BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN036M19

Length=215
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011077887.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  85.9    2e-19   Sesamum indicum [beniseed]
ref|XP_006384635.1|  60s acidic ribosomal family protein              85.5    3e-19   
gb|ABK92597.1|  unknown                                               85.5    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_009589318.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  85.1    4e-19   Nicotiana tomentosiformis
gb|EYU35434.1|  hypothetical protein MIMGU_mgv1a016591mg              85.1    4e-19   Erythranthe guttata [common monkey flower]
ref|XP_006430260.1|  hypothetical protein CICLE_v10013051mg           85.9    4e-19   
gb|KCW87970.1|  hypothetical protein EUGRSUZ_A00378                   84.0    9e-19   Eucalyptus grandis [rose gum]
ref|XP_010912250.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  84.0    9e-19   Elaeis guineensis
ref|XP_009804702.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  84.0    9e-19   Nicotiana sylvestris
ref|XP_010064997.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  84.0    1e-18   Eucalyptus grandis [rose gum]
ref|XP_011044769.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  84.0    1e-18   Populus euphratica
ref|XP_002525251.1|  60S acidic ribosomal protein P2, putative        83.6    1e-18   
gb|ACI14380.1|  60S acidic ribosomal protein P2-like protein          83.6    2e-18   Forsythia suspensa
ref|XP_002313663.1|  60s acidic ribosomal family protein              83.6    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_002283025.1|  PREDICTED: 60S acidic ribosomal protein P2       83.2    2e-18   Vitis vinifera
ref|XP_010242613.1|  PREDICTED: 60S acidic ribosomal protein P2-like  83.2    2e-18   Nelumbo nucifera [Indian lotus]
gb|KDP34714.1|  hypothetical protein JCGZ_10919                       83.2    2e-18   Jatropha curcas
ref|XP_007015884.1|  60S acidic ribosomal protein P2B, putative       82.8    3e-18   Theobroma cacao [chocolate]
gb|KJB21688.1|  hypothetical protein B456_004G008900                  84.3    3e-18   Gossypium raimondii
ref|XP_002266030.2|  PREDICTED: 60S acidic ribosomal protein P2 i...  83.6    3e-18   Vitis vinifera
ref|XP_011088860.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  82.8    3e-18   
ref|XP_009800754.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  82.4    4e-18   Nicotiana sylvestris
ref|XP_011046262.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  82.4    5e-18   Populus euphratica
ref|XP_008788306.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  82.0    7e-18   
gb|KJB21689.1|  hypothetical protein B456_004G009000                  82.0    7e-18   Gossypium raimondii
ref|XP_010651712.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  81.6    8e-18   Vitis vinifera
ref|XP_006347235.1|  PREDICTED: 60S acidic ribosomal protein P2       81.6    8e-18   Solanum tuberosum [potatoes]
ref|XP_007015881.1|  60S acidic ribosomal protein P2B, putative i...  81.6    9e-18   
ref|XP_010244112.1|  PREDICTED: 60S acidic ribosomal protein P2-like  81.6    9e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008783987.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  81.3    1e-17   Phoenix dactylifera
ref|XP_010924305.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  81.3    1e-17   Elaeis guineensis
ref|XP_008349090.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  81.3    1e-17   Malus domestica [apple tree]
gb|KJB36388.1|  hypothetical protein B456_006G156700                  81.3    1e-17   Gossypium raimondii
ref|XP_011090363.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  81.3    1e-17   Sesamum indicum [beniseed]
emb|CDP06954.1|  unnamed protein product                              81.3    1e-17   Coffea canephora [robusta coffee]
ref|XP_008227500.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  80.9    2e-17   Prunus mume [ume]
ref|XP_009777027.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  80.9    2e-17   Nicotiana sylvestris
gb|KDO61085.1|  hypothetical protein CISIN_1g033355mg                 80.9    2e-17   Citrus sinensis [apfelsine]
gb|EPS74099.1|  hypothetical protein M569_00658                       80.9    2e-17   Genlisea aurea
ref|XP_006471373.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  80.5    2e-17   Citrus sinensis [apfelsine]
ref|XP_011467330.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  80.5    2e-17   Fragaria vesca subsp. vesca
ref|XP_006481819.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  80.5    2e-17   Citrus sinensis [apfelsine]
ref|XP_004241310.1|  PREDICTED: 60S acidic ribosomal protein P2       80.5    2e-17   Solanum lycopersicum
emb|CDP15388.1|  unnamed protein product                              80.5    3e-17   Coffea canephora [robusta coffee]
gb|KHG07914.1|  60S acidic ribosomal P2                               80.5    3e-17   Gossypium arboreum [tree cotton]
ref|XP_009629439.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  80.5    3e-17   Nicotiana tomentosiformis
gb|KJB55651.1|  hypothetical protein B456_009G087300                  80.1    3e-17   Gossypium raimondii
ref|XP_007205887.1|  hypothetical protein PRUPE_ppa011311mg           82.0    3e-17   
ref|NP_001275119.1|  uncharacterized protein LOC102577788             81.3    3e-17   Solanum tuberosum [potatoes]
ref|XP_006424296.1|  hypothetical protein CICLE_v10029621mg           80.1    4e-17   Citrus clementina [clementine]
ref|XP_011094390.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  80.1    4e-17   Sesamum indicum [beniseed]
ref|XP_009624065.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  79.7    4e-17   Nicotiana tomentosiformis
ref|XP_002529063.1|  60S acidic ribosomal protein P2, putative        79.7    4e-17   Ricinus communis
ref|XP_008355226.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  80.1    4e-17   
ref|XP_008391761.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  79.7    4e-17   
ref|XP_004228456.1|  PREDICTED: 60S acidic ribosomal protein P2       79.7    4e-17   Solanum lycopersicum
gb|ABK22480.1|  unknown                                               79.7    5e-17   Picea sitchensis
ref|XP_008342938.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  79.7    5e-17   Malus domestica [apple tree]
ref|XP_007027672.1|  60S acidic ribosomal protein P2-4                79.7    5e-17   Theobroma cacao [chocolate]
gb|ABA40434.1|  60s acidic ribosomal protein-like protein             79.7    5e-17   Solanum tuberosum [potatoes]
ref|XP_009364278.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  79.7    6e-17   Pyrus x bretschneideri [bai li]
ref|XP_006349107.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  79.7    6e-17   Solanum tuberosum [potatoes]
ref|XP_004251036.1|  PREDICTED: 60S acidic ribosomal protein P2-2     79.3    6e-17   Solanum lycopersicum
ref|XP_007202715.1|  hypothetical protein PRUPE_ppa012794mg           80.1    8e-17   
ref|XP_008241270.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  79.0    9e-17   Prunus mume [ume]
ref|XP_009366640.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  79.0    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_009613358.1|  PREDICTED: 60S acidic ribosomal protein P2-like  79.0    1e-16   Nicotiana tomentosiformis
ref|XP_004293299.1|  PREDICTED: 60S acidic ribosomal protein P2-like  79.0    1e-16   Fragaria vesca subsp. vesca
ref|XP_009374748.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  78.6    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_008797513.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  78.6    1e-16   Phoenix dactylifera
ref|XP_011462847.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  78.6    1e-16   Fragaria vesca subsp. vesca
gb|KDP42715.1|  hypothetical protein JCGZ_23655                       78.6    1e-16   Jatropha curcas
ref|XP_010089386.1|  60S acidic ribosomal protein P2-4                78.2    2e-16   Morus notabilis
gb|KCW50805.1|  hypothetical protein EUGRSUZ_J00465                   78.2    2e-16   Eucalyptus grandis [rose gum]
ref|XP_010031491.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  78.2    2e-16   Eucalyptus grandis [rose gum]
ref|XP_008360542.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  78.2    2e-16   
gb|KHG14059.1|  60S acidic ribosomal P2                               77.8    2e-16   Gossypium arboreum [tree cotton]
ref|XP_010926364.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  77.8    3e-16   Elaeis guineensis
gb|ABM65702.1|  60S acidic ribosomal protein P2                       77.4    3e-16   Juglans regia
ref|XP_010907155.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  77.4    3e-16   Elaeis guineensis
ref|XP_010275438.1|  PREDICTED: 60S acidic ribosomal protein P2-like  77.4    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010069674.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  77.4    4e-16   Eucalyptus grandis [rose gum]
ref|XP_004303010.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  77.4    4e-16   Fragaria vesca subsp. vesca
ref|XP_010241325.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  77.0    4e-16   Nelumbo nucifera [Indian lotus]
gb|AGE45654.1|  ribosomal protein P2B                                 77.0    5e-16   Picea wilsonii
ref|XP_004150488.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  77.0    5e-16   Cucumis sativus [cucumbers]
ref|XP_004150487.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  77.0    6e-16   
gb|KJB16640.1|  hypothetical protein B456_002G241200                  76.6    8e-16   Gossypium raimondii
sp|P41099.1|RLA2_PARAR  RecName: Full=60S acidic ribosomal protei...  76.3    9e-16   Parthenium argentatum
ref|XP_008351356.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  76.3    9e-16   
emb|CDP13859.1|  unnamed protein product                              76.3    1e-15   Coffea canephora [robusta coffee]
