [Oriental melon]
ref|XP_008381928.1|  PREDICTED: probable rhamnose biosynthetic en...  61.2    8e-17   
ref|XP_008348787.1|  PREDICTED: probable rhamnose biosynthetic en...  60.8    9e-17   
gb|AAM65668.1|  unknown                                               60.1    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009346674.1|  PREDICTED: probable rhamnose biosynthetic en...  59.3    2e-16   
ref|XP_009362849.1|  PREDICTED: probable rhamnose biosynthetic en...  59.3    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_008238760.1|  PREDICTED: probable rhamnose biosynthetic en...  60.8    2e-16   
ref|XP_008373757.1|  PREDICTED: probable rhamnose biosynthetic en...  58.5    3e-16   
ref|XP_010916151.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  58.5    3e-16   Elaeis guineensis
ref|XP_007146360.1|  hypothetical protein PHAVU_006G034000g           62.4    1e-15   Phaseolus vulgaris [French bean]
emb|CDX81794.1|  BnaC08g38070D                                        58.5    2e-14   
gb|KHM99622.1|  Putative rhamnose biosynthetic enzyme 1               60.8    2e-14   Glycine soja [wild soybean]
gb|KEH17189.1|  rhamnose biosynthetic-like enzyme                     68.6    2e-11   Medicago truncatula
ref|XP_011031381.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  67.8    3e-11   Populus euphratica
ref|XP_008380346.1|  PREDICTED: probable rhamnose biosynthetic en...  67.8    3e-11   Malus domestica [apple tree]
ref|XP_009356708.1|  PREDICTED: probable rhamnose biosynthetic en...  67.4    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_004498563.1|  PREDICTED: probable rhamnose biosynthetic en...  67.4    4e-11   Cicer arietinum [garbanzo]
ref|XP_003588651.1|  Rhamnose synthase                                67.4    4e-11   Medicago truncatula
ref|XP_002468080.1|  hypothetical protein SORBIDRAFT_01g039220        67.0    6e-11   Sorghum bicolor [broomcorn]
ref|XP_002468088.1|  hypothetical protein SORBIDRAFT_01g039340        67.0    6e-11   Sorghum bicolor [broomcorn]
ref|XP_007225132.1|  hypothetical protein PRUPE_ppa002547mg           67.0    6e-11   Prunus persica
ref|XP_009363628.1|  PREDICTED: probable rhamnose biosynthetic en...  67.0    6e-11   Pyrus x bretschneideri [bai li]
gb|KHN29165.1|  Putative rhamnose biosynthetic enzyme 1               66.6    7e-11   Glycine soja [wild soybean]
ref|XP_004292875.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  66.2    1e-10   Fragaria vesca subsp. vesca
gb|KJB45828.1|  hypothetical protein B456_007G332000                  65.9    1e-10   Gossypium raimondii
ref|XP_008220004.1|  PREDICTED: probable rhamnose biosynthetic en...  65.9    1e-10   Prunus mume [ume]
gb|EMT06313.1|  hypothetical protein F775_00857                       63.2    1e-10   
ref|XP_006382137.1|  hypothetical protein POPTR_0006s28750g           65.9    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_005648979.1|  NAD-dependent epimerase/dehydratase              46.2    2e-10   Coccomyxa subellipsoidea C-169
gb|EEC73782.1|  hypothetical protein OsI_08465                        64.3    2e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001130297.1|  uncharacterized protein LOC100191391             65.1    2e-10   Zea mays [maize]
gb|ACG33666.1|  RHM1                                                  65.1    3e-10   Zea mays [maize]
ref|XP_003545554.1|  PREDICTED: probable rhamnose biosynthetic en...  65.1    3e-10   Glycine max [soybeans]
gb|KHN30780.1|  Putative rhamnose biosynthetic enzyme 1               64.7    3e-10   Glycine soja [wild soybean]
ref|XP_002989472.1|  hypothetical protein SELMODRAFT_129972           64.7    3e-10   
ref|XP_002964674.1|  hypothetical protein SELMODRAFT_266803           64.7    3e-10   Selaginella moellendorffii
ref|NP_001173114.1|  Os02g0678400                                     63.2    5e-10   
emb|CBI24007.3|  unnamed protein product                              64.3    5e-10   Vitis vinifera
ref|XP_002271970.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  63.9    6e-10   Vitis vinifera
ref|XP_002500589.1|  predicted protein                                49.3    7e-10   
ref|XP_008812156.1|  PREDICTED: probable rhamnose biosynthetic en...  63.2    1e-09   
ref|XP_003084264.1|  UDP-glucose 4-epimerase/UDP-sulfoquinovose s...  49.7    1e-09   
emb|CEG01892.1|  NAD-dependent epimerase/dehydratase                  49.3    2e-09   
gb|EWM28830.1|  epimerase 4-reductase                                 48.1    2e-09   
ref|XP_004138882.1|  PREDICTED: probable rhamnose biosynthetic en...  61.6    4e-09   
emb|CAN62061.1|  hypothetical protein VITISV_001928                   61.6    4e-09   
ref|XP_010109352.1|  putative rhamnose biosynthetic enzyme 1          61.2    5e-09   
gb|EYU36944.1|  hypothetical protein MIMGU_mgv1a018499mg              58.2    9e-09   
emb|CBN77585.1|  conserved unknown protein                            46.2    9e-09   
ref|XP_006483733.1|  PREDICTED: probable rhamnose biosynthetic en...  60.1    2e-08   
ref|XP_006450198.1|  hypothetical protein CICLE_v10010306mg           60.1    2e-08   
gb|KDO67325.1|  hypothetical protein CISIN_1g035631mg                 60.1    2e-08   
ref|XP_007514013.1|  predicted protein                                47.8    2e-08   
ref|XP_005535009.1|  similar to dTDP-4-dehydrorhamnose reductase      43.5    4e-08   
emb|CDX98052.1|  BnaA06g08030D                                        57.8    5e-08   
ref|XP_004337383.1|  NAD dependent epimerase/dehydratase              45.4    5e-08   
ref|XP_005536684.1|  similar to dTDP-4-dehydrorhamnose reductase      43.1    5e-08   
ref|XP_007508076.1|  predicted protein                                46.2    5e-08   
ref|XP_002324380.1|  hypothetical protein POPTR_0018s03420g           54.7    9e-08   
ref|XP_009036108.1|  hypothetical protein AURANDRAFT_25417            42.4    1e-07   
ref|XP_005537979.1|  similar to dTDP-4-dehydrorhamnose reductase      43.5    1e-07   
emb|CBK21796.2|  unnamed protein product                              44.3    1e-07   
ref|XP_005826217.1|  hypothetical protein GUITHDRAFT_89166            42.0    2e-07   
ref|XP_009039633.1|  hypothetical protein AURANDRAFT_38303            42.4    2e-07   
gb|EME44168.1|  hypothetical protein DOTSEDRAFT_80011                 46.6    2e-07   
ref|XP_003551914.1|  PREDICTED: probable rhamnose biosynthetic en...  55.8    4e-07   
gb|KHN18103.1|  Putative rhamnose biosynthetic enzyme 1               55.8    4e-07   
gb|KIL84951.1|  hypothetical protein FAVG1_11821                      44.7    5e-07   
ref|XP_001695032.1|  predicted protein                                54.3    7e-07   
ref|XP_002184144.1|  predicted protein                                41.6    7e-07   
ref|XP_005537191.1|  similar to dTDP-4-dehydrorhamnose reductase      40.0    8e-07   
ref|XP_005707655.1|  dTDP-4-dehydrorhamnose reductase                 40.0    1e-06   
ref|XP_009776239.1|  PREDICTED: probable rhamnose biosynthetic en...  51.6    2e-06   
ref|XP_002955639.1|  hypothetical protein VOLCADRAFT_76853            53.1    2e-06   
gb|EJK71347.1|  hypothetical protein THAOC_07228                      39.7    2e-06   
ref|XP_011320564.1|  hypothetical protein FGSG_13414                  42.0    2e-06   
gb|EYB25340.1|  hypothetical protein FG05_13414                       42.0    2e-06   
ref|XP_009260961.1|  hypothetical protein FPSE_09569                  41.6    2e-06   
gb|EGU73824.1|  hypothetical protein FOXB_15664                       45.4    3e-06   
ref|WP_038308628.1|  hypothetical protein                             39.7    3e-06   
ref|XP_005851985.1|  hypothetical protein CHLNCDRAFT_132889           52.4    4e-06   
ref|XP_011117055.1|  hypothetical protein AOL_s00004g103              41.6    4e-06   
gb|KDD74838.1|  hypothetical protein H632_c1041p0                     52.0    5e-06   
gb|KIM94722.1|  hypothetical protein OIDMADRAFT_45649                 42.0    7e-06   
ref|XP_003709861.1|  hypothetical protein MGG_09238                   42.0    7e-06   
ref|XP_002290334.1|  hypothetical protein THAPSDRAFT_40788            38.1    1e-05   
ref|XP_003665385.1|  epimerase/hydratase                              43.9    1e-05   
gb|KIN02359.1|  hypothetical protein OIDMADRAFT_162496                41.2    2e-05   
ref|XP_001740296.1|  NAD dependent epimerase/dehydratase              38.9    2e-05   
ref|XP_001738724.1|  NAD dependent epimerase/dehydratase              38.9    2e-05   
ref|XP_003057320.1|  predicted protein                                51.2    2e-05   
ref|XP_655810.1|  hypothetical protein                                38.5    2e-05   
ref|XP_004255825.1|  NAD dependent epimerase/dehydratase, putative    40.8    2e-05   
ref|XP_644280.1|  hypothetical protein DDB_G0274991                   42.4    2e-05   
ref|XP_011109886.1|  hypothetical protein H072_3926                   41.2    2e-05   
gb|KEQ68917.1|  UDP-4-keto-6-deoxy-glucose-3,5-epimerase/ UDP-4-k...  42.7    2e-05   
ref|XP_003654153.1|  hypothetical protein THITE_2049831               42.4    3e-05   
gb|KIZ02088.1|  putative rhamnose biosynthetic enzyme 1               48.9    5e-05   
ref|XP_006966750.1|  predicted protein                                38.5    1e-04   
gb|EMD97212.1|  hypothetical protein COCHEDRAFT_1150873               38.5    1e-04   
ref|XP_007682126.1|  hypothetical protein COCMIDRAFT_31392            38.5    2e-04   
ref|XP_007040094.1|  Uncharacterized protein TCM_016156               41.6    2e-04   
gb|KDO24436.1|  hypothetical protein SPRG_09826                       37.4    2e-04   
ref|XP_008610980.1|  hypothetical protein SDRG_06946                  37.0    3e-04   
gb|EFX02264.1|  NAD dependent epimerase                               46.6    3e-04   
ref|XP_006579608.1|  PREDICTED: probable rhamnose biosynthetic en...  45.4    4e-04   
ref|XP_007677597.1|  hypothetical protein BAUCODRAFT_72815            40.8    4e-04   
ref|YP_003987312.1|  uncharacterized dTDP-4-dehydrorhamnose reduc...  36.6    5e-04   
gb|KHN34442.1|  Putative rhamnose biosynthetic enzyme 1               45.4    5e-04   
ref|XP_006695147.1|  hypothetical protein CTHT_0047820                45.8    7e-04   
gb|EPQ67692.1|  hypothetical protein BGT96224_2262                    45.4    8e-04   
ref|XP_003290007.1|  hypothetical protein DICPUDRAFT_92411            43.9    8e-04   
gb|EWG55514.1|  dTDP-glucose 4,6-dehydratase                          45.4    9e-04   



>gb|EYU26294.1| hypothetical protein MIMGU_mgv1a002474mg [Erythranthe guttata]
Length=669

 Score = 69.3 bits (168),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  523  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  554