ref|XP_008348607.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  76.3    1e-15   
gb|EYU35149.1|  hypothetical protein MIMGU_mgv1a016659mg              75.9    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_004145795.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  75.9    1e-15   Cucumis sativus [cucumbers]
ref|XP_008446770.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  75.9    1e-15   Cucumis melo [Oriental melon]
gb|EPS73855.1|  hypothetical protein M569_00918                       75.9    1e-15   Genlisea aurea
ref|XP_007162878.1|  hypothetical protein PHAVU_001G1882000g          77.0    1e-15   Phaseolus vulgaris [French bean]
gb|AAS20966.1|  60s acidic ribosomal protein                          75.9    2e-15   Hyacinthus orientalis [common hyacinth]
ref|XP_010520675.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  74.3    2e-15   Tarenaya hassleriana [spider flower]
gb|ABK24939.1|  unknown                                               75.5    2e-15   Picea sitchensis
ref|XP_009618588.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  75.5    2e-15   Nicotiana tomentosiformis
gb|KJB06823.1|  hypothetical protein B456_001G120800                  75.5    2e-15   Gossypium raimondii
ref|XP_009784712.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  75.1    3e-15   Nicotiana sylvestris
gb|KHN02245.1|  60S acidic ribosomal protein P2                       73.9    3e-15   Glycine soja [wild soybean]
gb|AFK46271.1|  unknown                                               75.1    3e-15   Lotus japonicus
emb|CDP21644.1|  unnamed protein product                              75.1    3e-15   Coffea canephora [robusta coffee]
ref|XP_006858566.1|  hypothetical protein AMTR_s00071p00177850        75.1    3e-15   Amborella trichopoda
ref|XP_009394805.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  74.7    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001055683.1|  Os05g0445500                                     74.7    3e-15   
ref|XP_006419121.1|  hypothetical protein EUTSA_v10002732mg           74.7    4e-15   Eutrema salsugineum [saltwater cress]
ref|XP_008361098.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  74.7    5e-15   
ref|XP_006654480.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  74.3    5e-15   Oryza brachyantha
gb|KHN25194.1|  60S acidic ribosomal protein P2B                      73.6    6e-15   Glycine soja [wild soybean]
gb|EEC79308.1|  hypothetical protein OsI_20141                        75.5    6e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_002264645.1|  PREDICTED: 60S acidic ribosomal protein P2       73.9    7e-15   Vitis vinifera
ref|XP_008801232.1|  PREDICTED: 60S acidic ribosomal protein P2-like  73.9    8e-15   Phoenix dactylifera
ref|XP_010093218.1|  60S acidic ribosomal protein P2B                 73.9    9e-15   Morus notabilis
ref|XP_008358569.1|  PREDICTED: serpin-ZX-like                        77.8    1e-14   Malus domestica [apple tree]
ref|XP_009410961.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  73.6    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003521450.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  73.6    1e-14   Glycine max [soybeans]
ref|XP_006358327.1|  PREDICTED: 60S acidic ribosomal protein P2-like  73.6    1e-14   Solanum tuberosum [potatoes]
ref|XP_004490304.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  73.6    1e-14   Cicer arietinum [garbanzo]
ref|XP_003554422.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  73.6    1e-14   Glycine max [soybeans]
ref|XP_004297919.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  73.6    1e-14   Fragaria vesca subsp. vesca
ref|XP_004243028.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  73.2    1e-14   Solanum lycopersicum
ref|XP_002950613.1|  hypothetical protein VOLCADRAFT_120883           73.2    1e-14   Volvox carteri f. nagariensis
ref|NP_001236459.1|  uncharacterized protein LOC100500331             73.2    1e-14   Glycine max [soybeans]
ref|XP_008458601.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  73.2    2e-14   Cucumis melo [Oriental melon]
ref|XP_009394231.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  73.2    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002967170.1|  hypothetical protein SELMODRAFT_28094            71.6    2e-14   
ref|XP_006343627.1|  PREDICTED: 60S acidic ribosomal protein P2-like  72.4    3e-14   Solanum tuberosum [potatoes]
ref|XP_010231320.1|  PREDICTED: 60S acidic ribosomal protein P2B      72.0    4e-14   Brachypodium distachyon [annual false brome]
gb|AAT08664.1|  acidic ribosomal protein                              72.0    4e-14   Hyacinthus orientalis [common hyacinth]
ref|XP_010541287.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  72.0    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_002439881.1|  hypothetical protein SORBIDRAFT_09g021900        72.0    4e-14   Sorghum bicolor [broomcorn]
gb|KHN27663.1|  60S acidic ribosomal protein P2B                      72.0    4e-14   Glycine soja [wild soybean]
ref|XP_004297921.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  72.0    5e-14   Fragaria vesca subsp. vesca
ref|XP_008462549.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  72.0    5e-14   
ref|XP_008462550.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  71.6    6e-14   
ref|XP_002960843.1|  hypothetical protein SELMODRAFT_139397           71.2    7e-14   Selaginella moellendorffii
emb|CAN72528.1|  hypothetical protein VITISV_013399                   70.9    1e-13   Vitis vinifera
ref|XP_004167615.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  70.9    1e-13   
emb|CDP13301.1|  unnamed protein product                              70.9    1e-13   Coffea canephora [robusta coffee]
ref|XP_007261576.1|  ribosomal protein 60S                            70.9    1e-13   Fomitiporia mediterranea MF3/22
ref|NP_001132823.1|  uncharacterized protein LOC100194313             70.9    1e-13   Zea mays [maize]
gb|AFW81220.1|  acidic ribosomal protein P2a-4                        70.9    1e-13   
gb|EEE63896.1|  hypothetical protein OsJ_18721                        72.8    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010683782.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  70.5    1e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW81221.1|  hypothetical protein ZEAMMB73_796524                  72.8    1e-13   
gb|ABD74514.1|  ribosomal protein                                     70.9    2e-13   Pteris vittata
ref|XP_004961921.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  70.1    2e-13   Setaria italica
gb|ACJ86110.1|  unknown                                               70.1    2e-13   Medicago truncatula
ref|NP_001235654.1|  uncharacterized protein LOC100499761             70.1    2e-13   Glycine max [soybeans]
gb|AFK45307.1|  unknown                                               70.1    2e-13   Medicago truncatula
gb|KHN21444.1|  60S acidic ribosomal protein P2B                      69.7    2e-13   Glycine soja [wild soybean]
ref|XP_003543439.2|  PREDICTED: 60S acidic ribosomal protein P2B-...  70.5    2e-13   Glycine max [soybeans]
ref|XP_004295494.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  69.7    2e-13   Fragaria vesca subsp. vesca
gb|AFW81770.1|  60S acidic ribosomal protein P2B                      70.5    3e-13   
ref|XP_004297978.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  69.7    3e-13   Fragaria vesca subsp. vesca
ref|XP_008655428.1|  PREDICTED: acidic ribosomal protein P2a-2 is...  70.1    3e-13   
ref|NP_001105390.1|  60S acidic ribosomal protein P2B                 69.7    3e-13   Zea mays [maize]
ref|NP_001105388.1|  acidic ribosomal protein P2a-2                   69.7    3e-13   Zea mays [maize]
ref|XP_007145332.1|  hypothetical protein PHAVU_007G230200g           69.7    4e-13   Phaseolus vulgaris [French bean]
ref|NP_001236220.1|  uncharacterized protein LOC100306264             69.3    4e-13   Glycine max [soybeans]
ref|NP_001105377.1|  60S acidic ribosomal protein P2A precursor       69.3    4e-13   Zea mays [maize]
sp|P46252.3|RLA2A_MAIZE  RecName: Full=60S acidic ribosomal prote...  69.3    4e-13   Zea mays [maize]
ref|XP_008655427.1|  PREDICTED: 60S acidic ribosomal protein P2A ...  69.3    4e-13   Zea mays [maize]
ref|XP_001694856.1|  acidic ribosomal protein P2                      68.9    6e-13   Chlamydomonas reinhardtii
ref|XP_004961920.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  69.3    6e-13   
ref|NP_190045.1|  60S acidic ribosomal protein P2-4                   68.9    6e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002441563.1|  hypothetical protein SORBIDRAFT_09g029390        68.9    6e-13   Sorghum bicolor [broomcorn]
gb|KJB06824.1|  hypothetical protein B456_001G120800                  68.9    6e-13   Gossypium raimondii
ref|XP_008655431.1|  PREDICTED: 60S acidic ribosomal protein P2B ...  69.3    6e-13   Zea mays [maize]
ref|XP_006292078.1|  hypothetical protein CARUB_v10018273mg           68.9    6e-13   
ref|XP_006279385.1|  hypothetical protein CARUB_v10008004mg           68.9    6e-13   Capsella rubella
ref|XP_010521669.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  68.9    6e-13   Tarenaya hassleriana [spider flower]
ref|XP_008387857.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  68.9    6e-13   
ref|XP_004975549.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  68.9    6e-13   Setaria italica
ref|XP_004973771.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  68.9    6e-13   Setaria italica
ref|XP_009421130.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  68.9    6e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010686061.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  68.9    7e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010425874.1|  PREDICTED: 60S acidic ribosomal protein P2-4     68.9    7e-13   Camelina sativa [gold-of-pleasure]
gb|EMT02685.1|  60S acidic ribosomal protein P2B                      68.6    7e-13   
gb|EMS66726.1|  60S acidic ribosomal protein P2B                      68.6    7e-13   Triticum urartu
ref|XP_005849033.1|  hypothetical protein CHLNCDRAFT_51198            68.6    7e-13   Chlorella variabilis
gb|AFW81218.1|  acidic ribosomal protein P2a                          69.3    8e-13   
ref|XP_002448737.1|  hypothetical protein SORBIDRAFT_06g032330        68.6    9e-13   Sorghum bicolor [broomcorn]
gb|AFK40789.1|  unknown                                               68.2    1e-12   Lotus japonicus
ref|XP_002315449.1|  60s acidic ribosomal family protein              68.2    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010503106.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  67.8    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_001758040.1|  predicted protein                                67.8    1e-12   
gb|AAP80630.1|AF475108_1  acidic ribosomal protein                    68.2    2e-12   Triticum aestivum [Canadian hard winter wheat]
pdb|3J61|SS  Chain s, Localization Of The Large Subunit Ribosomal...  67.8    2e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001761876.1|  predicted protein                                67.8    2e-12   
gb|ACN30980.1|  unknown                                               67.4    2e-12   Zea mays [maize]
ref|XP_001784528.1|  predicted protein                                67.4    2e-12   
ref|XP_004975548.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  68.9    2e-12   
gb|ACG45911.1|  60S acidic ribosomal protein P2A                      67.4    3e-12   Zea mays [maize]
ref|XP_004487515.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  67.4    3e-12   Cicer arietinum [garbanzo]
ref|XP_004973770.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  67.8    3e-12   
ref|XP_011399325.1|  60S acidic ribosomal protein P2                  67.0    3e-12   Auxenochlorella protothecoides
dbj|BAC83094.1|  putative 60S acidic ribosomal protein                67.8    3e-12   Oryza sativa Japonica Group [Japonica rice]
gb|KFK32382.1|  hypothetical protein AALP_AA6G233900                  67.0    3e-12   Arabis alpina [alpine rockcress]
ref|XP_008663721.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  67.0    3e-12   
ref|XP_008668723.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  67.0    4e-12   
ref|XP_011024241.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  66.6    4e-12   Populus euphratica
ref|XP_010473164.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  66.6    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002447780.1|  hypothetical protein SORBIDRAFT_06g015440        66.6    4e-12   Sorghum bicolor [broomcorn]
gb|KJB62189.1|  hypothetical protein B456_009G405600                  67.0    4e-12   Gossypium raimondii
ref|XP_001754567.1|  predicted protein                                66.2    5e-12   
dbj|BAH57243.1|  AT2G27710                                            65.9    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189621.1|  60S acidic ribosomal protein P2-2                65.9    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004165173.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  66.6    7e-12   
ref|XP_002642304.1|  Hypothetical protein CBG18296                    65.9    7e-12   Caenorhabditis briggsae
ref|XP_010510738.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  66.2    7e-12   Camelina sativa [gold-of-pleasure]
gb|AFK33658.1|  unknown                                               65.9    7e-12   Medicago truncatula
ref|XP_002639930.1|  Hypothetical protein CBG08266                    65.9    8e-12   Caenorhabditis briggsae
ref|XP_010514785.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  65.9    8e-12   Camelina sativa [gold-of-pleasure]
ref|NP_180339.1|  60S acidic ribosomal protein P2-2                   65.9    8e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KIZ04174.1|  60S acidic ribosomal protein P2-4                     65.9    8e-12   Monoraphidium neglectum
gb|KGN48246.1|  hypothetical protein Csa_6G451490                     65.9    9e-12   Cucumis sativus [cucumbers]
gb|EGC44602.1|  60S acidic ribosomal protein P2                       65.9    9e-12   Histoplasma capsulatum H88
ref|XP_004167613.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  65.9    1e-11   
ref|XP_006295265.1|  hypothetical protein CARUB_v10024352mg           65.5    1e-11   Capsella rubella
ref|XP_010417919.1|  PREDICTED: 60S acidic ribosomal protein P2-1     65.5    1e-11   Camelina sativa [gold-of-pleasure]
emb|CDX77131.1|  BnaC04g39260D                                        65.5    1e-11   
gb|KIK47394.1|  hypothetical protein CY34DRAFT_247207                 65.5    1e-11   Suillus luteus UH-Slu-Lm8-n1
ref|XP_001756207.1|  predicted protein                                65.5    1e-11   
ref|XP_001907105.1|  hypothetical protein                             65.5    1e-11   Podospora anserina S mat+
gb|AFK39918.1|  unknown                                               65.5    1e-11   Medicago truncatula
gb|AAM65044.1|  60S acidic ribosomal protein P2                       65.5    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KEH38965.1|  60S acidic ribosomal protein                          65.5    1e-11   Medicago truncatula
ref|XP_006643860.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  65.5    1e-11   Oryza brachyantha
ref|XP_010473159.1|  PREDICTED: 60S acidic ribosomal protein P2-1...  65.5    1e-11   Camelina sativa [gold-of-pleasure]
gb|AAP80619.1|AF475097_1  acidic ribosomal protein P2                 65.5    1e-11   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ92129.1|  predicted protein                                    65.1    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010514554.1|  PREDICTED: 60S acidic ribosomal protein P2-3...  65.1    2e-11   Camelina sativa [gold-of-pleasure]
gb|KIP10036.1|  hypothetical protein PHLGIDRAFT_34126                 65.1    2e-11   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_004955604.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  65.5    2e-11   
ref|XP_003579690.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  64.7    2e-11   Brachypodium distachyon [annual false brome]
gb|EEH10128.1|  60S acidic ribosomal protein P2                       65.9    2e-11   Histoplasma capsulatum G186AR
gb|AAN52372.1|  ribosomal protein P2                                  64.7    2e-11   Branchiostoma belcheri
ref|XP_002875674.1|  hypothetical protein ARALYDRAFT_484870           64.7    2e-11   
ref|XP_009140817.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  64.7    2e-11   Brassica rapa
ref|XP_004955605.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  64.7    2e-11   Setaria italica
emb|CCO30861.1|  60S acidic ribosomal protein P2 AltName: Full=Ac...  63.5    3e-11   Rhizoctonia solani AG-1 IB
ref|XP_002634216.1|  Hypothetical protein CBG01785                    64.7    3e-11   Caenorhabditis briggsae
gb|ACM09200.1|  60S acidic ribosomal protein P2                       64.3    3e-11   Salmo salar
gb|AFK35524.1|  unknown                                               64.3    3e-11   Lotus japonicus
ref|NP_001133207.1|  ribosomal protein, large P2, like 1-2            64.3    3e-11   Salmo salar
ref|XP_004143377.1|  PREDICTED: 60S acidic ribosomal protein P2B-...  64.7    4e-11   Cucumis sativus [cucumbers]
ref|XP_006295264.1|  hypothetical protein CARUB_v10024350mg           64.3    4e-11   Capsella rubella
ref|XP_010764780.1|  PREDICTED: 60S acidic ribosomal protein P2-like  64.3    4e-11   Notothenia coriiceps [yellowbelly rockcod]
ref|NP_001107326.1|  uncharacterized protein LOC100135138             63.9    4e-11   Xenopus tropicalis [western clawed frog]
ref|NP_001047015.1|  Os02g0529700                                     63.9    4e-11   
ref|XP_002880973.1|  predicted protein                                63.9    4e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_002634214.1|  C. briggsae CBR-RLA-2 protein                    63.9    4e-11   Caenorhabditis briggsae
ref|XP_008407179.1|  PREDICTED: 60S acidic ribosomal protein P2-like  63.9    5e-11   Poecilia reticulata
ref|XP_006284631.1|  hypothetical protein CARUB_v10005874mg           64.7    5e-11   
ref|XP_006647333.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  63.9    5e-11   Oryza brachyantha
ref|NP_180340.1|  60S acidic ribosomal protein P2-1                   63.9    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409780.1|  hypothetical protein EUTSA_v10017442mg           63.9    5e-11   Eutrema salsugineum [saltwater cress]
ref|XP_003557330.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  63.5    5e-11   Brachypodium distachyon [annual false brome]
ref|XP_001831572.2|  60S acidic ribosomal protein P2                  64.3    6e-11   Coprinopsis cinerea okayama7#130
ref|XP_006292070.1|  hypothetical protein CARUB_v10018265mg           63.5    6e-11   Capsella rubella
gb|EER38969.1|  60S acidic ribosomal protein P2                       63.5    6e-11   Histoplasma capsulatum H143
ref|XP_003108418.1|  CRE-RLA-2 protein                                64.3    6e-11   Caenorhabditis remanei
ref|XP_007546959.1|  PREDICTED: 60S acidic ribosomal protein P2-like  63.5    6e-11   Poecilia formosa
ref|XP_005103046.1|  PREDICTED: 60S acidic ribosomal protein P2-like  63.5    7e-11   Aplysia californica
ref|XP_005815430.1|  PREDICTED: 60S acidic ribosomal protein P2-like  63.5    7e-11   Xiphophorus maculatus
ref|XP_007827937.1|  60S acidic ribosomal protein P2                  63.2    7e-11   Pestalotiopsis fici W106-1
ref|XP_010425630.1|  PREDICTED: 60S acidic ribosomal protein P2-3     63.2    8e-11   Camelina sativa [gold-of-pleasure]
gb|ACM08252.1|  60S acidic ribosomal protein P2                       63.2    8e-11   Salmo salar