 Score = 56.2 bits (134),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  556  YNKVVNIPNSMTVLDELLPISIEMAKRNL  584



>ref|XP_008451740.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451741.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451742.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
Length=670

 Score = 68.2 bits (165),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 57.0 bits (136),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_004509959.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cicer 
arietinum]
Length=667

 Score = 68.2 bits (165),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  525  LLREYDNVCTLRVRMPISSDLSNPRNFITKIS  556


 Score = 56.6 bits (135),  Expect(2) = 3e-20, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_011098163.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
 ref|XP_011098164.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
Length=675

 Score = 67.4 bits (163),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  529  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  560


 Score = 56.6 bits (135),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  562  YNKVVNIPNSMTILDELLPISIEMAKRNL  590



>emb|CDY71423.1| BnaCnng72830D, partial [Brassica napus]
Length=431

 Score = 67.8 bits (164),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  288  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  319


 Score = 56.6 bits (135),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  321  YNKVVNIPNSMTVLDELLPISIEMAKRNL  349



>ref|XP_010093448.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXB54072.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=671

 Score = 67.4 bits (163),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  556


 Score = 56.6 bits (135),  Expect(2) = 5e-20, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|NP_177978.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9SYM5.1|RHM1_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1; AltName: Full=Protein REPRESSOR OF LRX1 1; AltName: 
Full=Rhamnose biosynthetic enzyme 1; Short=AtRHM1; Includes: 
RecName: Full=UDP-glucose 4,6-dehydratase; Includes: 
RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAD30579.1|AC007260_10 Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAK68773.1| Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAM10033.1| similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AEE36122.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=669

 Score = 67.4 bits (163),  Expect(2) = 6e-20, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  526  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  557


 Score = 56.2 bits (134),  Expect(2) = 6e-20, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  559  YNKVVNIPNSMTVLDELLPISIEMAKRNL  587



>ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006594709.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score = 67.8 bits (164),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  556


 Score = 55.8 bits (133),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>gb|KHN36936.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score = 67.4 bits (163),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  556


 Score = 55.8 bits (133),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 ref|XP_004156513.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN53576.1| hypothetical protein Csa_4G083510 [Cucumis sativus]
Length=670

 Score = 68.2 bits (165),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 55.1 bits (131),  Expect(2) = 9e-20, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YSKVVNIPNSMTILDELLPISIEMAKRNL  586



>gb|KHN19477.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score = 67.4 bits (163),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  556


 Score = 55.5 bits (132),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006592951.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score = 67.4 bits (163),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  556


 Score = 55.5 bits (132),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64003.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score = 67.4 bits (163),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  526  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  557


 Score = 55.5 bits (132),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PIS+EMAKRNL
Sbjct  559  YNKVVNIPNSMTVLDELLPISVEMAKRNL  587



>ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006597976.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
 ref|XP_006597977.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=668

 Score = 66.2 bits (160),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  525  LLREYDNVCTLRVRMPISSDLSNPRNFITKIS  556


 Score = 56.6 bits (135),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>gb|EPS62084.1| hypothetical protein M569_12709, partial [Genlisea aurea]
Length=617

 Score = 68.2 bits (165),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  477  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  508


 Score = 54.7 bits (130),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMA+R+L
Sbjct  510  YNKVVNIPNSMTILDELLPISIEMARRDL  538



>ref|XP_007022008.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY13533.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=667

 Score = 65.9 bits (159),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  524  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  555


 Score = 56.6 bits (135),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  557  YNKVVNIPNSMTILDELLPISIEMAKRNL  585



>ref|XP_006647099.1| PREDICTED: probable rhamnose biosynthetic enzyme 3-like [Oryza 
brachyantha]
Length=667

 Score = 67.4 bits (163),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  521  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  552


 Score = 55.1 bits (131),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PIS+EMAKRNL
Sbjct  554  YNKVVNIPNSMTILDELLPISVEMAKRNL  582



>ref|XP_009377674.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score = 67.4 bits (163),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  529  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  560


 Score = 55.1 bits (131),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  562  YNKVVDIPNSMTILDELLPISIEMAKRNL  590



>gb|ACJ11756.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score = 65.9 bits (159),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  524  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIA  555


 Score = 56.6 bits (135),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  557  YNKVVNIPNSMTILDELLPISIEMAKRNL  585



>gb|KJB12934.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12935.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12936.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
Length=667

 Score = 65.9 bits (159),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  524  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIA  555


 Score = 56.6 bits (135),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  557  YNKVVNIPNSMTILDELLPISIEMAKRNL  585



>ref|XP_009610279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=674

 Score = 65.9 bits (159),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  529  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  560


 Score = 56.6 bits (135),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  562  YNKVVNIPNSMTILDELLPISIEMAKRNL  590



>ref|XP_009776312.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=671

 Score = 65.9 bits (159),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  526  LLKEYENVCTLRVRMPISSDLSNPRNFITKIS  557


 Score = 56.6 bits (135),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  559  YNKVVNIPNSMTILDELLPISIEMAKRNL  587



>ref|XP_010035897.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW47401.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=674

 Score = 67.4 bits (163),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  528  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  559


 Score = 55.1 bits (131),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PIS+EMAKRNL
Sbjct  561  YNKVVNIPNSMTILDELLPISVEMAKRNL  589



>ref|XP_007149511.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
 gb|ESW21505.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
Length=669

 Score = 66.2 bits (160),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  525  LLREYDNVCTLRVRMPISSDLSNPRNFITKIS  556


 Score = 55.8 bits (133),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_011082806.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Sesamum indicum]
Length=671

 Score = 65.9 bits (159),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 56.2 bits (134),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_006370064.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
 gb|ERP66633.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
Length=670

 Score = 65.9 bits (159),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  527  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  558


 Score = 56.2 bits (134),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  560  YNKVVNIPNSMTILDELLPISIEMAKRNL  588



>gb|EYU38237.1| hypothetical protein MIMGU_mgv1a002436mg [Erythranthe guttata]
Length=675

 Score = 65.1 bits (157),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPIS+DL NPRNFITKI+
Sbjct  527  LLKEYDNVCTLRVRMPISADLDNPRNFITKIS  558


 Score = 57.0 bits (136),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  560  YNKVVNIPNSMTILDELLPISIEMAKRNL  588



>ref|XP_010537694.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=670

 Score = 65.5 bits (158),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE++NVCTLRVRMPISSDL NPRNFITKIT
Sbjct  527  LLKEFENVCTLRVRMPISSDLKNPRNFITKIT  558


 Score = 56.6 bits (135),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  560  YNKVVNIPNSMTVLDELLPISIEMAKRNL  588



>gb|KHN18614.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=353

 Score = 66.2 bits (160),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  210  LLREYDNVCTLRVRMPISSDLSNPRNFITKIS  241


 Score = 55.8 bits (133),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  243  YNKVVNIPNSMTILDELLPISIEMAKRNL  271



>ref|XP_004488984.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004488985.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=670

 Score = 66.2 bits (160),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  526  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  557


 Score = 55.8 bits (133),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  559  YNKVVNIPNSMTILDELLPISIEMAKRNL  587



>ref|XP_011006811.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
 ref|XP_011006812.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=670

 Score = 66.2 bits (160),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  527  LLREYDNVCTLRVRMPISSDLSNPRNFITKIS  558


 Score = 55.5 bits (132),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  560  YNKVVNIPNSMTILDELLPISIEMAKRNL  588



>gb|KDO60921.1| hypothetical protein CISIN_1g005818mg [Citrus sinensis]
Length=676

 Score = 65.9 bits (159),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  526  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  557


 Score = 55.8 bits (133),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PIS+EMAKRNL
Sbjct  559  YNKVVNIPNSMTILDELLPISVEMAKRNL  587



>ref|XP_009783771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=674

 Score = 65.9 bits (159),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  529  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  560


 Score = 55.8 bits (133),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  562  YNKVVNIPNSMTILDELLPISIEMAKRNL  590



>emb|CDP06058.1| unnamed protein product [Coffea canephora]
Length=653

 Score = 67.4 bits (163),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  508  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  539


 Score = 54.3 bits (129),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  541  YNKVVDIPNSMTILDELLPISIEMAKRNL  569



>ref|XP_009590265.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009590274.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=671

 Score = 65.9 bits (159),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  526  LLKEYENVCTLRVRMPISSDLSNPRNFITKIS  557


 Score = 55.8 bits (133),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  559  YNKVVNIPNSMTILDELLPISIEMAKRNL  587



>ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006585328.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X4 [Glycine max]
 ref|XP_006585329.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X5 [Glycine max]
 ref|XP_006585330.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X6 [Glycine max]
Length=668

 Score = 64.7 bits (156),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL++YDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  525  LLRDYDNVCTLRVRMPISSDLSNPRNFITKIS  556


 Score = 56.6 bits (135),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_010462242.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score = 65.1 bits (157),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLREYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 56.6 bits (135),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTVLDELLPISIEMAKRNL  586



>gb|KHG07031.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score = 66.2 bits (160),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  524  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  555


 Score = 55.5 bits (132),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  557  YNKVVNIPNSMTVLDELLPISIEMAKRNL  585



>ref|XP_011045548.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Populus euphratica]
Length=670

 Score = 65.9 bits (159),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  527  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  558


 Score = 55.5 bits (132),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  560  YNKVVNIPNSMTILDELLPISIEMAKRNL  588



>emb|CDY20084.1| BnaA01g29180D [Brassica napus]
Length=644

 Score = 64.7 bits (156),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  501  LLREYDNVCTLRVRMPISSDLNNPRNFITKIS  532


 Score = 56.6 bits (135),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  534  YNKVVNIPNSMTILDELLPISIEMAKRNL  562



>ref|XP_010479911.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score = 64.7 bits (156),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLREYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 56.6 bits (135),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTVLDELLPISIEMAKRNL  586



>ref|XP_009394841.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394842.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score = 67.0 bits (162),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  526  LLKEYENVCTLRVRMPISSDLSNPRNFITKIT  557


 Score = 54.3 bits (129),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM +LDEL PISIEMAKRN
Sbjct  559  YNKVVNIPNSMTVLDELLPISIEMAKRN  586



>gb|KDP30504.1| hypothetical protein JCGZ_17141 [Jatropha curcas]
Length=671

 Score = 65.9 bits (159),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  528  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  559


 Score = 55.5 bits (132),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  561  YNKVVNIPNSMTVLDELLPISIEMAKRNL  589



>gb|ADB24772.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score = 64.7 bits (156),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            L KEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  524  LFKEYDNVCTLRVRMPISSDLNNPRNFITKIS  555


 Score = 56.6 bits (135),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  557  YNKVVNIPNSMTVLDELLPISIEMAKRNL  585



>ref|XP_006437200.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
 gb|ESR50440.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
Length=676

 Score = 65.9 bits (159),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  526  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  557


 Score = 55.5 bits (132),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PIS+EMAKRNL
Sbjct  559  YNKVVNIPNSMTILDELLPISVEMAKRNL  587



>gb|KEH38548.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=682

 Score = 65.9 bits (159),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK+YDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  538  LLKDYDNVCTLRVRMPISSDLSNPRNFITKIS  569


 Score = 55.5 bits (132),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  571  YNKVVNIPNSMTVLDELLPISIEMAKRNL  599



>ref|XP_006484833.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=676

 Score = 65.9 bits (159),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  526  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  557


 Score = 55.5 bits (132),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PIS+EMAKRNL
Sbjct  559  YNKVVNIPNSMTILDELLPISVEMAKRNL  587



>ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=691

 Score = 64.7 bits (156),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL++YDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  548  LLRDYDNVCTLRVRMPISSDLSNPRNFITKIS  579


 Score = 56.6 bits (135),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  581  YNKVVNIPNSMTILDELLPISIEMAKRNL  609



>ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=690

 Score = 64.7 bits (156),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL++YDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  547  LLRDYDNVCTLRVRMPISSDLSNPRNFITKIS  578


 Score = 56.6 bits (135),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  580  YNKVVNIPNSMTILDELLPISIEMAKRNL  608



>ref|XP_003571828.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
 ref|XP_010234080.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
Length=667

 Score = 65.9 bits (159),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 55.5 bits (132),  Expect(2) = 3e-19, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PIS+EMAKRNL
Sbjct  554  YNKVVNIPNSMTVLDELLPISVEMAKRNL  582



>ref|XP_002531238.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF31135.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=622

 Score = 65.9 bits (159),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  479  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  510


 Score = 55.5 bits (132),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  512  YNKVVNIPNSMTVLDELLPISIEMAKRNL  540



>ref|XP_008342373.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score = 67.4 bits (163),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  529  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  560


 Score = 53.9 bits (128),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  562  YNKVVDIPNSMTILDELLPISVEMAKRNL  590



>ref|XP_004303854.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Fragaria vesca subsp. vesca]
Length=679

 Score = 67.4 bits (163),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  529  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  560


 Score = 53.9 bits (128),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  562  YNKVVDIPNSMTILDELLPISVEMAKRNL  590



>ref|XP_006442344.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442345.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442346.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55584.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55585.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55586.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
Length=668

 Score = 65.9 bits (159),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 55.1 bits (131),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTVLDELLPISIEMAKRNL  586



>ref|XP_006477818.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477819.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Citrus sinensis]
Length=668

 Score = 65.9 bits (159),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 55.5 bits (132),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTVLDELLPISIEMAKRNL  586



>gb|KDO49287.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
 gb|KDO49288.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
Length=668

 Score = 65.9 bits (159),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 55.5 bits (132),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTVLDELLPISIEMAKRNL  586



>emb|CDY32340.1| BnaC01g36590D [Brassica napus]
Length=643

 Score = 64.7 bits (156),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  500  LLREYDNVCTLRVRMPISSDLNNPRNFITKIS  531


 Score = 56.2 bits (134),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  533  YNKVVNIPNSMTILDELLPISIEMAKRNL  561



>gb|KJB45831.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=667

 Score = 65.9 bits (159),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  524  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  555


 Score = 55.1 bits (131),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAK+NL
Sbjct  557  YNKVVNIPNSMTVLDELLPISIEMAKKNL  585



>ref|XP_010268536.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Nelumbo nucifera]
Length=665

 Score = 65.9 bits (159),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  522  LLREYDNVCTLRVRMPISSDLNNPRNFITKIT  553


 Score = 55.1 bits (131),  Expect(2) = 4e-19, Method: Composition-based stats.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM +LDEL PISIEMAKRN
Sbjct  555  YNKVVNIPNSMTVLDELLPISIEMAKRN  582



>ref|XP_002317559.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
 gb|EEE98171.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
Length=670

 Score = 66.2 bits (160),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  527  LLREYDNVCTLRVRMPISSDLSNPRNFITKIS  558


 Score = 54.7 bits (130),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM IL+EL PISIEMAKRNL
Sbjct  560  YNKVVNIPNSMTILEELLPISIEMAKRNL  588



>ref|XP_004960685.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=666

 Score = 65.5 bits (158),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDLSNPRNF+TKI+
Sbjct  520  LLKEYENVCTLRVRMPISSDLSNPRNFVTKIS  551


 Score = 55.5 bits (132),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PIS+EMAKRNL
Sbjct  553  YNKVVNIPNSMTILDELLPISVEMAKRNL  581



>ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
 ref|XP_010327108.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
Length=674

 Score = 65.1 bits (157),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  529  LLKNYDNVCTLRVRMPISSDLSNPRNFITKIS  560


 Score = 55.8 bits (133),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  562  YNKVVNIPNSMTILDELLPISIEMAKRNL  590



>ref|XP_010429684.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472689.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472690.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=670

 Score = 64.7 bits (156),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  527  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  558


 Score = 56.2 bits (134),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  560  YNKVVNIPNSMTVLDELLPISIEMAKRNL  588



>ref|XP_006360030.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006360031.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Solanum tuberosum]
Length=674

 Score = 65.1 bits (157),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  529  LLKNYDNVCTLRVRMPISSDLSNPRNFITKIS  560


 Score = 55.8 bits (133),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  562  YNKVVNIPNSMTILDELLPISIEMAKRNL  590



>ref|XP_006301908.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
 gb|EOA34806.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
Length=669

 Score = 64.7 bits (156),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  526  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  557


 Score = 56.2 bits (134),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  559  YNKVVNIPNSMTVLDELLPISIEMAKRNL  587



>emb|CDX88455.1| BnaC06g38990D [Brassica napus]
Length=707

 Score = 64.7 bits (156),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  564  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  595


 Score = 56.2 bits (134),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  597  YNKVVNIPNSMTVLDELLPISIEMAKRNL  625



>ref|XP_006355193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=654

 Score = 68.2 bits (165),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 32/32 (100%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  511  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  542


 Score = 52.4 bits (124),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM +LDEL PISIEMAKRN
Sbjct  544  YDKVVNIPNSMTVLDELLPISIEMAKRN  571



>ref|XP_010417456.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Camelina sativa]
 ref|XP_010417457.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Camelina sativa]
 ref|XP_010417458.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X3 
[Camelina sativa]
Length=671

 Score = 64.7 bits (156),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  528  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  559


 Score = 56.2 bits (134),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  561  YNKVVNIPNSMTVLDELLPISIEMAKRNL  589



>ref|XP_006392784.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
 gb|ESQ30070.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
Length=667

 Score = 63.5 bits (153),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  524  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  555


 Score = 57.0 bits (136),  Expect(2) = 5e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  557  YNKVVNIPNSMTILDELLPISIEMAKRNL  585



>ref|XP_006389974.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
 gb|ESQ27260.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
Length=669

 Score = 64.7 bits (156),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  526  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  557


 Score = 55.8 bits (133),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  559  YNKVVNIPNSMTVLDELLPISIEMAKRNL  587



>ref|XP_010924680.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Elaeis guineensis]
Length=673

 Score = 67.0 bits (162),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  527  LLKEYENVCTLRVRMPISSDLSNPRNFITKIT  558


 Score = 53.5 bits (127),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM ILDEL PIS+EMAKRN
Sbjct  560  YNKVVNIPNSMTILDELLPISVEMAKRN  587



>ref|XP_009147602.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=665

 Score = 63.2 bits (152),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  522  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  553


 Score = 57.0 bits (136),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  555  YNKVVNIPNSMTILDELLPISIEMAKRNL  583



>ref|XP_010552134.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Tarenaya hassleriana]
Length=668

 Score = 64.7 bits (156),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLREYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 55.5 bits (132),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_009144768.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
 ref|XP_009144769.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=668

 Score = 63.5 bits (153),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 57.0 bits (136),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>emb|CDY60210.1| BnaCnng35880D [Brassica napus]
Length=668

 Score = 63.5 bits (153),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 57.0 bits (136),  Expect(2) = 6e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_010060763.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW67616.1| hypothetical protein EUGRSUZ_F01369 [Eucalyptus grandis]
Length=666

 Score = 65.9 bits (159),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  520  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  551


 Score = 54.3 bits (129),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDE+ P+SIEMAKRNL
Sbjct  553  YNKVVNIPNSMTVLDEVLPVSIEMAKRNL  581



>emb|CDY24092.1| BnaA06g00900D [Brassica napus]
Length=665

 Score = 63.2 bits (152),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  522  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  553


 Score = 57.0 bits (136),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  555  YNKVVNIPNSMTILDELLPISIEMAKRNL  583



>ref|XP_002894444.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70703.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
Length=668

 Score = 64.7 bits (156),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLREYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 55.5 bits (132),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVDIPNSMTILDELLPISIEMAKRNL  586



>emb|CDY45116.1| BnaC06g06370D [Brassica napus]
Length=665

 Score = 63.2 bits (152),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  522  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  553


 Score = 57.0 bits (136),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  555  YNKVVNIPNSMTILDELLPISIEMAKRNL  583



>ref|XP_010487282.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score = 63.2 bits (152),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 56.6 bits (135),  Expect(2) = 7e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  554  YNKVVNIPNSMTILDELLPISIEMAKRNL  582



>ref|XP_003551160.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
Length=655

 Score = 64.7 bits (156),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  512  LLKNYDNVCTLRVRMPISSDLSNPRNFITKIS  543


 Score = 55.1 bits (131),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  545  YNKVVNIPNSMTVLDELLPISIEMAKRNL  573



>emb|CDX98494.1| BnaC05g38810D [Brassica napus]
Length=646

 Score = 63.2 bits (152),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  503  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  534


 Score = 56.6 bits (135),  Expect(2) = 8e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  536  YNKVVNIPNSMTILDELLPISIEMAKRNL  564



>ref|XP_009146324.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Brassica 
rapa]
Length=665

 Score = 63.2 bits (152),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  522  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  553


 Score = 56.6 bits (135),  Expect(2) = 8e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  555  YNKVVNIPNSMTILDELLPISIEMAKRNL  583



>ref|XP_009376726.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009376727.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Pyrus x bretschneideri]
Length=668

 Score = 64.3 bits (155),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 55.5 bits (132),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELIPISIEMAKRNL  586



>ref|XP_009421279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=678

 Score = 64.7 bits (156),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  528  LLREYDNVCTLRVRMPISSDLNNPRNFITKIS  559


 Score = 55.1 bits (131),  Expect(2) = 9e-19, Method: Composition-based stats.
 Identities = 26/28 (93%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM ILDEL PISIEMAKRN
Sbjct  561  YNKVVNIPNSMTILDELLPISIEMAKRN  588



>ref|XP_010501002.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score = 64.7 bits (156),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLREYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 55.1 bits (131),  Expect(2) = 9e-19, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAK+NL
Sbjct  558  YNKVVNIPNSMTVLDELLPISIEMAKKNL  586



>ref|NP_001152718.1| LOC100286359 [Zea mays]
 gb|ACG49124.1| dTDP-4-dehydrorhamnose reductase [Zea mays]
 gb|ACR38060.1| unknown [Zea mays]
 gb|AFW72796.1| dTDP-4-dehydrorhamnose reductase [Zea mays]
Length=307

 Score = 65.9 bits (159),  Expect(2) = 9e-19, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  161  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  192


 Score = 53.9 bits (128),  Expect(2) = 9e-19, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  194  YDKVVNIPNSMTVLDELLPISIEMAKRNL  222



>emb|CDX97601.1| BnaA05g24780D [Brassica napus]
Length=646

 Score = 63.2 bits (152),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  503  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  534


 Score = 56.6 bits (135),  Expect(2) = 9e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  536  YNKVVNIPNSMTILDELLPISIEMAKRNL  564



>ref|XP_007215006.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
 gb|EMJ16205.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
Length=675

 Score = 67.4 bits (163),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  529  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  560


 Score = 52.4 bits (124),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  562  YDKVVDIPNSMTILDELLPISVEMAKRNL  590



>ref|XP_008229395.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=669

 Score = 67.4 bits (163),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  523  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIS  554


 Score = 52.4 bits (124),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  556  YDKVVDIPNSMTILDELLPISVEMAKRNL  584



>ref|XP_006407044.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 ref|XP_006407045.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48497.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48498.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
Length=664

 Score = 63.2 bits (152),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 56.6 bits (135),  Expect(2) = 9e-19, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  554  YNKVVNIPNSMTILDELLPISIEMAKRNL  582



>ref|XP_010465388.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score = 63.2 bits (152),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 56.6 bits (135),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  554  YNKVVNIPNSMTILDELLPISIEMAKRNL  582



>ref|XP_008380229.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score = 65.9 bits (159),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  529  LLKEYENVCTLRVRMPISSDLSNPRNFITKIS  560