ref|XP_004344608.1|  60s Acidic ribosomal protein                     63.5    8e-11   Acanthamoeba castellanii str. Neff
ref|XP_002676372.1|  predicted protein                                62.8    1e-10   Naegleria gruberi strain NEG-M
ref|XP_003003683.1|  60S acidic ribosomal protein P2                  62.8    1e-10   Verticillium alfalfae VaMs.102
ref|XP_003453702.1|  PREDICTED: 60S acidic ribosomal protein P2-like  63.2    1e-10   
ref|XP_002880972.1|  predicted protein                                63.2    1e-10   Arabidopsis lyrata subsp. lyrata
emb|CBN08621.1|  ribosomal protein, large, P2                         62.8    1e-10   Microcosmus squamiger
ref|XP_008546451.1|  PREDICTED: 60S acidic ribosomal protein P2       62.8    1e-10   
ref|XP_004497613.1|  PREDICTED: 60S acidic ribosomal protein P2-4...  62.8    1e-10   
ref|NP_001042268.1|  Os01g0191100                                     62.8    1e-10   
emb|CDQ59569.1|  unnamed protein product                              62.0    1e-10   
emb|CBY33355.1|  unnamed protein product                              62.8    1e-10   
emb|CBY11295.1|  unnamed protein product                              62.8    1e-10   
ref|XP_009655443.1|  60S acidic ribosomal protein P2                  62.8    1e-10   
gb|EMR80626.1|  putative 60s acidic ribosomal protein p2 protein      63.2    1e-10   
gb|ACM09422.1|  60S acidic ribosomal protein P2                       62.8    1e-10   
gb|ACM09537.1|  60S acidic ribosomal protein P2                       62.8    1e-10   
ref|NP_997908.1|  60S acidic ribosomal protein P2                     62.8    1e-10   
ref|NP_189491.1|  60S acidic ribosomal protein P2-3                   62.8    1e-10   
ref|XP_006392052.1|  hypothetical protein EUTSA_v10023766mg           62.8    1e-10   
gb|EFA76098.1|  ribosomal acidic phosphoprotein P2                    62.4    1e-10   
dbj|GAM90886.1|  hypothetical protein ANO11243_089320                 61.2    1e-10   
gb|AAF61073.1|AF220554_1  ribosomal protein large P2                  62.4    2e-10   
gb|ACM08361.1|  60S acidic ribosomal protein P2                       62.4    2e-10   
emb|CAN75514.1|  hypothetical protein VITISV_042772                   62.0    2e-10   
ref|XP_010435954.1|  PREDICTED: 60S acidic ribosomal protein P2-5     62.4    2e-10   
emb|CCA66773.1|  probable ribosomal protein P2                        62.4    2e-10   
gb|EAZ03394.1|  hypothetical protein OsI_25537                        62.0    2e-10   
gb|EWC45954.1|  60S acidic ribosomal protein P2                       62.0    2e-10   
ref|XP_010728413.1|  PREDICTED: 60S acidic ribosomal protein P2-like  62.0    2e-10   
ref|XP_008278475.1|  PREDICTED: 60S acidic ribosomal protein P2       62.0    2e-10   
ref|XP_011331848.1|  PREDICTED: 60S acidic ribosomal protein P2       62.0    2e-10   
gb|EAZ39293.1|  hypothetical protein OsJ_23728                        61.6    2e-10   
ref|XP_005987634.1|  PREDICTED: 60S acidic ribosomal protein P2-like  62.0    3e-10   
ref|NP_001175120.1|  Os07g0251301                                     61.6    3e-10   
ref|XP_011422440.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  61.6    3e-10   
ref|XP_007877227.1|  hypothetical protein PFL1_06848                  61.6    3e-10   
gb|ABV44733.1|  60S acidic ribosomal protein P2-like protein          61.6    3e-10   
emb|CBN80745.1|  60S acidic ribosomal protein P2                      61.6    3e-10   
ref|XP_008879709.1|  hypothetical protein H310_13839                  61.6    3e-10   
ref|NP_001187032.1|  ribosomal protein P2                             61.6    3e-10   
ref|XP_006025341.1|  PREDICTED: 60S acidic ribosomal protein P2-like  61.6    3e-10   
sp|Q9GPU2.1|RLA2_EUPRA  RecName: Full=60S acidic ribosomal protei...  61.6    3e-10   
ref|NP_502571.1|  Protein RLA-2                                       61.6    3e-10   
ref|XP_005729847.1|  PREDICTED: 60S acidic ribosomal protein P2-like  61.6    3e-10   
ref|XP_006266263.1|  PREDICTED: 60S acidic ribosomal protein P2-like  61.6    3e-10   
emb|CAG11814.1|  unnamed protein product                              61.6    4e-10   
ref|XP_009801559.1|  PREDICTED: 60S acidic ribosomal protein P2-like  62.0    4e-10   
ref|XP_002862551.1|  hypothetical protein ARALYDRAFT_497404           61.6    4e-10   
ref|XP_011266350.1|  PREDICTED: 60S acidic ribosomal protein P2       61.6    4e-10   
ref|XP_002594824.1|  hypothetical protein BRAFLDRAFT_124423           61.6    4e-10   
ref|XP_010867688.1|  PREDICTED: 60S acidic ribosomal protein P2-like  61.2    4e-10   
sp|O01725.1|RLA2_BRAFL  RecName: Full=60S acidic ribosomal protei...  61.6    4e-10   
ref|XP_010728436.1|  PREDICTED: 60S acidic ribosomal protein P2-like  61.6    4e-10   
gb|EKC25701.1|  60S acidic ribosomal protein P2                       62.0    4e-10   
gb|ELR57188.1|  60S acidic ribosomal protein P2                       61.2    4e-10   
ref|XP_011444192.1|  PREDICTED: 60S acidic ribosomal protein P2-like  61.2    4e-10   
ref|XP_010441119.1|  PREDICTED: 60S acidic ribosomal protein P2-5...  61.2    5e-10   
ref|XP_006753265.1|  PREDICTED: 60S acidic ribosomal protein P2-like  60.5    5e-10   
gb|KHJ33075.1|  putative ribosomal protein 60s                        61.2    5e-10   
gb|ESZ92796.1|  60S acidic ribosomal protein P2                       61.2    5e-10   
gb|EAZ39748.1|  hypothetical protein OsJ_24186                        60.8    5e-10   
ref|XP_006967873.1|  60s ribosomal protein rla2, P2                   60.8    5e-10   
ref|XP_007253399.1|  PREDICTED: 60S acidic ribosomal protein P2-like  60.8    6e-10   
ref|XP_003351714.1|  60S acidic ribosomal protein P2                  60.8    6e-10   
ref|XP_965172.1|  60S acidic ribosomal protein P2                     60.8    6e-10   
ref|XP_006657594.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  60.8    7e-10   
ref|XP_001553823.1|  60S acidic ribosomal protein P2                  60.8    7e-10   
dbj|BAF98697.1|  ribosomal protein LP2                                60.8    7e-10   
ref|XP_001601398.1|  PREDICTED: 60S acidic ribosomal protein P2       60.8    7e-10   
emb|CAA54470.1|  ribosomal P2 protein                                 60.5    8e-10   
ref|XP_001597505.1|  60S acidic ribosomal protein P2                  60.5    8e-10   
gb|ELK38183.1|  60S acidic ribosomal protein P2                       60.1    8e-10   
ref|XP_009111598.1|  PREDICTED: 60S acidic ribosomal protein P2-3...  60.5    8e-10   
ref|XP_008319097.1|  PREDICTED: 60S acidic ribosomal protein P2-like  60.5    8e-10   
ref|XP_010072151.1|  PREDICTED: 60S acidic ribosomal protein P2       59.7    8e-10   
emb|CDY31188.1|  BnaC03g47030D                                        60.5    8e-10   
gb|KFV67029.1|  60S acidic ribosomal protein P2                       59.7    8e-10   
ref|XP_011497614.1|  PREDICTED: 60S acidic ribosomal protein P2       60.5    9e-10   
ref|XP_011159603.1|  PREDICTED: 60S acidic ribosomal protein P2       60.5    9e-10   
ref|XP_003789036.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  60.5    9e-10   
ref|XP_009133885.1|  PREDICTED: 60S acidic ribosomal protein P2-1     60.5    9e-10   
gb|KFK33166.1|  hypothetical protein AALP_AA6G339100                  60.5    1e-09   
gb|KFQ10965.1|  60S acidic ribosomal protein P2                       59.3    1e-09   
ref|XP_003571500.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  60.5    1e-09   
ref|XP_003089924.1|  hypothetical protein CRE_12398                   60.1    1e-09   
gb|EIE91690.1|  60S acidic ribosomal protein P2                       60.1    1e-09   
gb|EMT15514.1|  60S acidic ribosomal protein P2B                      60.1    1e-09   
ref|XP_003973120.1|  PREDICTED: 60S acidic ribosomal protein P2-like  60.1    1e-09   
gb|AAH53763.1|  LOC398653 protein                                     60.1    1e-09   
ref|XP_009855097.1|  hypothetical protein NEUTE1DRAFT_51458           60.1    1e-09   
gb|KFP43073.1|  60S acidic ribosomal protein P2                       59.7    1e-09   
ref|XP_005715470.1|  unnamed protein product                          60.1    1e-09   
gb|EUC59786.1|  60S acidic ribosomal protein P2                       60.1    1e-09   
ref|XP_010865677.1|  PREDICTED: 60S acidic ribosomal protein P2-like  60.1    1e-09   
gb|EPX71080.1|  60S acidic ribosomal protein P2B subunit              60.1    1e-09   
ref|XP_006822991.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  60.1    1e-09   
gb|KFQ19945.1|  60S acidic ribosomal protein P2                       59.3    1e-09   
gb|EPY51533.1|  ribosomal protein rpa6                                60.1    1e-09   
gb|EHJ71201.1|  hypothetical protein KGM_08664                        60.1    1e-09   
gb|EME50007.1|  hypothetical protein DOTSEDRAFT_68758                 60.1    1e-09   
gb|ACQ58863.1|  60S acidic ribosomal protein P2                       60.1    1e-09   
emb|CDY04508.1|  BnaA07g13340D                                        60.1    1e-09   
ref|XP_007401185.1|  hypothetical protein PHACADRAFT_213761           60.1    1e-09   
ref|XP_003993856.1|  PREDICTED: 60S acidic ribosomal protein P2       60.1    1e-09   
ref|XP_009163412.1|  hypothetical protein T265_01187                  60.1    1e-09   
ref|XP_003801216.1|  PREDICTED: 60S acidic ribosomal protein P2-like  59.7    2e-09   
ref|XP_011145402.1|  PREDICTED: 60S acidic ribosomal protein P2-like  59.7    2e-09   
ref|XP_008106552.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  59.7    2e-09   
gb|AAR87710.1|  60S ribosomal stalk P2 subunit                        59.7    2e-09   
emb|CEI97934.1|  Putative 60S acidic ribosomal protein P2             59.7    2e-09   
emb|CEG66385.1|  Putative 60S acidic ribosomal protein P2             59.7    2e-09   
gb|KFV00420.1|  60S acidic ribosomal protein P2                       59.3    2e-09   
ref|XP_007433233.1|  PREDICTED: 60S acidic ribosomal protein P2       59.7    2e-09   
ref|XP_001094442.1|  PREDICTED: 60S acidic ribosomal protein P2-like  59.7    2e-09   
ref|XP_009103616.1|  PREDICTED: 60S acidic ribosomal protein P2-2...  59.7    2e-09   
ref|NP_595873.1|  60S acidic ribosomal protein P2B                    59.7    2e-09   
emb|CDX71430.1|  BnaC04g16650D                                        59.7    2e-09   
ref|XP_003214823.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  59.7    2e-09   
ref|XP_005894640.1|  PREDICTED: 60S acidic ribosomal protein P2-like  58.9    2e-09   
ref|XP_009819648.1|  PREDICTED: 60S acidic ribosomal protein P2       58.9    2e-09   
ref|XP_004403832.1|  PREDICTED: 60S acidic ribosomal protein P2       59.7    2e-09   
ref|XP_004717227.1|  PREDICTED: 60S acidic ribosomal protein P2       59.7    2e-09   
ref|XP_003802819.1|  PREDICTED: 60S acidic ribosomal protein P2       59.7    2e-09   
gb|EAZ06215.1|  hypothetical protein OsI_28456                        59.7    2e-09   
gb|KDQ61763.1|  hypothetical protein JAAARDRAFT_172170                59.7    2e-09   
gb|ADG29166.1|  60S acidic ribosomal protein large P2                 59.7    2e-09   
gb|EAZ42058.1|  hypothetical protein OsJ_26618                        59.7    2e-09   
gb|KIJ65687.1|  hypothetical protein HYDPIDRAFT_110834                59.7    2e-09   
ref|XP_008943254.1|  PREDICTED: 60S acidic ribosomal protein P2       58.9    2e-09   
ref|NP_001291786.1|  ribosomal protein, large, P2                     59.7    2e-09   
ref|XP_003253139.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  59.7    2e-09   
ref|XP_002868676.1|  hypothetical protein ARALYDRAFT_493981           59.7    2e-09   
gb|EGI60614.1|  60S acidic ribosomal protein P2                       58.5    2e-09   
gb|KFV48563.1|  60S acidic ribosomal protein P2                       58.9    2e-09   
pdb|2W1O|A  Chain A, Nmr Structure Of Dimerization Domain Of Huma...  58.5    2e-09   
emb|CDX83277.1|  BnaA03g22290D                                        59.7    2e-09   
ref|NP_001078905.1|  60S acidic ribosomal protein P2                  59.7    2e-09   
gb|KGL96761.1|  60S acidic ribosomal protein P2                       59.3    2e-09   
dbj|BAD26688.1|  60S acidic ribosomal protein P2                      59.3    2e-09   
gb|AAH75193.1|  Unknown (protein for MGC:83396)                       59.3    2e-09   
ref|XP_002273733.1|  PREDICTED: 60S acidic ribosomal protein P2B      59.3    2e-09   
emb|CAN61098.1|  hypothetical protein VITISV_026175                   59.3    2e-09   
ref|XP_010954273.1|  PREDICTED: 60S acidic ribosomal protein P2       59.7    2e-09   
dbj|BAD05855.1|  putative 60S acidiic ribosomal protein P2A           60.1    2e-09   
gb|KIL95338.1|  60s acidic ribosomal protein p2                       59.3    2e-09   
ref|XP_010997536.1|  PREDICTED: 60S acidic ribosomal protein P2       59.3    2e-09   
ref|NP_001037213.1|  ribosomal protein P2                             59.3    2e-09   
ref|XP_003101271.1|  hypothetical protein CRE_14104                   59.3    2e-09   
gb|EMP34725.1|  60S acidic ribosomal protein P2                       59.7    2e-09   
emb|CDI55133.1|  probable ribosomal protein P2                        58.2    2e-09   
gb|KIM53911.1|  hypothetical protein SCLCIDRAFT_11451                 59.7    2e-09   
dbj|GAM23864.1|  hypothetical protein SAMD00019534_070390             59.3    2e-09   
dbj|GAM23685.1|  hypothetical protein SAMD00019534_068600             59.3    2e-09   
ref|XP_006822992.1|  PREDICTED: 60S acidic ribosomal protein P2-l...  59.3    2e-09   
ref|XP_006911025.1|  PREDICTED: 60S acidic ribosomal protein P2       59.3    2e-09   
gb|EMD39063.1|  hypothetical protein CERSUDRAFT_112755                59.3    3e-09   
ref|XP_004602932.1|  PREDICTED: 60S acidic ribosomal protein P2       59.3    3e-09   
ref|XP_001248451.1|  60S acidic ribosomal protein P2                  59.3    3e-09   
gb|EHK47605.1|  hypothetical protein TRIATDRAFT_298659                58.9    3e-09   
dbj|GAC77688.1|  60S acidic ribosomal protein P2                      59.7    3e-09   
ref|XP_009139947.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...  58.9    3e-09   
gb|AEM37651.1|  ribosomal protein LP2                                 59.3    3e-09   
gb|ABR27956.1|  ribosomal protein P2                                  59.3    3e-09   
gb|EIE83553.1|  hypothetical protein RO3G_08258                       58.9    3e-09   
gb|EDL36486.1|  mCG10050                                              59.3    3e-09   
ref|XP_006628376.1|  PREDICTED: 60S acidic ribosomal protein P2-like  58.9    3e-09   
ref|XP_002129422.1|  PREDICTED: 60S acidic ribosomal protein P2       58.9    3e-09   
dbj|BAM17679.1|  ribosomal protein LP2                                58.9    3e-09   
ref|XP_004456302.1|  PREDICTED: 60S acidic ribosomal protein P2-like  58.5    3e-09   
ref|XP_005064262.1|  PREDICTED: 60S acidic ribosomal protein P2       58.9    3e-09   
ref|XP_006045870.1|  PREDICTED: 60S acidic ribosomal protein P2       59.7    3e-09   
gb|ACY95371.1|  ribosomal protein P2                                  58.9    3e-09   
ref|XP_008494263.1|  PREDICTED: 60S acidic ribosomal protein P2       58.9    3e-09   
ref|XP_003048910.1|  60S acidic ribosomal protein P2                  58.9    3e-09   
gb|ABS57437.1|  ribosomal protein P2                                  58.9    3e-09   
gb|KIR45542.1|  60S acidic ribosomal protein P2                       58.9    3e-09   
ref|XP_002843918.1|  60S acidic ribosomal protein P2                  58.9    3e-09   
ref|XP_004808605.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  58.9    3e-09   
ref|XP_011297722.1|  PREDICTED: 60S acidic ribosomal protein P2       58.9    3e-09   
emb|CCF44035.1|  hypothetical protein CH063_00500                     58.9    3e-09   
ref|NP_198820.1|  60S acidic ribosomal protein P2-5                   58.9    3e-09   
ref|XP_007063534.1|  PREDICTED: 60S acidic ribosomal protein P2-like  58.9    3e-09   
gb|EST08868.1|  cytosolic ribosomal acidic protein                    58.9    3e-09   
gb|AFR96082.1|  large subunit acidic ribosomal protein P2             58.9    4e-09   
ref|XP_571539.1|  ribosomal protein P2                                58.9    4e-09   
ref|XP_010121095.1|  PREDICTED: 60S acidic ribosomal protein P2       58.9    4e-09   
ref|XP_011062371.1|  PREDICTED: 60S acidic ribosomal protein P2       58.9    4e-09   
ref|XP_006028665.1|  PREDICTED: 60S acidic ribosomal protein P2       58.9    4e-09   
gb|EEC83203.1|  hypothetical protein OsI_28460                        58.9    4e-09   
ref|XP_009875956.1|  PREDICTED: 60S acidic ribosomal protein P2       58.9    4e-09   
gb|KFZ48809.1|  60S acidic ribosomal protein P2                       58.5    4e-09   
gb|KFO26400.1|  60S acidic ribosomal protein P2                       59.3    4e-09   
gb|EQL00202.1|  60S acidic ribosomal protein P2                       58.5    4e-09   
ref|XP_007007055.1|  hypothetical protein TREMEDRAFT_57649            58.5    4e-09   
ref|XP_005280567.1|  PREDICTED: 60S acidic ribosomal protein P2-like  58.5    4e-09   
ref|XP_006893411.1|  PREDICTED: 60S acidic ribosomal protein P2       58.2    4e-09   
gb|KIJ20865.1|  hypothetical protein PAXINDRAFT_165698                58.5    4e-09   
ref|XP_004808604.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  59.3    4e-09   
ref|XP_011121822.1|  hypothetical protein AOL_s00078g257              58.5    4e-09   
emb|CBQ69060.1|  probable ribosomal protein P2                        58.5    4e-09   
gb|KFP66981.1|  60S acidic ribosomal protein P2                       58.5    4e-09   
gb|EHH22542.1|  Renal carcinoma antigen NY-REN-44                     58.5    4e-09   
gb|ACK77644.1|  LP06614p                                              58.9    4e-09   
ref|NP_596513.1|  60S acidic ribosomal protein P2A                    58.5    4e-09   
ref|XP_006977292.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  58.5    4e-09   
ref|XP_009898338.1|  PREDICTED: 60S acidic ribosomal protein P2       58.5    4e-09   
ref|XP_006877039.1|  PREDICTED: 60S acidic ribosomal protein P2       58.5    4e-09   
ref|XP_007648612.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  58.5    4e-09   
ref|XP_006977291.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  58.5    4e-09   
ref|NP_080296.3|  60S acidic ribosomal protein P2                     58.5    4e-09   
ref|XP_003509814.1|  PREDICTED: 60S acidic ribosomal protein P2 i...  58.5    4e-09   
ref|XP_007865193.1|  ribosomal protein 60S                            58.5    4e-09   
ref|XP_004993332.1|  60S acidic ribosomal protein P2                  58.5    4e-09   
ref|XP_007947485.1|  PREDICTED: 60S acidic ribosomal protein P2       58.5    5e-09   
ref|NP_000995.1|  60S acidic ribosomal protein P2                     58.5    5e-09   
gb|EHH30845.1|  hypothetical protein EGK_20635                        58.5    5e-09   
ref|XP_007150093.1|  hypothetical protein PHAVU_005G126000g           58.5    5e-09   
ref|XP_009702440.1|  PREDICTED: 60S acidic ribosomal protein P2       58.5    5e-09   
ref|XP_003557331.1|  PREDICTED: 60S acidic ribosomal protein P2A-...  58.5    5e-09   
pdb|4BEH|B  Chain B, Solution Structure Of Human Ribosomal Protei...  58.5    5e-09   
gb|ABJ96355.1|  60S acidic ribosomal protein P2                       58.5    5e-09   
ref|XP_004781181.1|  PREDICTED: 60S acidic ribosomal protein P2       58.5    5e-09   
gb|KGB35641.1|  60S acidic ribosomal protein P2                       58.5    5e-09   
ref|XP_004356859.1|  hypothetical protein DFA_06633                   58.9    5e-09   
ref|XP_002821384.1|  PREDICTED: 60S acidic ribosomal protein P2       58.5    5e-09   
ref|XP_010293297.1|  PREDICTED: 60S acidic ribosomal protein P2       58.5    5e-09   
gb|ERL95076.1|  hypothetical protein D910_12346                       58.9    5e-09   