 Score = 53.9 bits (128),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  562  YNKVVDIPNSMTILDELLPISVEMAKRNL  590



>ref|XP_009356652.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score = 65.9 bits (159),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  529  LLKEYENVCTLRVRMPISSDLSNPRNFITKIS  560


 Score = 53.9 bits (128),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  562  YNKVVDIPNSMTILDELLPISVEMAKRNL  590



>ref|XP_010062770.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 ref|XP_010062771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW69901.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
 gb|KCW69902.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
Length=671

 Score = 65.9 bits (159),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  528  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  559


 Score = 53.5 bits (127),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  561  YSKVVNIPNSMTILDELLPISIEMAKRNL  589



>ref|XP_004294169.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
 ref|XP_011460833.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
Length=671

 Score = 63.9 bits (154),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLNEFDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 55.8 bits (133),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSMTILDELLPISIEMAKRNL  586



>ref|XP_006297150.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
 gb|EOA30048.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
Length=664

 Score = 63.2 bits (152),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 56.2 bits (134),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  554  YNKVVNIPNSMTILDELLPISIEMAKRNL  582



>ref|XP_008226345.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=671

 Score = 65.9 bits (159),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 53.9 bits (128),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNS+ ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSVTILDELLPISIEMAKRNL  586



>ref|XP_010502125.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score = 63.2 bits (152),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 56.2 bits (134),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  554  YNKVVNIPNSMTILDELLPISIEMAKRNL  582



>ref|XP_009586858.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586859.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586860.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=653

 Score = 66.6 bits (161),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  510  LLKEYENVCTLRVRMPISSDLSNPRNFITKIT  541


 Score = 52.8 bits (125),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM +LDEL PISIEMAKRN
Sbjct  543  YDKVVNIPNSMTVLDELLPISIEMAKRN  570



>gb|ACG28244.1| dTDP-4-dehydrorhamnose reductase [Zea mays]
Length=309

 Score = 65.9 bits (159),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  163  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  194


 Score = 53.9 bits (128),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  196  YDKVVNIPNSMTVLDELLPISIEMAKRNL  224



>ref|XP_010533730.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=300

 Score = 65.1 bits (157),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  153  LLKNYDNVCTLRVRMPISSDLSNPRNFITKIS  184


 Score = 54.3 bits (129),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  186  YNKVVDIPNSMTILDELLPISIEMAKRNL  214



>ref|XP_001779703.1| predicted protein [Physcomitrella patens]
 gb|EDQ55499.1| predicted protein [Physcomitrella patens]
Length=666

 Score = 65.1 bits (157),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKI  95
            LLKE+DNVCTLRVRMPISSDL NPRNFI+KI
Sbjct  520  LLKEFDNVCTLRVRMPISSDLQNPRNFISKI  550


 Score = 54.7 bits (130),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y K+VNIPNSM ILDEL PISIEMAKRNL
Sbjct  553  YQKIVNIPNSMTILDELLPISIEMAKRNL  581



>gb|KHG22077.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score = 62.4 bits (150),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDL+NPRNFI KI 
Sbjct  524  LLKEYENVCTLRVRMPISSDLNNPRNFIAKIA  555


 Score = 57.0 bits (136),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  557  YNKVVNIPNSMTILDELLPISIEMAKRNL  585



>ref|XP_010273412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=676

 Score = 64.3 bits (155),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  527  LLKEYENVCTLRVRMPISSDLTNPRNFITKIS  558


 Score = 55.1 bits (131),  Expect(2) = 1e-18, Method: Composition-based stats.
 Identities = 26/28 (93%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM ILDEL PISIEMAKRN
Sbjct  560  YNKVVNIPNSMTILDELLPISIEMAKRN  587



>ref|XP_008791880.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
 ref|XP_008791888.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=682

 Score = 65.9 bits (159),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  529  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  560


 Score = 53.1 bits (126),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM +LDEL PIS+EMAKRN
Sbjct  562  YNKVVNIPNSMTVLDELLPISVEMAKRN  589



>gb|KHN44082.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=350

 Score = 62.0 bits (149),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK+YDNVCTLRV MPISSDLSNPRNFITKI+
Sbjct  259  LLKDYDNVCTLRVCMPISSDLSNPRNFITKIS  290


 Score = 56.6 bits (135),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  292  YNKVVNIPNSMTILDELLPISIEMAKRNL  320



>ref|XP_002454480.1| hypothetical protein SORBIDRAFT_04g031900 [Sorghum bicolor]
 gb|EES07456.1| hypothetical protein SORBIDRAFT_04g031900 [Sorghum bicolor]
Length=307

 Score = 64.3 bits (155),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  161  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  192


 Score = 54.7 bits (130),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  194  YDKVVNIPNSMTILDELLPISIEMAKRNL  222



>ref|XP_004953442.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=307

 Score = 65.5 bits (158),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  161  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  192


 Score = 53.1 bits (126),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  194  YEKVVNIPNSMTILDELLPISIEMAKRNL  222



>ref|XP_002882893.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59152.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
Length=664

 Score = 63.2 bits (152),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 55.8 bits (133),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  554  YNKVVNIPNSMTILDELLPISIEMAKRNL  582



>ref|XP_010053354.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Eucalyptus 
grandis]
 gb|KCW77624.1| hypothetical protein EUGRSUZ_D01934 [Eucalyptus grandis]
Length=302

 Score = 64.7 bits (156),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  156  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  187


 Score = 53.9 bits (128),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVNIPNSMTILDELLPISIEMAKRNL  217



>emb|CDY35137.1| BnaA06g11470D [Brassica napus]
Length=670

 Score = 64.7 bits (156),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  527  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  558


 Score = 54.3 bits (129),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  560  YSKVVNIPNSMTVLDELLPISIEMAKRNL  588



>ref|XP_009149137.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=672

 Score = 64.7 bits (156),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  529  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  560


 Score = 54.3 bits (129),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  562  YSKVVNIPNSMTVLDELLPISIEMAKRNL  590



>gb|ADB24773.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score = 63.9 bits (154),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  524  LLKEYNNVCTLRVRMPISSDLNNPRNFITKIS  555


 Score = 54.7 bits (130),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  557  YSKVVNIPNSMTILDELLPISIEMAKRNL  585



>emb|CDY40003.1| BnaC05g13120D [Brassica napus]
Length=670

 Score = 64.7 bits (156),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  527  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  558


 Score = 53.9 bits (128),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  560  YSKVVNIPNSMTVLDELLPISIEMAKRNL  588



>ref|XP_010915435.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915436.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915438.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
Length=678

 Score = 65.9 bits (159),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  529  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  560


 Score = 53.1 bits (126),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM +LDEL PIS+EMAKRN
Sbjct  562  YNKVVNIPNSMTVLDELLPISVEMAKRN  589



>ref|NP_188097.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
 sp|Q9LH76.1|RHM3_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3; AltName: Full=Probable rhamnose biosynthetic 
enzyme 3; Short=AtRHM3; Includes: RecName: Full=UDP-glucose 
4,6-dehydratase; Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose 4-keto-reductase 
[Arabidopsis thaliana]
 dbj|BAB02645.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL84958.1| AT3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AAM98324.1| At3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AEE75567.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
Length=664

 Score = 63.2 bits (152),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 55.5 bits (132),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  554  YNKVVNIPNSMTILDELLPISIEMAKRNL  582



>ref|XP_010325193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=651

 Score = 66.6 bits (161),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  511  LLKEYNNVCTLRVRMPISSDLSNPRNFITKIT  542


 Score = 52.4 bits (124),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM +LDEL PISIEMAKRN
Sbjct  544  YDKVVNIPNSMTVLDELLPISIEMAKRN  571



>gb|KCW77625.1| hypothetical protein EUGRSUZ_D01934 [Eucalyptus grandis]
Length=294

 Score = 64.7 bits (156),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  148  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  179


 Score = 53.9 bits (128),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  181  YEKVVNIPNSMTILDELLPISIEMAKRNL  209



>ref|XP_008792282.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score = 67.0 bits (162),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  527  LLKEYENVCTLRVRMPISSDLSNPRNFITKIT  558


 Score = 51.6 bits (122),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM ILDEL PIS+EMAKRN
Sbjct  560  YSKVVNIPNSMTILDELLPISVEMAKRN  587



>ref|XP_002282339.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Vitis vinifera]
Length=302

 Score = 64.7 bits (156),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  156  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  187


 Score = 53.9 bits (128),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVNIPNSMTILDELLPISIEMAKRNL  217



>ref|XP_007213598.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 ref|XP_007213599.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14797.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14798.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
Length=671

 Score = 64.3 bits (155),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 54.3 bits (129),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNS+ ILDEL PISIEMAKRNL
Sbjct  558  YNKVVNIPNSLTILDELLPISIEMAKRNL  586



>ref|NP_001151455.1| RHM1 [Zea mays]
 ref|XP_008658705.1| PREDICTED: RHM1 isoform X1 [Zea mays]
 gb|ACG42927.1| RHM1 [Zea mays]
 gb|ACN32027.1| unknown [Zea mays]
 gb|AFW88805.1| RHM1 isoform 1 [Zea mays]
 gb|AFW88806.1| RHM1 isoform 2 [Zea mays]
Length=672

 Score = 67.0 bits (162),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  526  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIA  557


 Score = 51.6 bits (122),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM ILDEL PISIEMAKR+
Sbjct  559  YDKVVNIPNSMTILDELLPISIEMAKRD  586



>ref|XP_010933909.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase-like [Elaeis guineensis]
Length=302

 Score = 66.2 bits (160),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  156  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  187


 Score = 52.4 bits (124),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVDIPNSMTILDELLPISIEMAKRNL  217



>ref|XP_004244296.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=674

 Score = 62.8 bits (151),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY NVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  529  LLKEYPNVCTLRVRMPISSDLNNPRNFITKIS  560


 Score = 55.5 bits (132),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  562  YNKVVNIPNSMTILDELLPISIEMAKRNL  590



>ref|XP_010671686.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=675

 Score = 66.2 bits (160),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  528  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  559


 Score = 52.4 bits (124),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM +LDEL PISIEMAKRNL
Sbjct  561  YSKVVDIPNSMTVLDELLPISIEMAKRNL  589



>ref|XP_006348335.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=674

 Score = 62.8 bits (151),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY NVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  529  LLKEYPNVCTLRVRMPISSDLNNPRNFITKIS  560


 Score = 55.5 bits (132),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  562  YNKVVNIPNSMTILDELLPISIEMAKRNL  590



>ref|XP_009106565.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
 ref|XP_009106567.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=670

 Score = 67.8 bits (164),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  527  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIS  558


 Score = 50.8 bits (120),  Expect(2) = 2e-18, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNK VN PNSM +LDEL PISIEMAKRNL
Sbjct  560  YNKGVNSPNSMTVLDELFPISIEMAKRNL  588



>gb|KHG29785.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score = 63.5 bits (153),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLR+RMPISSDL+NPRNFITKI+
Sbjct  524  LLKEYNNVCTLRIRMPISSDLNNPRNFITKIS  555


 Score = 54.7 bits (130),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  557  YSKVVNIPNSMTILDELLPISIEMAKRNL  585



>ref|XP_006306947.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
 gb|EOA39845.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
Length=668

 Score = 63.2 bits (152),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  525  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  556


 Score = 54.7 bits (130),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  558  YDKVVNIPNSMTVLDELLPISIEMAKRNL  586



>gb|EMT23371.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=667

 Score = 64.3 bits (155),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLKEYENVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 53.9 bits (128),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PIS+EMAKRNL
Sbjct  554  YDKVVNIPNSMTVLDELLPISVEMAKRNL  582



>ref|XP_008776517.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=302

 Score = 64.3 bits (155),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  156  LLKNYENVCTLRVRMPISSDLSNPRNFITKIS  187