>ref|XP_011077887.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Sesamum indicum]
Length=114

 Score = 85.9 bits (211),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PSADDLK+IL+SVGA+ D DRI+LLL+QV+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNASPSADDLKNILNSVGAEADDDRIELLLTQVKGKDIT  52



>ref|XP_006384635.1| 60s acidic ribosomal family protein [Populus trichocarpa]
 gb|ABK93470.1| unknown [Populus trichocarpa]
 gb|ERP62432.1| 60s acidic ribosomal family protein [Populus trichocarpa]
Length=114

 Score = 85.5 bits (210),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG  CP+A+DLKHIL SVGAD D DRI+LLLS V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTCPTAEDLKHILGSVGADADDDRIELLLSSVKGKDIT  52



>gb|ABK92597.1| unknown [Populus trichocarpa]
 gb|ABK94701.1| unknown [Populus trichocarpa]
Length=114

 Score = 85.5 bits (210),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG  CP+A+DLKHIL SVGAD D DRI+LLLS V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTCPTAEDLKHILGSVGADADDDRIELLLSSVKGKDIT  52



>ref|XP_009589318.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana tomentosiformis]
Length=112

 Score = 85.1 bits (209),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG +CP A DLK+IL SVGA+ D DRI+LLLSQVEGKDIT
Sbjct  1    MKVIAAYLLAVLGGNSCPKAKDLKNILGSVGAEADDDRIELLLSQVEGKDIT  52



>gb|EYU35434.1| hypothetical protein MIMGU_mgv1a016591mg [Erythranthe guttata]
 gb|EYU35435.1| hypothetical protein MIMGU_mgv1a016591mg [Erythranthe guttata]
Length=115

 Score = 85.1 bits (209),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PS DDLK+IL+SVGAD D D+I+LLLSQ++GKDIT
Sbjct  1    MKVIAAYLLAVLGGNASPSGDDLKNILASVGADADQDKIELLLSQIKGKDIT  52



>ref|XP_006430260.1| hypothetical protein CICLE_v10013051mg [Citrus clementina]
 gb|ESR43500.1| hypothetical protein CICLE_v10013051mg [Citrus clementina]
Length=144

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +3

Query  51   KEEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            KEEMKV+AAYLLAVLGG   PSADD+K IL SVGADC+ +R++LLLS+V+GKDIT
Sbjct  29   KEEMKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDIT  83



>gb|KCW87970.1| hypothetical protein EUGRSUZ_A00378 [Eucalyptus grandis]
Length=106

 Score = 84.0 bits (206),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG  CPSADDLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTCPSADDLKDILGSVGAEADDDRIELLLSEVKGKDIT  52



>ref|XP_010912250.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Elaeis guineensis]
 gb|AGE46033.1| 60S acidic ribosomal protein P2B [Elaeis guineensis]
Length=112

 Score = 84.0 bits (206),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG  CPSADDLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTCPSADDLKDILGSVGAEADDDRIELLLSEVKGKDIT  52



>ref|XP_009804702.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana sylvestris]
 ref|XP_009804705.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana sylvestris]
Length=112

 Score = 84.0 bits (206),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG +CP A DLK IL SVGA+ D DRI+LLLSQVEGKDIT
Sbjct  1    MKVIAAYLLAVLGGNSCPKAKDLKSILGSVGAEADDDRIELLLSQVEGKDIT  52



>ref|XP_010064997.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Eucalyptus 
grandis]
 gb|KCW87971.1| hypothetical protein EUGRSUZ_A00378 [Eucalyptus grandis]
Length=116

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG  CPSADDLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTCPSADDLKDILGSVGAEADDDRIELLLSEVKGKDIT  52



>ref|XP_011044769.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Populus euphratica]
Length=113

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG  CP+A+DLK+IL SVGAD D DRI+LLLS V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTCPTAEDLKNILGSVGADADDDRIELLLSSVKGKDIT  52



>ref|XP_002525251.1| 60S acidic ribosomal protein P2, putative [Ricinus communis]
 gb|EEF37217.1| 60S acidic ribosomal protein P2, putative [Ricinus communis]
Length=108

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLG    PSAD++K IL+SVGADCD D+I+LLLSQVEGKDIT
Sbjct  1    MKVVAAYLLAVLGVNTSPSADNIKDILNSVGADCDGDKIELLLSQVEGKDIT  52



>gb|ACI14380.1| 60S acidic ribosomal protein P2-like protein [Forsythia suspensa]
Length=115

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG ACPSADDLK ILSSVGA+ + D+I LLL+QV GKDIT
Sbjct  1    MKVIAAYLLAVLGGNACPSADDLKDILSSVGAEANDDQIGLLLTQVTGKDIT  52



>ref|XP_002313663.1| 60s acidic ribosomal family protein [Populus trichocarpa]
 gb|ABK94130.1| unknown [Populus trichocarpa]
 gb|ABK94462.1| unknown [Populus trichocarpa]
 gb|ABK95516.1| unknown [Populus trichocarpa]
 gb|ABK95879.1| unknown [Populus trichocarpa]
 gb|EEE87618.1| 60s acidic ribosomal family protein [Populus trichocarpa]
Length=113

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG  CP+A+DLK+IL SVGAD D DRI+LLLS V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTCPTAEDLKNILGSVGADADDDRIELLLSSVKGKDIT  52



>ref|XP_002283025.1| PREDICTED: 60S acidic ribosomal protein P2 [Vitis vinifera]
 emb|CBI30271.3| unnamed protein product [Vitis vinifera]
Length=114

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG  CPSA+DLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNTCPSANDLKDILGSVGAEADDDRIELLLSEVKGKDIT  52



>ref|XP_010242613.1| PREDICTED: 60S acidic ribosomal protein P2-like [Nelumbo nucifera]
Length=114

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PSADDLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNASPSADDLKDILGSVGAEADDDRIELLLSEVKGKDIT  52



>gb|KDP34714.1| hypothetical protein JCGZ_10919 [Jatropha curcas]
Length=114

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   PSA+DLK IL SVGAD D D+I LLLSQVEGKDIT
Sbjct  1    MKVIAAYLLAVLGGNTSPSAEDLKEILGSVGADADDDKIQLLLSQVEGKDIT  52



>ref|XP_007015884.1| 60S acidic ribosomal protein P2B, putative [Theobroma cacao]
 gb|EOY33503.1| 60S acidic ribosomal protein P2B, putative [Theobroma cacao]
Length=112

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG  CPSADDLK IL SVGA+ D D+I+LLLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNTCPSADDLKDILGSVGAEADDDKIELLLSEVKGKDIT  52



>gb|KJB21688.1| hypothetical protein B456_004G008900 [Gossypium raimondii]
Length=182

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  51   KEEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            K +MKV+AAYLLAVLGG A PSADDLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  66   KVKMKVVAAYLLAVLGGNASPSADDLKVILGSVGAEADDDRIELLLSEVKGKDIT  120



>ref|XP_002266030.2| PREDICTED: 60S acidic ribosomal protein P2 isoform X1 [Vitis 
vinifera]
 emb|CBI17057.3| unnamed protein product [Vitis vinifera]
Length=145

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 52/64 (81%), Gaps = 1/64 (2%)
 Frame = +3

Query  27   SHPPEEQRKE-EMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEG  203
            +  PE +R   +MKVIAAYLLAVLGG  CPSA+DLK IL SVGA+ D DRI+LLL++V+G
Sbjct  21   TQEPEGRRSHHKMKVIAAYLLAVLGGNTCPSAEDLKDILGSVGAEADDDRIELLLAEVKG  80

Query  204  KDIT  215
            KDIT
Sbjct  81   KDIT  84



>ref|XP_011088860.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Sesamum indicum]
Length=115

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSAD+LK ILSSVGA+ D DRI+LLLSQV+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTSPSADNLKDILSSVGAEADDDRIELLLSQVKGKDIT  52



>ref|XP_009800754.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Nicotiana 
sylvestris]
Length=113

 Score = 82.4 bits (202),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAA+LLAVLGG A PSA DLK IL+SVGA+ D DR+DLLLSQVEGKDIT
Sbjct  1    MKVIAAFLLAVLGGNASPSAADLKKILASVGAEADDDRVDLLLSQVEGKDIT  52



>ref|XP_011046262.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Populus euphratica]
Length=114

 Score = 82.4 bits (202),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG  CP+A+DLK+IL SVGAD D DRI+LLLS ++GKD+T
Sbjct  1    MKVVAAYLLAVLGGNTCPTAEDLKNILGSVGADADDDRIELLLSNMKGKDVT  52



>ref|XP_008788306.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Phoenix dactylifera]
Length=113

 Score = 82.0 bits (201),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG  CP+ADDLK IL SVGA+ D D+I+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTCPTADDLKDILGSVGAEADDDKIELLLSEVKGKDIT  52



>gb|KJB21689.1| hypothetical protein B456_004G009000 [Gossypium raimondii]
Length=114