 Score = 53.5 bits (127),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVNIPNSMTILDELLPISIEMAKRNL  217



>ref|XP_007048831.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007048832.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92988.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92989.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
Length=732

 Score = 65.5 bits (158),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  529  LLREYDNVCTLRVRMPISSDLSNPRNFITKIA  560


 Score = 52.4 bits (124),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  562  YSKVVDIPNSMTILDELLPISIEMAKRNL  590



>gb|KJB61502.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=667

 Score = 63.9 bits (154),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  524  LLKEYNNVCTLRVRMPISSDLNNPRNFITKIS  555


 Score = 53.9 bits (128),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  557  YSKVVNIPNSMTILDELLPISIEMAKRNL  585



>ref|XP_002285634.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=675

 Score = 64.3 bits (155),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  529  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  560


 Score = 53.5 bits (127),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM +LDEL PISIEMAKRN
Sbjct  562  YNKVVNIPNSMTVLDELLPISIEMAKRN  589



>ref|XP_002965630.1| hypothetical protein SELMODRAFT_439393 [Selaginella moellendorffii]
 ref|XP_002989281.1| hypothetical protein SELMODRAFT_184467 [Selaginella moellendorffii]
 gb|EFJ09719.1| hypothetical protein SELMODRAFT_184467 [Selaginella moellendorffii]
 gb|EFJ33050.1| hypothetical protein SELMODRAFT_439393 [Selaginella moellendorffii]
Length=308

 Score = 63.9 bits (154),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  163  LLKNYENVCTLRVRMPISSDLANPRNFITKIT  194


 Score = 53.9 bits (128),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  196  YEKVVNIPNSMTVLDELLPISIEMAKRNL  224



>ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
 gb|EES19282.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
Length=666

 Score = 62.8 bits (151),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EY+NVCTLRVRMPISSDL+NPRNF+TKI+
Sbjct  520  LLREYENVCTLRVRMPISSDLNNPRNFVTKIS  551


 Score = 55.1 bits (131),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PIS+EMAKRNL
Sbjct  553  YNKVVNIPNSMTMLDELLPISVEMAKRNL  581



>ref|XP_006647684.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza 
brachyantha]
Length=307

 Score = 64.7 bits (156),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  161  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  192


 Score = 53.1 bits (126),  Expect(2) = 3e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  194  YDKVVDIPNSMTILDELLPISIEMAKRNL  222



>ref|XP_010272587.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=302

 Score = 64.3 bits (155),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  156  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  187


 Score = 53.5 bits (127),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVNIPNSMTILDELLPISIEMAKRNL  217



>ref|XP_010255576.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=302

 Score = 64.3 bits (155),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  156  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  187


 Score = 53.5 bits (127),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVNIPNSMTILDELLPISIEMAKRNL  217



>ref|XP_010535018.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Tarenaya hassleriana]
Length=667

 Score = 63.2 bits (152),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EY+NVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  524  LLREYENVCTLRVRMPISSDLNNPRNFITKIS  555


 Score = 54.7 bits (130),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  557  YDKVVNIPNSMTILDELLPISIEMAKRNL  585



>ref|XP_007040092.1| Nucleotide-rhamnose synthase/epimerase-reductase [Theobroma cacao]
 gb|EOY24593.1| Nucleotide-rhamnose synthase/epimerase-reductase [Theobroma cacao]
Length=300

 Score = 63.5 bits (153),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLANPRNFITKIT  185


 Score = 54.3 bits (129),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  187  YDKVVNIPNSMTILDELLPISIEMAKRNL  215



>gb|AAK82539.1| At1g53500/F22G10_13 [Arabidopsis thaliana]
 gb|AAN72275.1| At1g53500/F22G10_13 [Arabidopsis thaliana]
Length=498

 Score = 63.2 bits (152),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  355  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  386


 Score = 54.7 bits (130),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+IPNSM +LDEL PISIEMAKRNL
Sbjct  388  YNKVVDIPNSMTVLDELLPISIEMAKRNL  416



>ref|NP_564633.2| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9LPG6.1|RHM2_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2; AltName: Full=NDP-rhamnose synthase; AltName: 
Full=Protein MUCILAGE-MODIFIED 4; AltName: Full=Protein RHAMNOSE 
BIOSYNTHESIS 2; AltName: Full=Rhamnose biosynthetic enzyme 
2; Short=AtRHM2; AltName: Full=UDP-L-rhamnose synthase 
MUM4; Includes: RecName: Full=UDP-glucose 4,6-dehydratase; 
Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAF78439.1|AC018748_18 Contains similarity to dTPD-D-glucose-4,6-dehydratase from Sphingomonas 
sp.S88 gb|U51197 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain [Arabidopsis thaliana]
 gb|AAG51981.1|AC024260_19 dTDP-D-glucose 4,6-dehydratase, putative; 102946-105028 [Arabidopsis 
thaliana]
 emb|CAD92667.1| putative NDP-rhamnose synthase [Arabidopsis thaliana]
 gb|AAP93963.1| putative UDP-L-rhamnose synthase MUM4 [Arabidopsis thaliana]
 gb|AEE32949.1| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=667

 Score = 63.2 bits (152),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  524  LLREFDNVCTLRVRMPISSDLNNPRNFITKIS  555


 Score = 54.3 bits (129),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+IPNSM +LDEL PISIEMAKRNL
Sbjct  557  YNKVVDIPNSMTVLDELLPISIEMAKRNL  585



>emb|CDP18722.1| unnamed protein product [Coffea canephora]
Length=676

 Score = 65.5 bits (158),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  526  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIA  557


 Score = 52.0 bits (123),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM +LDEL PISIEMAKRN
Sbjct  559  YDKVVNIPNSMTVLDELLPISIEMAKRN  586



>ref|XP_010497682.1| PREDICTED: probable rhamnose biosynthetic enzyme 1, partial [Camelina 
sativa]
Length=127

 Score = 63.5 bits (153),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3   LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
           LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  8   LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  39


 Score = 53.9 bits (128),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  41   YNKVVNIPNSMTVLDELLPISIEMAKRNL  69



>ref|NP_001049724.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|ABF95277.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95278.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95279.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11638.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|EEC74971.1| hypothetical protein OsI_10998 [Oryza sativa Indica Group]
 gb|EEE58799.1| hypothetical protein OsJ_10344 [Oryza sativa Japonica Group]
 gb|AJB98437.1| NAD-dependent epimerase/dehydratase family domain containing 
protein, partial [Oryza sativa]
Length=675

 Score = 65.9 bits (159),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  529  LLQEYDNVCTLRVRMPISSDLSNPRNFITKIA  560


 Score = 51.6 bits (122),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM ILDEL PISIEMAKR+
Sbjct  562  YDKVVNIPNSMTILDELLPISIEMAKRD  589



>ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza 
brachyantha]
Length=673

 Score = 65.9 bits (159),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  527  LLREYDNVCTLRVRMPISSDLSNPRNFITKIA  558


 Score = 51.6 bits (122),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM ILDEL PISIEMAKR+
Sbjct  560  YDKVVNIPNSMTILDELLPISIEMAKRD  587



>gb|KFK23178.1| hypothetical protein AALP_AAs48438U000100, partial [Arabis alpina]
Length=99

 Score = 63.5 bits (153),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3   LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
           LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  5   LLKEFDNVCTLRVRMPISSDLTNPRNFITKIS  36


 Score = 53.9 bits (128),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  38   YNKVVNIPNSMTVLDELLPISIEMAKRNL  66



>dbj|BAJ97692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score = 64.3 bits (155),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLKEYENVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 53.1 bits (126),  Expect(2) = 4e-18, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PIS+EMAKRNL
Sbjct  554  YDKVVNIPNSMTMLDELLPISVEMAKRNL  582



>emb|CAN79484.1| hypothetical protein VITISV_006441 [Vitis vinifera]
Length=360

 Score = 64.3 bits (155),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  214  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  245


 Score = 53.1 bits (126),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM +LDEL PISIEMAKRN
Sbjct  247  YNKVVNIPNSMTVLDELLPISIEMAKRN  274



>ref|XP_007161328.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
 gb|ESW33322.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
Length=655

 Score = 60.8 bits (146),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+ Y+NVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  512  LLRNYENVCTLRVRMPISSDLTNPRNFITKIS  543


 Score = 56.6 bits (135),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  545  YNKVVNIPNSMTVLDELLPISIEMAKRNL  573



>gb|KHN09737.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=512

 Score = 66.2 bits (160),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  365  LLKNYDNVCTLRVRMPISSDLSNPRNFITKIT  396


 Score = 50.8 bits (120),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEM KRNL
Sbjct  398  YEKVVDIPNSMTILDELLPISIEMGKRNL  426



>gb|EMT13548.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=300

 Score = 64.3 bits (155),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  185


 Score = 52.8 bits (125),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  187  YDKVVDIPNSMTILDELLPISIEMAKRNL  215



>ref|XP_004515790.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cicer 
arietinum]
Length=303

 Score = 65.1 bits (157),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+ YDNVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  158  LLRNYDNVCTLRVRMPISSDLSNPRNFITKIT  189


 Score = 52.4 bits (124),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  191  YEKVVDIPNSMTILDELLPISIEMAKRNL  219



>gb|KFK24330.1| hypothetical protein AALP_AAs39635U000100, partial [Arabis alpina]
Length=95

 Score = 63.5 bits (153),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3   LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
           LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  4   LLKEFDNVCTLRVRMPISSDLTNPRNFITKIS  35


 Score = 53.9 bits (128),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  37   YNKVVNIPNSMTVLDELLPISIEMAKRNL  65



>gb|EMS50143.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=300

 Score = 64.3 bits (155),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  185


 Score = 52.8 bits (125),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  187  YDKVVDIPNSMTILDELLPISIEMAKRNL  215



>ref|XP_009395981.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score = 65.9 bits (159),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE+DNVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  526  LLKEFDNVCTLRVRMPISSDLSNPRNFITKIS  557


 Score = 51.6 bits (122),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKR  183
            YNKVVNIPNSM +LDEL PISIEMAKR
Sbjct  559  YNKVVNIPNSMTVLDELLPISIEMAKR  585



>emb|CBI20105.3| unnamed protein product [Vitis vinifera]
Length=192

 Score = 64.3 bits (155),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3   LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
           LLKE+DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  46  LLKEFDNVCTLRVRMPISSDLNNPRNFITKIS  77


 Score = 53.1 bits (126),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM +LDEL PISIEMAKRN
Sbjct  79   YNKVVNIPNSMTVLDELLPISIEMAKRN  106



>ref|XP_010553490.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Tarenaya hassleriana]
Length=300

 Score = 64.7 bits (156),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  153  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  184


 Score = 52.4 bits (124),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  186  YSKVVDIPNSMTILDELLPISIEMAKRNL  214



>gb|AFK41450.1| unknown [Medicago truncatula]
 gb|KEH31692.1| 3,5-epimerase/4-reductase [Medicago truncatula]
Length=298

 Score = 65.1 bits (157),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+ YDNVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  153  LLRNYDNVCTLRVRMPISSDLSNPRNFITKIT  184


 Score = 52.4 bits (124),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  186  YEKVVDIPNSMTILDELLPISIEMAKRNL  214



>ref|XP_003570100.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
Length=300

 Score = 64.7 bits (156),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  185


 Score = 52.8 bits (125),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  187  YDKVVDIPNSMTILDELLPISIEMAKRNL  215



>ref|XP_008654228.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654237.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654239.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654245.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 tpg|DAA44692.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44693.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44694.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
Length=672

 Score = 65.5 bits (158),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  526  LLKEYDNVCTLRVRMPISSDLNNPRNFITKIA  557


 Score = 51.6 bits (122),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM ILDEL PISIEMAKR+
Sbjct  559  YDKVVNIPNSMTILDELLPISIEMAKRD  586