 Score = 82.0 bits (201),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG A PSADDLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNASPSADDLKVILGSVGAEADDDRIELLLSEVKGKDIT  52



>ref|XP_010651712.1| PREDICTED: 60S acidic ribosomal protein P2 isoform X2 [Vitis 
vinifera]
 emb|CAN73396.1| hypothetical protein VITISV_003816 [Vitis vinifera]
 emb|CAN65595.1| hypothetical protein VITISV_030546 [Vitis vinifera]
Length=113

 Score = 81.6 bits (200),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG  CPSA+DLK IL SVGA+ D DRI+LLL++V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNTCPSAEDLKDILGSVGAEADDDRIELLLAEVKGKDIT  52



>ref|XP_006347235.1| PREDICTED: 60S acidic ribosomal protein P2 [Solanum tuberosum]
Length=113

 Score = 81.6 bits (200),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG  CPS  DLK IL+SVGA+ D DRI LLLSQV+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNTCPSEKDLKKILASVGAEADDDRIQLLLSQVKGKDIT  52



>ref|XP_007015881.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007015882.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007015883.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
 gb|EOY33500.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
 gb|EOY33501.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
 gb|EOY33502.1| 60S acidic ribosomal protein P2B, putative isoform 1 [Theobroma 
cacao]
Length=113

 Score = 81.6 bits (200),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PSADDLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNANPSADDLKDILGSVGAEADDDRIELLLSEVKGKDIT  52



>ref|XP_010244112.1| PREDICTED: 60S acidic ribosomal protein P2-like [Nelumbo nucifera]
Length=114

 Score = 81.6 bits (200),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK++AAYLLAVLGGK  PSADDLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKIVAAYLLAVLGGKIAPSADDLKDILGSVGAEADDDRIELLLSEVKGKDIT  52



>ref|XP_008783987.1| PREDICTED: 60S acidic ribosomal protein P2B-like isoform X1 [Phoenix 
dactylifera]
Length=112

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   P+ADDLK IL SVGA+ D D+I+LLLS+VEGKDIT
Sbjct  1    MKVIAAYLLAVLGGNTSPTADDLKDILGSVGAEADDDKIELLLSEVEGKDIT  52



>ref|XP_010924305.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Elaeis guineensis]
Length=114

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG A PSADDLK IL SVGA+ + +RIDLLL+QV+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNANPSADDLKSILESVGAEAEEERIDLLLTQVKGKDIT  52



>ref|XP_008349090.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Malus domestica]
Length=117

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGGK  PSA+DLK IL+SVGA+ D DRI LL S++EGKDIT
Sbjct  1    MKVIAAYLLAVLGGKNTPSANDLKDILASVGAEADDDRIQLLFSEIEGKDIT  52



>gb|KJB36388.1| hypothetical protein B456_006G156700 [Gossypium raimondii]
 gb|KJB36389.1| hypothetical protein B456_006G156700 [Gossypium raimondii]
Length=113

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG A PSADDLK+IL+SVGAD + +R+ LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNASPSADDLKNILASVGADAEEERLQLLLSEVKGKDIT  52



>ref|XP_011090363.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Sesamum indicum]
Length=115

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK++AAYLLAVLGG   PSADDLK IL SVGA+ D DRI+LLL+QV+GKDIT
Sbjct  1    MKIVAAYLLAVLGGNTSPSADDLKDILGSVGAEADEDRIELLLAQVKGKDIT  52



>emb|CDP06954.1| unnamed protein product [Coffea canephora]
Length=114

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLA+LGG  CPSA D+K IL+SVGAD D ++IDLLLSQV+GKDIT
Sbjct  1    MKVVAAYLLALLGGNTCPSAKDIKAILASVGADADDEKIDLLLSQVDGKDIT  52



>ref|XP_008227500.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Prunus mume]
Length=113

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGK  PSA DLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKTSPSAADLKDILGSVGAEADGDRIELLLSEVKGKDIT  52



>ref|XP_009777027.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Nicotiana 
sylvestris]
Length=112

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PSA DLK IL  VGA+ D DRI+LLLSQVEGKDIT
Sbjct  1    MKVIAAYLLAVLGGNASPSAKDLKSILGCVGAEADDDRIELLLSQVEGKDIT  52



>gb|KDO61085.1| hypothetical protein CISIN_1g033355mg [Citrus sinensis]
Length=121

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSADD+K IL SVGADC+ +R++LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDIT  52



>gb|EPS74099.1| hypothetical protein M569_00658, partial [Genlisea aurea]
Length=121

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +3

Query  57   EMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            +MKV+AAYLLAVLGG + P+A+DLK IL SVGAD D +RI+LLLSQV+GKDIT
Sbjct  2    DMKVVAAYLLAVLGGNSSPTAEDLKDILGSVGADADDERIELLLSQVKGKDIT  54



>ref|XP_006471373.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X1 [Citrus 
sinensis]
 ref|XP_006471374.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X2 [Citrus 
sinensis]
 ref|XP_006471375.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X3 [Citrus 
sinensis]
 ref|XP_006471376.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X4 [Citrus 
sinensis]
Length=112

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PSADDLK+IL SVGA+ D +RI+ LLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDIT  52



>ref|XP_011467330.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Fragaria vesca 
subsp. vesca]
Length=114

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLA+LGGK CP+A+D+K ILS+VGA+ D DRI LLL +V+GKDIT
Sbjct  1    MKVIAAYLLALLGGKTCPTAEDIKTILSAVGAEADEDRIQLLLMEVQGKDIT  52



>ref|XP_006481819.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Citrus sinensis]
 gb|KDO61084.1| hypothetical protein CISIN_1g033355mg [Citrus sinensis]
Length=113

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSADD+K IL SVGADC+ +R++LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTSPSADDIKGILGSVGADCEDNRLELLLSEVKGKDIT  52



>ref|XP_004241310.1| PREDICTED: 60S acidic ribosomal protein P2 [Solanum lycopersicum]
Length=112

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   PS  DLK IL+SVGA+ D DRI LLLSQVEGKDIT
Sbjct  1    MKVIAAYLLAVLGGNTSPSEKDLKKILASVGAEADDDRIQLLLSQVEGKDIT  52



>emb|CDP15388.1| unnamed protein product [Coffea canephora]
Length=116

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG  CPSA+ + +ILSSVGA+ D D+I+LLLSQV GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTCPSAEHVTNILSSVGAEADEDKIELLLSQVNGKDIT  52



>gb|KHG07914.1| 60S acidic ribosomal P2 [Gossypium arboreum]
Length=114

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSADDLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNLSPSADDLKDILGSVGAEADDDRIELLLSEVKGKDIT  52



>ref|XP_009629439.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana tomentosiformis]
Length=114

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAA+LLAVLGG A PSA DLK IL+SVGA+ D DR+DLLLSQV+GKDIT
Sbjct  1    MKVIAAFLLAVLGGNASPSAVDLKKILASVGAEADDDRVDLLLSQVKGKDIT  52



>gb|KJB55651.1| hypothetical protein B456_009G087300 [Gossypium raimondii]
Length=113

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSADDLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNLSPSADDLKDILGSVGAEADDDRIELLLSEVKGKDIT  52



>ref|XP_007205887.1| hypothetical protein PRUPE_ppa011311mg [Prunus persica]
 gb|EMJ07086.1| hypothetical protein PRUPE_ppa011311mg [Prunus persica]
Length=215

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  54   EEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            +EMKV+AAYLLAVLGGK  PSA DLK IL SVGA+ D DRI+LLLS+V+GKDIT
Sbjct  101  DEMKVVAAYLLAVLGGKTSPSAADLKDILGSVGAEADGDRIELLLSEVKGKDIT  154



>ref|NP_001275119.1| uncharacterized protein LOC102577788 [Solanum tuberosum]
 gb|ABA81865.1| unknown [Solanum tuberosum]
Length=162

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG  CPS  DLK IL+SVGA+ D DRI LLLSQV+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNTCPSEKDLKKILASVGAEADDDRIQLLLSQVDGKDIT  52



>ref|XP_006424296.1| hypothetical protein CICLE_v10029621mg [Citrus clementina]
 ref|XP_006424297.1| hypothetical protein CICLE_v10029621mg [Citrus clementina]
 gb|ESR37536.1| hypothetical protein CICLE_v10029621mg [Citrus clementina]
 gb|ESR37537.1| hypothetical protein CICLE_v10029621mg [Citrus clementina]
Length=112

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PSADDL++IL SVGA+ D +RI+ LLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNANPSADDLQNILGSVGAEADDERIEFLLSEVKGKDIT  52



>ref|XP_011094390.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Sesamum indicum]
Length=115

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG A PSA DLK ILSSVGA+ D DRI+LLL+QV+ KDIT
Sbjct  1    MKVVAAYLLAVLGGNATPSAGDLKDILSSVGAEADDDRIELLLTQVKNKDIT  52



>ref|XP_009624065.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana tomentosiformis]
Length=111

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PSA DLK IL  VGA+ D DRI LLLSQVEGKDIT
Sbjct  1    MKVIAAYLLAVLGGNASPSAKDLKSILGCVGAEADDDRIKLLLSQVEGKDIT  52



>ref|XP_002529063.1| 60S acidic ribosomal protein P2, putative [Ricinus communis]
 gb|EEF33307.1| 60S acidic ribosomal protein P2, putative [Ricinus communis]
Length=113

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK++AAYLLAVLGG   PSA+DLK IL SVG D D DRI LLLSQV+GKDIT
Sbjct  1    MKIVAAYLLAVLGGNTSPSAEDLKEILGSVGIDADEDRIGLLLSQVKGKDIT  52



>ref|XP_008355226.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Malus domestica]
 ref|XP_008355227.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Malus domestica]
Length=116

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGK+ PSA DLK IL SVGA+ D D+I+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKSSPSAADLKDILGSVGAEADGDKIELLLSEVKGKDIT  52