>dbj|BAJ95321.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=327

 Score = 64.3 bits (155),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  181  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  212


 Score = 52.8 bits (125),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  214  YDKVVDIPNSMTILDELLPISIEMAKRNL  242



>gb|EPS68271.1| hypothetical protein M569_06499, partial [Genlisea aurea]
Length=297

 Score = 65.1 bits (157),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  155  LLKNYDNVCTLRVRMPISSDLTNPRNFITKIT  186


 Score = 52.0 bits (123),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM +LDEL PISIEM KRNL
Sbjct  188  YEKVVNIPNSMTVLDELLPISIEMGKRNL  216



>ref|XP_006477360.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
 gb|KDO63611.1| hypothetical protein CISIN_1g022112mg [Citrus sinensis]
Length=302

 Score = 63.2 bits (152),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK ++NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  156  LLKNFENVCTLRVRMPISSDLSNPRNFITKIT  187


 Score = 53.9 bits (128),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVNIPNSMTILDELLPISIEMAKRNL  217



>ref|XP_006857961.1| hypothetical protein AMTR_s00069p00173700 [Amborella trichopoda]
 gb|ERN19428.1| hypothetical protein AMTR_s00069p00173700 [Amborella trichopoda]
Length=300

 Score = 64.7 bits (156),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  185


 Score = 52.4 bits (124),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAK+NL
Sbjct  187  YEKVVNIPNSMTILDELLPISIEMAKKNL  215



>ref|XP_009389578.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389587.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=306

 Score = 62.8 bits (151),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL  Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  160  LLTNYENVCTLRVRMPISSDLTNPRNFITKIT  191


 Score = 54.3 bits (129),  Expect(2) = 6e-18, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  193  YEKVVNIPNSMTILDELLPISIEMAKRNL  221



>ref|XP_007155573.1| hypothetical protein PHAVU_003G213400g [Phaseolus vulgaris]
 gb|ESW27567.1| hypothetical protein PHAVU_003G213400g [Phaseolus vulgaris]
Length=300

 Score = 64.7 bits (156),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPISSDLSNPRNFI KIT
Sbjct  155  LLKNYDNVCTLRVRMPISSDLSNPRNFIAKIT  186


 Score = 52.4 bits (124),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM+ILDEL PISIEMAKRNL
Sbjct  188  YEKVVDIPNSMSILDELLPISIEMAKRNL  216



>ref|XP_004984749.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=672

 Score = 67.0 bits (162),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  526  LLKEYDNVCTLRVRMPISSDLSNPRNFITKIA  557


 Score = 50.1 bits (118),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM ILDEL P SIEMAKR+
Sbjct  559  YDKVVNIPNSMTILDELLPFSIEMAKRD  586



>ref|XP_001775697.1| predicted protein [Physcomitrella patens]
 gb|EDQ59500.1| predicted protein [Physcomitrella patens]
Length=669

 Score = 62.4 bits (150),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKI  95
            LL E+DNVCTLRVRMPISSDL NPRNFI+KI
Sbjct  523  LLSEFDNVCTLRVRMPISSDLENPRNFISKI  553


 Score = 54.3 bits (129),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y K+VNIPNSM ILDEL PISIEMAKRNL
Sbjct  556  YQKIVNIPNSMTILDELLPISIEMAKRNL  584



>ref|XP_009803668.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=653

 Score = 64.7 bits (156),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEY+NVCTLRVRMPISSDL NPRNFITKIT
Sbjct  510  LLKEYENVCTLRVRMPISSDLCNPRNFITKIT  541


 Score = 52.0 bits (123),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM +LDEL PISIEMAKRN
Sbjct  543  YDKVVNIPNSMTVLDELLPISIEMAKRN  570



>ref|XP_011072055.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Sesamum indicum]
Length=300

 Score = 63.2 bits (152),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  154  LLKNYENVCTLRVRMPISSDLSNPRNFITKIA  185


 Score = 53.5 bits (127),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  187  YEKVVNIPNSMTILDELLPISIEMAKRNL  215



>ref|XP_008437195.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Cucumis melo]
Length=300

 Score = 64.7 bits (156),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  185


 Score = 52.0 bits (123),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  187  YEKVVDIPNSMTILDELLPISIEMAKRNL  215



>gb|KHG15836.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=681

 Score = 65.9 bits (159),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  531  LLREFDNVCTLRVRMPISSDLSNPRNFITKIT  562


 Score = 50.8 bits (120),  Expect(2) = 7e-18, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+I NSM ILDEL P+SIEMAKRNL
Sbjct  564  YNKVVDISNSMTILDELLPVSIEMAKRNL  592



>ref|XP_006440508.1| hypothetical protein CICLE_v10021340mg [Citrus clementina]
 gb|ESR53748.1| hypothetical protein CICLE_v10021340mg [Citrus clementina]
Length=302

 Score = 63.2 bits (152),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK ++NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  156  LLKNFENVCTLRVRMPISSDLSNPRNFITKIT  187


 Score = 53.5 bits (127),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVNIPNSMTILDELLPISIEMAKRNL  217



>gb|KJB75445.1| hypothetical protein B456_012G042300 [Gossypium raimondii]
Length=681

 Score = 65.9 bits (159),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  531  LLREFDNVCTLRVRMPISSDLSNPRNFITKIT  562


 Score = 50.8 bits (120),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+I NSM ILDEL P+SIEMAKRNL
Sbjct  564  YNKVVDISNSMTILDELLPVSIEMAKRNL  592



>ref|XP_004143938.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 ref|XP_004159969.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN50154.1| hypothetical protein Csa_5G156140 [Cucumis sativus]
Length=300

 Score = 64.3 bits (155),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  185


 Score = 52.0 bits (123),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  187  YEKVVDIPNSMTILDELLPISIEMAKRNL  215



>gb|KJB20764.1| hypothetical protein B456_003G163300 [Gossypium raimondii]
Length=300

 Score = 63.5 bits (153),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLANPRNFITKIT  185


 Score = 53.1 bits (126),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEM KRNL
Sbjct  187  YDKVVNIPNSMTILDELLPISIEMGKRNL  215



>ref|XP_007011619.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY29238.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=659

 Score = 67.0 bits (162),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 31/32 (97%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  516  LLQEYDNVCTLRVRMPISSDLSNPRNFITKIT  547


 Score = 49.3 bits (116),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM +LDEL  ISIEMAKRN
Sbjct  549  YNKVVNIPNSMTVLDELLLISIEMAKRN  576



>ref|XP_010933908.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase-like [Elaeis guineensis]
Length=302

 Score = 64.7 bits (156),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  156  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  187


 Score = 52.0 bits (123),  Expect(2) = 9e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNS+ ILDEL PISIEMAKRNL
Sbjct  189  YEKVVNIPNSITILDELLPISIEMAKRNL  217



>dbj|BAJ86835.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=675

 Score = 65.5 bits (158),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK+YDNVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  529  LLKDYDNVCTLRVRMPISSDLSNPRNFITKIA  560


 Score = 50.8 bits (120),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM ILDEL PIS+EMAKR+
Sbjct  562  YDKVVNIPNSMTILDELLPISVEMAKRD  589



>ref|XP_009394163.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=675

 Score = 64.3 bits (155),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EY+NVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  529  LLREYENVCTLRVRMPISSDLSNPRNFITKIA  560


 Score = 52.4 bits (124),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM +LDEL PISIEMAKRN
Sbjct  562  YDKVVNIPNSMTVLDELLPISIEMAKRN  589



>gb|ADB24764.1| UDP-L-rhamnose synthase [Gossypium hirsutum]
Length=300

 Score = 63.5 bits (153),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLANPRNFITKIT  185


 Score = 52.8 bits (125),  Expect(2) = 9e-18, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEM KRNL
Sbjct  187  YDKVVNIPNSMTILDELLPISIEMGKRNL  215



>gb|EMS45937.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=675

 Score = 65.5 bits (158),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK+YDNVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  529  LLKDYDNVCTLRVRMPISSDLSNPRNFITKIA  560


 Score = 50.8 bits (120),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM ILDEL PIS+EMAKR+
Sbjct  562  YDKVVNIPNSMTILDELLPISVEMAKRD  589



>emb|CDP05404.1| unnamed protein product [Coffea canephora]
Length=155

 Score = 65.1 bits (157),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3   LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
           LLKEYDNVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  5   LLKEYDNVCTLRVRMPISSDLNNPRNFITKIA  36


 Score = 51.2 bits (121),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM +LDEL PISIEMAKRN
Sbjct  38   YDKVVNIPNSMTVLDELLPISIEMAKRN  65



>gb|ACJ11713.1| UDP-L-rhamnose synthase [Gossypium hirsutum]
Length=300

 Score = 63.5 bits (153),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLANPRNFITKIT  185


 Score = 52.8 bits (125),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEM KRNL
Sbjct  187  YDKVVNIPNSMTILDELLPISIEMGKRNL  215



>ref|XP_001781616.1| predicted protein [Physcomitrella patens]
 ref|XP_001781618.1| predicted protein [Physcomitrella patens]
 gb|EDQ53572.1| predicted protein [Physcomitrella patens]
 gb|EDQ53574.1| predicted protein [Physcomitrella patens]
Length=300

 Score = 63.9 bits (154),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPI+ DLSNPRNFITKIT
Sbjct  154  LLREFDNVCTLRVRMPITGDLSNPRNFITKIT  185


 Score = 52.4 bits (124),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  187  YEKVVDIPNSMTILDELLPISIEMAKRNL  215



>gb|KHG05296.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=300

 Score = 63.5 bits (153),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLANPRNFITKIT  185


 Score = 52.8 bits (125),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEM KRNL
Sbjct  187  YDKVVNIPNSMTILDELLPISIEMGKRNL  215



>ref|XP_004298763.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Fragaria vesca subsp. vesca]
Length=300

 Score = 62.4 bits (150),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 28/31 (90%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKI  95
            LLK Y+NVCTLRVRMPISSDL NPRNFITKI
Sbjct  155  LLKNYENVCTLRVRMPISSDLQNPRNFITKI  185


 Score = 53.9 bits (128),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PIS+EMAKRNL
Sbjct  188  YDKVVNIPNSMTILDELLPISVEMAKRNL  216



>gb|ADB24774.1| rhamnose synthase [Gossypium hirsutum]
Length=681

 Score = 65.9 bits (159),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+E+DNVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  531  LLREFDNVCTLRVRMPISSDLSNPRNFITKIT  562


 Score = 50.4 bits (119),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            YNKVV+I NSM ILDEL P+SIEMAKRNL
Sbjct  564  YNKVVDISNSMTILDELLPVSIEMAKRNL  592



>ref|XP_004245662.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=301

 Score = 63.9 bits (154),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPIS+DL+NPRNFITKIT
Sbjct  155  LLKNYDNVCTLRVRMPISADLTNPRNFITKIT  186


 Score = 52.0 bits (123),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y +VVNIPNSM ILDEL PISIEMAKRNL
Sbjct  188  YARVVNIPNSMTILDELLPISIEMAKRNL  216



>gb|ABK22031.1| unknown [Picea sitchensis]
Length=300

 Score = 62.0 bits (149),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK ++NVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  154  LLKNFENVCTLRVRMPISSDLSNPRNFITKIS  185


 Score = 54.3 bits (129),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  187  YDKVVNIPNSMTILDELLPISIEMAKRNL  215



>emb|CDY57072.1| BnaCnng31530D [Brassica napus]
Length=323

 Score = 64.7 bits (156),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  176  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  207


 Score = 51.6 bits (122),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  209  YEKVVDIPNSMTILDELLPISLEMAKRNL  237



>ref|XP_010675264.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Beta vulgaris subsp. vulgaris]
Length=674

 Score = 62.8 bits (151),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK++DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  527  LLKDFDNVCTLRVRMPISSDLNNPRNFITKIS  558


 Score = 53.1 bits (126),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  560  YSKVVNIPNSMTVLDELLPISIEMAKRNL  588



>ref|XP_006845495.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
 gb|ERN07170.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
Length=681

 Score = 62.4 bits (150),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL EY+NVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  538  LLSEYENVCTLRVRMPISSDLTNPRNFITKIA  569


 Score = 53.5 bits (127),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM ILDEL PISIEMAK+N
Sbjct  571  YNKVVNIPNSMTILDELLPISIEMAKKN  598



>ref|XP_007158451.1| hypothetical protein PHAVU_002G153500g [Phaseolus vulgaris]
 gb|ESW30445.1| hypothetical protein PHAVU_002G153500g [Phaseolus vulgaris]
Length=303

 Score = 63.5 bits (153),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+ YDNVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  153  LLENYDNVCTLRVRMPISSDLTNPRNFITKIT  184


 Score = 52.4 bits (124),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM+ILDEL PIS+EMAKRNL
Sbjct  186  YDKVVDIPNSMSILDELLPISLEMAKRNL  214



>gb|EMS59810.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=667

 Score = 62.0 bits (149),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL EY+NVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  521  LLNEYENVCTLRVRMPISSDLNNPRNFITKIS  552


 Score = 53.9 bits (128),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PIS+EMAKRNL
Sbjct  554  YDKVVNIPNSMTVLDELLPISVEMAKRNL  582



>gb|KJB27003.1| hypothetical protein B456_004G271200 [Gossypium raimondii]
Length=571

 Score = 60.8 bits (146),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EYDNVCTLRVRMPISSDL++P NFITKI+
Sbjct  428  LLREYDNVCTLRVRMPISSDLNSPHNFITKIS  459


 Score = 55.1 bits (131),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +1

Query  100  CYNKVVNIPNSMNILDELQPISIEMAKRNL  189
            CYNKV+NIPN M ILDEL P+SIEMAK+NL
Sbjct  460  CYNKVINIPNGMTILDELLPMSIEMAKKNL  489



>ref|XP_010676576.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Beta vulgaris subsp. vulgaris]
Length=303

 Score = 62.4 bits (150),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL  YDNVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  155  LLNNYDNVCTLRVRMPISSDLSNPRNFITKIA  186


 Score = 53.5 bits (127),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  188  YEKVVNIPNSMTILDELLPISIEMAKRNL  216



>ref|XP_010675265.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675266.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675267.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=674

 Score = 62.8 bits (151),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK++DNVCTLRVRMPISSDL+NPRNFITKI+
Sbjct  527  LLKDFDNVCTLRVRMPISSDLNNPRNFITKIS  558


 Score = 53.1 bits (126),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM +LDEL PISIEMAKRNL
Sbjct  560  YSKVVNIPNSMTVLDELLPISIEMAKRNL  588



>ref|XP_004984748.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=673

 Score = 64.3 bits (155),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK+YDNVCTLRVRMPISSDL NPRNFITKI 
Sbjct  527  LLKDYDNVCTLRVRMPISSDLGNPRNFITKIA  558


 Score = 51.6 bits (122),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM ILDEL PISIEMAKR+
Sbjct  560  YDKVVNIPNSMTILDELLPISIEMAKRD  587



>emb|CDP09826.1| unnamed protein product [Coffea canephora]
Length=300

 Score = 63.5 bits (153),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  155  LLKNYENVCTLRVRMPISSDLANPRNFITKIT  186


 Score = 52.4 bits (124),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKR+L
Sbjct  188  YEKVVNIPNSMTILDELLPISIEMAKRDL  216



>ref|XP_011029152.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Populus euphratica]
Length=302

 Score = 62.4 bits (150),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+ Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  156  LLRNYENVCTLRVRMPISSDLANPRNFITKIT  187


 Score = 53.5 bits (127),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVNIPNSMTILDELLPISIEMAKRNL  217



>gb|KDP25530.1| hypothetical protein JCGZ_20686 [Jatropha curcas]
Length=303

 Score = 63.5 bits (153),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  157  LLKNYQNVCTLRVRMPISSDLSNPRNFITKIT  188


 Score = 52.0 bits (123),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  190  YEKVVDIPNSMTILDELLPISIEMAKRNL  218



>ref|XP_009148579.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=321

 Score = 64.7 bits (156),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  174  LLKNYENVCTLRVRMPISSDLSNPRNFITKIT  205


 Score = 50.8 bits (120),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  207  YEKVVDIPNSMTILDELLPISLEMAKRNL  235



>ref|XP_006391796.1| hypothetical protein EUTSA_v10023613mg [Eutrema salsugineum]
 gb|ESQ29082.1| hypothetical protein EUTSA_v10023613mg [Eutrema salsugineum]
Length=297

 Score = 63.2 bits (152),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  150  LLKNYENVCTLRVRMPISSDLSNPRNFITKIA  181


 Score = 52.4 bits (124),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  183  YEKVVDIPNSMTILDELLPISIEMAKRNL  211



>emb|CDY45969.1| BnaA09g12970D [Brassica napus]
Length=297

 Score = 63.2 bits (152),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  150  LLKNYENVCTLRVRMPISSDLSNPRNFITKIA  181


 Score = 52.4 bits (124),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  183  YEKVVDIPNSMTILDELLPISIEMAKRNL  211



>emb|CDY45471.1| BnaC09g12890D [Brassica napus]
Length=297

 Score = 63.2 bits (152),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  150  LLKNYENVCTLRVRMPISSDLSNPRNFITKIA  181


 Score = 52.4 bits (124),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  183  YEKVVDIPNSMTILDELLPISIEMAKRNL  211



>ref|XP_002509687.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF51074.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=302

 Score = 63.5 bits (153),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  156  LLKNYENVCTLRVRMPISSDLANPRNFITKIT  187


 Score = 52.0 bits (123),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVDIPNSMTILDELLPISIEMAKRNL  217



>gb|AAC32137.1| hypothetical protein [Picea mariana]
Length=271

 Score = 61.6 bits (148),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK ++NVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  125  LLKNFENVCTLRVRMPISSDLSNPRNFITKIS  156


 Score = 53.9 bits (128),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  158  YDKVVNIPNSMTILDELLPISIEMAKRNL  186



>ref|XP_009620292.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=298

 Score = 63.9 bits (154),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPIS+DL+NPRNFITKIT
Sbjct  152  LLKNYDNVCTLRVRMPISADLTNPRNFITKIT  183


 Score = 51.2 bits (121),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  185  YEKVVDIPNSMTILDELLPISLEMAKRNL  213



>ref|XP_001766894.1| predicted protein [Physcomitrella patens]
 gb|EDQ68296.1| predicted protein [Physcomitrella patens]
Length=677

 Score = 62.0 bits (149),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKI  95
            LL E+DNVCTLRVRMPISSDL NPRNFI+KI
Sbjct  530  LLNEFDNVCTLRVRMPISSDLQNPRNFISKI  560


 Score = 53.1 bits (126),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y K+VNIPNSM ILDEL PISIEMAKRNL
Sbjct  563  YQKIVNIPNSMTILDELLPISIEMAKRNL  591



>ref|XP_004169238.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like, partial 
[Cucumis sativus]
Length=338

 Score = 61.2 bits (147),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL++Y NVCTLRVRMPISSDLSNPRNFITKI+
Sbjct  195  LLRDYPNVCTLRVRMPISSDLSNPRNFITKIS  226


 Score = 53.5 bits (127),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM +LDEL PISIEMAKRN
Sbjct  228  YNKVVNIPNSMTVLDELLPISIEMAKRN  255



>ref|XP_006358852.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=301

 Score = 62.8 bits (151),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPIS+DL+NPRNFITKI+
Sbjct  155  LLKNYDNVCTLRVRMPISADLTNPRNFITKIS  186


 Score = 52.0 bits (123),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  188  YEKVVDIPNSMTILDELLPISIEMAKRNL  216



>ref|XP_010108054.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXC17786.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=300

 Score = 61.6 bits (148),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL NPRNFITKIT
Sbjct  154  LLKNYENVCTLRVRMPISSDLLNPRNFITKIT  185


 Score = 53.1 bits (126),  Expect(2) = 2e-17, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  187  YEKVVNIPNSMTILDELLPISIEMAKRNL  215



>gb|EYU36941.1| hypothetical protein MIMGU_mgv1a010842mg [Erythranthe guttata]
Length=300

 Score = 62.8 bits (151),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL  Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  154  LLHNYENVCTLRVRMPISSDLSNPRNFITKIT  185


 Score = 52.0 bits (123),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  187  YEKVVDIPNSMTILDELLPISIEMAKRNL  215



>ref|XP_009400458.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=306

 Score = 60.8 bits (146),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPIS+DL NPRNFITKIT
Sbjct  160  LLKNYENVCTLRVRMPISTDLLNPRNFITKIT  191


 Score = 53.9 bits (128),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  193  YEKVVNIPNSMTILDELLPISIEMAKRNL  221



>ref|XP_010473526.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=304

 Score = 62.0 bits (149),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  157  LLKNYENVCTLRVRMPISSDLTNPRNFITKIA  188


 Score = 52.8 bits (125),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  190  YEKVVDIPNSMTILDELLPISIEMAKRNL  218



>gb|KFK40550.1| hypothetical protein AALP_AA2G010500 [Arabis alpina]
Length=295

 Score = 62.0 bits (149),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  150  LLKNYENVCTLRVRMPISSDLTNPRNFITKIA  181


 Score = 52.8 bits (125),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  183  YEKVVDIPNSMTILDELLPISIEMAKRNL  211



>ref|XP_010430376.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=303

 Score = 62.0 bits (149),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  156  LLKNYENVCTLRVRMPISSDLTNPRNFITKIA  187


 Score = 52.4 bits (124),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVDIPNSMTILDELLPISIEMAKRNL  217



>ref|XP_002299567.1| hypothetical protein POPTR_0001s08570g [Populus trichocarpa]
 gb|ABK94159.1| unknown [Populus trichocarpa]
 gb|EEE84372.1| hypothetical protein POPTR_0001s08570g [Populus trichocarpa]
Length=302

 Score = 62.4 bits (150),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+ Y+NVCTLRVRMPISSDL+NPRNFITKIT
Sbjct  156  LLRNYENVCTLRVRMPISSDLANPRNFITKIT  187


 Score = 52.4 bits (124),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVDIPNSMTILDELLPISIEMAKRNL  217



>ref|XP_008393937.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=660

 Score = 64.7 bits (156),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYD VCTLRVRMPISSDLSNPRNFITKI 
Sbjct  517  LLKEYDKVCTLRVRMPISSDLSNPRNFITKIA  548


 Score = 49.7 bits (117),  Expect(2) = 3e-17, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  106  NKVVNIPNSMNILDELQPISIEMAKRN  186
            +KVVNIPNSM +LDEL PISIEMA+RN
Sbjct  551  DKVVNIPNSMTVLDELLPISIEMARRN  577



>ref|XP_006302532.1| hypothetical protein CARUB_v10020632mg, partial [Capsella rubella]
 gb|EOA35430.1| hypothetical protein CARUB_v10020632mg, partial [Capsella rubella]
Length=330

 Score = 62.0 bits (149),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  183  LLKNYENVCTLRVRMPISSDLTNPRNFITKIA  214


 Score = 52.8 bits (125),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  216  YEKVVDIPNSMTILDELLPISIEMAKRNL  244



>ref|XP_002887985.1| hypothetical protein ARALYDRAFT_893174 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64244.1| hypothetical protein ARALYDRAFT_893174 [Arabidopsis lyrata subsp. 
lyrata]
Length=300

 Score = 62.0 bits (149),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  153  LLKNYENVCTLRVRMPISSDLTNPRNFITKIA  184


 Score = 52.4 bits (124),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  186  YEKVVDIPNSMTILDELLPISIEMAKRNL  214



>ref|XP_003549868.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
Length=302

 Score = 63.2 bits (152),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK YDNVCTLRVRMPISSDL NPRNFITKIT
Sbjct  155  LLKNYDNVCTLRVRMPISSDLLNPRNFITKIT  186


 Score = 51.2 bits (121),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEM KRNL
Sbjct  188  YEKVVDIPNSMTILDELLPISIEMGKRNL  216



>ref|XP_001775602.1| predicted protein [Physcomitrella patens]
 gb|EDQ59549.1| predicted protein [Physcomitrella patens]
Length=679

 Score = 62.4 bits (150),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKI  95
            LL E+DNVCTLRVRMPISSDL NPRNFI+KI
Sbjct  532  LLNEFDNVCTLRVRMPISSDLQNPRNFISKI  562


 Score = 52.0 bits (123),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y K+VNIPNSM ILDEL PIS+EMAKRNL
Sbjct  565  YQKIVNIPNSMTILDELLPISLEMAKRNL  593



>gb|AAK62450.1|AF387005_1 Unknown protein [Arabidopsis thaliana]
Length=301

 Score = 62.0 bits (149),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  154  LLKNYENVCTLRVRMPISSDLTNPRNFITKIA  185


 Score = 52.4 bits (124),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  187  YEKVVDIPNSMTILDELLPISIEMAKRNL  215



>emb|CDP22060.1| unnamed protein product [Coffea canephora]
Length=361

 Score = 62.0 bits (149),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLRVRMPISSDL++PRNFI KI 
Sbjct  211  LLKEYDNVCTLRVRMPISSDLNSPRNFIAKIA  242


 Score = 52.0 bits (123),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            Y+KVVNIPNSM +LDEL PISIEMAKRN
Sbjct  244  YDKVVNIPNSMTVLDELLPISIEMAKRN  271



>ref|XP_010418304.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=304

 Score = 62.0 bits (149),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  157  LLKNYENVCTLRVRMPISSDLTNPRNFITKIA  188


 Score = 52.4 bits (124),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  190  YEKVVDIPNSMTILDELLPISIEMAKRNL  218



>ref|XP_009113029.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=297

 Score = 63.2 bits (152),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDLSNPRNFITKI 
Sbjct  150  LLKNYENVCTLRVRMPISSDLSNPRNFITKIA  181


 Score = 50.8 bits (120),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISI+MAKRNL
Sbjct  183  YEKVVDIPNSMTILDELLPISIDMAKRNL  211



>ref|XP_008776518.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=302

 Score = 60.8 bits (146),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTL VRMPISSDLSNPRNFITKIT
Sbjct  156  LLKNYENVCTLCVRMPISSDLSNPRNFITKIT  187


 Score = 53.1 bits (126),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMA+RNL
Sbjct  189  YEKVVNIPNSMTILDELLPISIEMARRNL  217



>ref|NP_564806.1| UDP-4-keto-6-deoxy-d-glucose-3,5-epimerase-4-reductase 1 [Arabidopsis 
thaliana]
 sp|Q9LQ04.1|RMLCD_ARATH RecName: Full=Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase; AltName: Full=dTDP-L-rhamnose 
synthase [Arabidopsis thaliana]
 gb|AAF75813.1|AC011000_16 Contains weak similarity to 5-epimerase from Saccharopolyspora 
erythraea gb|L37354. ESTs gb|T41773, gb|R29767, gb|T88368, 
gb|F13963 come from this gene [Arabidopsis thaliana]
 gb|AAG48808.1|AF332445_1 unknown protein [Arabidopsis thaliana]
 gb|AAR99502.1| 3,5-epimerase/4-reductase [Arabidopsis thaliana]
 gb|AEE34035.1| UDP-4-keto-6-deoxy-d-glucose-3,5-epimerase-4-reductase 1 [Arabidopsis 
thaliana]
Length=301

 Score = 62.0 bits (149),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPISSDL+NPRNFITKI 
Sbjct  154  LLKNYENVCTLRVRMPISSDLTNPRNFITKIA  185


 Score = 52.0 bits (123),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  187  YEKVVDIPNSMTILDELLPISIEMAKRNL  215



>gb|ACU23112.1| unknown [Glycine max]
Length=297

 Score = 61.6 bits (148),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            L+  Y+NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  153  LVGNYENVCTLRVRMPISSDLSNPRNFITKIT  184


 Score = 52.0 bits (123),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  186  YDKVVDIPNSMTILDELLPISLEMAKRNL  214



>ref|XP_002303557.1| hypothetical protein POPTR_0003s12000g [Populus trichocarpa]
 gb|ABK94255.1| unknown [Populus trichocarpa]
 gb|EEE78536.1| hypothetical protein POPTR_0003s12000g [Populus trichocarpa]
Length=302

 Score = 60.1 bits (144),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+ Y+NVCTLRVRMPIS DL+NPRNFITKIT
Sbjct  156  LLRNYENVCTLRVRMPISCDLANPRNFITKIT  187


 Score = 53.5 bits (127),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVVNIPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVNIPNSMTILDELLPISIEMAKRNL  217



>ref|XP_007209407.1| hypothetical protein PRUPE_ppa009264mg [Prunus persica]
 gb|EMJ10606.1| hypothetical protein PRUPE_ppa009264mg [Prunus persica]
Length=299

 Score = 61.2 bits (147),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL  ++NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  153  LLNNFENVCTLRVRMPISSDLSNPRNFITKIT  184


 Score = 52.4 bits (124),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  186  YEKVVDIPNSMTILDELLPISIEMAKRNL  214



>ref|XP_009766426.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=298

 Score = 62.4 bits (150),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPIS+DL+NPRNFITKIT
Sbjct  152  LLKNYENVCTLRVRMPISADLTNPRNFITKIT  183


 Score = 51.2 bits (121),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  185  YEKVVDIPNSMTILDELLPISLEMAKRNL  213



>ref|XP_008365831.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=353

 Score = 61.2 bits (147),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL  ++NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  207  LLNNFENVCTLRVRMPISSDLSNPRNFITKIT  238


 Score = 52.4 bits (124),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  240  YEKVVDIPNSMTILDELLPISIEMAKRNL  268



>gb|KFK43526.1| hypothetical protein AALP_AA1G137100 [Arabis alpina]
Length=296

 Score = 62.0 bits (149),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPIS+DLSNPRNFITKI 
Sbjct  153  LLKNYENVCTLRVRMPISADLSNPRNFITKIA  184


 Score = 51.2 bits (121),  Expect(2) = 7e-17, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PIS+EMAKRNL
Sbjct  186  YEKVVDIPNSMTILDELLPISLEMAKRNL  214



>ref|XP_011033826.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Populus euphratica]
Length=302

 Score = 61.2 bits (147),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCTLRVRMPIS DL NPRNFITKIT
Sbjct  156  LLKNYENVCTLRVRMPISCDLGNPRNFITKIT  187


 Score = 52.4 bits (124),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  189  YEKVVDIPNSMTILDELLPISIEMAKRNL  217



>ref|XP_008445073.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Cucumis melo]
Length=667

 Score = 60.1 bits (144),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL+EY NVCTLRVRMPISSDLSN RNFITKI+
Sbjct  524  LLREYPNVCTLRVRMPISSDLSNQRNFITKIS  555


 Score = 53.1 bits (126),  Expect(2) = 8e-17, Method: Composition-based stats.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM +LDEL PISIEMAKR+
Sbjct  557  YNKVVNIPNSMTVLDELLPISIEMAKRD  584



>ref|XP_008381928.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=299

 Score = 61.2 bits (147),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL  ++NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  153  LLNNFENVCTLRVRMPISSDLSNPRNFITKIT  184


 Score = 52.0 bits (123),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  186  YEKVVDIPNSMTILDELLPISIEMAKRNL  214



>ref|XP_008348787.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
 ref|XP_009377895.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
 ref|XP_009377904.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=299

 Score = 60.8 bits (146),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL  ++NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  153  LLNNFENVCTLRVRMPISSDLSNPRNFITKIT  184


 Score = 52.0 bits (123),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  186  YEKVVDIPNSMTILDELLPISIEMAKRNL  214



>gb|AAM65668.1| unknown [Arabidopsis thaliana]
Length=300

 Score = 60.1 bits (144),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLK Y+NVCT RVRMPISSDL+NPRNFITKI 
Sbjct  153  LLKNYENVCTXRVRMPISSDLTNPRNFITKIA  184


 Score = 52.4 bits (124),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  186  YEKVVDIPNSMTILDELLPISIEMAKRNL  214



>ref|XP_009346674.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
 ref|XP_009346676.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=282

 Score = 59.3 bits (142),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL +++NVCTLRVRMPISSDL NPRNFITKIT
Sbjct  136  LLNDFENVCTLRVRMPISSDLCNPRNFITKIT  167


 Score = 52.8 bits (125),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  169  YDKVVDIPNSMTILDELLPISIEMAKRNL  197



>ref|XP_009362849.1| PREDICTED: probable rhamnose biosynthetic enzyme 1, partial [Pyrus 
x bretschneideri]
Length=257

 Score = 59.3 bits (142),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL +++NVCTLRVRMPISSDL NPRNFITKIT
Sbjct  111  LLNDFENVCTLRVRMPISSDLCNPRNFITKIT  142


 Score = 52.8 bits (125),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  144  YDKVVDIPNSMTILDELLPISIEMAKRNL  172



>ref|XP_008238760.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=394

 Score = 60.8 bits (146),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL  ++NVCTLRVRMPISSDLSNPRNFITKIT
Sbjct  248  LLNNFENVCTLRVRMPISSDLSNPRNFITKIT  279


 Score = 51.2 bits (121),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y KVV+IPNSM ILDEL PISI+MAKRNL
Sbjct  281  YEKVVDIPNSMTILDELLPISIDMAKRNL  309



>ref|XP_008373757.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=299

 Score = 58.5 bits (140),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LL  ++NVCTLRVRMPISSDL NPRNFITKIT
Sbjct  153  LLNNFENVCTLRVRMPISSDLCNPRNFITKIT  184


 Score = 52.8 bits (125),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRNL  189
            Y+KVV+IPNSM ILDEL PISIEMAKRNL
Sbjct  186  YDKVVDIPNSMTILDELLPISIEMAKRNL  214



>ref|XP_010916151.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Elaeis guineensis]
Length=673

 Score = 58.5 bits (140),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKE++NVCTLR+RMPISSDLSNP N ITKIT
Sbjct  527  LLKEFENVCTLRIRMPISSDLSNPCNLITKIT  558


 Score = 52.8 bits (125),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  103  YNKVVNIPNSMNILDELQPISIEMAKRN  186
            YNKVVNIPNSM++LDEL P+SIEMAKRN
Sbjct  560  YNKVVNIPNSMSVLDELLPLSIEMAKRN  587



>ref|XP_007146360.1| hypothetical protein PHAVU_006G034000g [Phaseolus vulgaris]
 gb|ESW18354.1| hypothetical protein PHAVU_006G034000g [Phaseolus vulgaris]
Length=666

 Score = 62.4 bits (150),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    LLKEYDNVCTLRVRMPISSDLSNPRNFITKIT  98
            LLKEYDNVCTLR+++P+SSDLSNP NFITKIT
Sbjct  514  LLKEYDNVCTLRIQLPVSSDLSNPHNFITKIT  545


 Score = 47.0 bits (110),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  106  NKVVNIPNSMNILDELQPISIEMAKRN  186
            +KV NIPNS+ +LDEL PISIEMAKRN
Sbjct  548  DKVANIPNSITVLDELLPISIEMAKRN  574



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570351139820