>ref|XP_008391761.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Malus domestica]
Length=115

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGK  P+A+DLK IL SVGA+ D DRI LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKTTPTAEDLKDILGSVGAEADDDRIQLLLSEVKGKDIT  52



>ref|XP_004228456.1| PREDICTED: 60S acidic ribosomal protein P2 [Solanum lycopersicum]
 ref|XP_006365780.1| PREDICTED: 60S acidic ribosomal protein P2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365781.1| PREDICTED: 60S acidic ribosomal protein P2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_010327199.1| PREDICTED: 60S acidic ribosomal protein P2 [Solanum lycopersicum]
Length=111

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PSA DLK+IL  VGA+ D DRI LLLSQV+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNASPSAKDLKNILGCVGAEADDDRIQLLLSQVDGKDIT  52



>gb|ABK22480.1| unknown [Picea sitchensis]
 gb|ABK23773.1| unknown [Picea sitchensis]
 gb|ABR16343.1| unknown [Picea sitchensis]
 gb|ABR18357.1| unknown [Picea sitchensis]
 gb|ACN40496.1| unknown [Picea sitchensis]
 gb|ACN40723.1| unknown [Picea sitchensis]
Length=114

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PS+DD+K IL SVG D D D+ID LLSQ+EGKDIT
Sbjct  1    MKVVAAYLLAVLGGNTSPSSDDIKSILGSVGVDSDDDKIDYLLSQLEGKDIT  52



>ref|XP_008342938.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Malus domestica]
Length=115

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGK  PSA DLK IL SVGA+ D+D+I+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKTSPSAADLKDILGSVGAEADSDKIELLLSEVKGKDIT  52



>ref|XP_007027672.1| 60S acidic ribosomal protein P2-4 [Theobroma cacao]
 gb|EOY08174.1| 60S acidic ribosomal protein P2-4 [Theobroma cacao]
Length=113

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG  CPSADDLK IL  VGA+ + DRI LLLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNTCPSADDLKDILGCVGAEVEDDRIQLLLSEVKGKDIT  52



>gb|ABA40434.1| 60s acidic ribosomal protein-like protein [Solanum tuberosum]
Length=115

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIA+YLLAVLGG   PSA DLK IL+SVGA+ D DRI+LLLSQV+GKDIT
Sbjct  1    MKVIASYLLAVLGGNTSPSAADLKKILASVGAEADDDRIELLLSQVKGKDIT  52



>ref|XP_009364278.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Pyrus x bretschneideri]
Length=116

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGK+ PSA DLK IL SVGA+ D D+I+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKSSPSAADLKDILGSVGAEADGDKIELLLSEVKGKDIT  52



>ref|XP_006349107.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Solanum tuberosum]
Length=116

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIA+YLLAVLGG   PSA DLK IL+SVGA+ D DRI+LLLSQV+GKDIT
Sbjct  1    MKVIASYLLAVLGGNTSPSAADLKKILASVGAEADDDRIELLLSQVKGKDIT  52



>ref|XP_004251036.1| PREDICTED: 60S acidic ribosomal protein P2-2 [Solanum lycopersicum]
Length=113

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIA+YLLAVLGG   PSA DLK IL+SVGA+ D DRI+LLLSQV+GKDIT
Sbjct  1    MKVIASYLLAVLGGNTSPSAADLKKILASVGAEADDDRIELLLSQVKGKDIT  52



>ref|XP_007202715.1| hypothetical protein PRUPE_ppa012794mg [Prunus persica]
 gb|EMJ03914.1| hypothetical protein PRUPE_ppa012794mg [Prunus persica]
Length=154

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  57   EMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            EMKV+AAYLLAVLGG   PSA+DLK IL SVGA+ D DRI LLLS+V+GKDIT
Sbjct  41   EMKVVAAYLLAVLGGNTTPSAEDLKDILGSVGAETDDDRIQLLLSEVKGKDIT  93



>ref|XP_008241270.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Prunus mume]
 ref|XP_008241271.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Prunus mume]
 gb|AAL91663.1| 60s acidic ribosomal protein [Prunus dulcis]
 gb|ABH03379.1| 60S acidic ribosomal protein [Prunus dulcis]
Length=113

 Score = 79.0 bits (193),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSA+DLK IL SVGA+ D DRI LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTTPSAEDLKDILGSVGAETDDDRIQLLLSEVKGKDIT  52



>ref|XP_009366640.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Pyrus x bretschneideri]
 ref|XP_009366641.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Pyrus x bretschneideri]
Length=114

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGK  P+A+D+K IL SVGA+ D DRI LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKTTPTAEDIKDILGSVGAEADDDRIQLLLSEVKGKDIT  52



>ref|XP_009613358.1| PREDICTED: 60S acidic ribosomal protein P2-like [Nicotiana tomentosiformis]
Length=114

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLA LGG   PSADDL+ IL+SVGA+ D  +I+LLLSQV+GKDIT
Sbjct  1    MKVIAAYLLAQLGGNTNPSADDLRKILNSVGAEIDESKIELLLSQVKGKDIT  52



>ref|XP_004293299.1| PREDICTED: 60S acidic ribosomal protein P2-like [Fragaria vesca 
subsp. vesca]
Length=113

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAY+LAVLGG A PSADD+K IL SVGA+ D ++I+LLLSQ++GKDIT
Sbjct  1    MKVVAAYMLAVLGGNASPSADDVKKILGSVGAEADDNKIELLLSQLKGKDIT  52



>ref|XP_009374748.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Pyrus x bretschneideri]
Length=117

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGK  P+A+D+K IL SVGA+ D DRI LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKTTPTAEDIKDILGSVGAEADDDRIQLLLSEVKGKDIT  52



>ref|XP_008797513.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Phoenix dactylifera]
Length=110

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG A PS DD+K IL SVGA+ + +RIDLLL+QV+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNADPSTDDIKTILESVGAEGEEERIDLLLTQVKGKDIT  52



>ref|XP_011462847.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Fragaria vesca 
subsp. vesca]
Length=122

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAY+LAVLGG   P+ADD+K IL SVGA+ D DRI+LLLSQ++GKDI 
Sbjct  1    MKVIAAYMLAVLGGNTSPTADDVKKILGSVGAEADNDRIELLLSQMKGKDIN  52



>gb|KDP42715.1| hypothetical protein JCGZ_23655 [Jatropha curcas]
Length=114

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG A PSADD+K ILS VGAD D D++  LLS++EGKDIT
Sbjct  1    MKVVAAYLLAVLGGNAAPSADDIKDILSCVGADVDDDKVRFLLSEIEGKDIT  52



>ref|XP_010089386.1| 60S acidic ribosomal protein P2-4 [Morus notabilis]
 gb|EXB37739.1| 60S acidic ribosomal protein P2-4 [Morus notabilis]
Length=115

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV AAYLLAVLGG A PSA D+K+IL+SVGAD D DRI LLLS++ GKDIT
Sbjct  1    MKVTAAYLLAVLGGNANPSAYDIKNILASVGADADEDRIKLLLSEIAGKDIT  52



>gb|KCW50805.1| hypothetical protein EUGRSUZ_J00465 [Eucalyptus grandis]
Length=114

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   P+ADDLK IL SVG + D D+I+LLLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNTTPTADDLKDILGSVGVEADDDKIELLLSEVKGKDIT  52



>ref|XP_010031491.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Eucalyptus 
grandis]
 gb|KCW50802.1| hypothetical protein EUGRSUZ_J00465 [Eucalyptus grandis]
 gb|KCW50803.1| hypothetical protein EUGRSUZ_J00465 [Eucalyptus grandis]
 gb|KCW50804.1| hypothetical protein EUGRSUZ_J00465 [Eucalyptus grandis]
Length=114

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   P+ADDLK IL SVG + D D+I+LLLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNTTPTADDLKDILGSVGVEADDDKIELLLSEVKGKDIT  52



>ref|XP_008360542.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Malus domestica]
 ref|XP_008360549.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Malus domestica]
Length=116

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGK+ PSA DLK IL SVGA+ D D+I+LLL +V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKSSPSAADLKDILGSVGAEADGDKIELLLXEVKGKDIT  52



>gb|KHG14059.1| 60S acidic ribosomal P2 [Gossypium arboreum]
Length=114

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAA+LLAVLGG   PSADDLK IL SVGA+ D D+I++LLS+V+GKDIT
Sbjct  1    MKVIAAFLLAVLGGNTNPSADDLKAILGSVGAEADDDKIEMLLSEVKGKDIT  52



>ref|XP_010926364.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Elaeis guineensis]
Length=115

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSADD+K IL SVGA+ + +RIDLLL+QV GKDIT
Sbjct  1    MKVVAAYLLAVLGGNVDPSADDIKAILESVGAESEEERIDLLLTQVRGKDIT  52



>gb|ABM65702.1| 60S acidic ribosomal protein P2 [Juglans regia]
Length=113

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+A+YLLAVLGG   P  DDLKHIL SVGA+ D D+I+LLLS+V+GKDIT
Sbjct  1    MKVVASYLLAVLGGNTTPCTDDLKHILGSVGAEADDDKIELLLSEVKGKDIT  52



>ref|XP_010907155.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Elaeis guineensis]
Length=112

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   P+ADDLK IL SVG + D DRI+ LLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTSPTADDLKDILGSVGIEADDDRIEFLLSEVKGKDIT  52



>ref|XP_010275438.1| PREDICTED: 60S acidic ribosomal protein P2-like [Nelumbo nucifera]
Length=114

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   PSADDLK IL SVGA+ + DR++LLLS+++GKDIT
Sbjct  1    MKVIAAYLLAVLGGNLQPSADDLKSILGSVGAEAEDDRLELLLSEIKGKDIT  52



>ref|XP_010069674.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Eucalyptus 
grandis]
Length=116

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   PSADDLK IL SVGA+ D D I LLLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNTTPSADDLKGILGSVGAEADDDGIKLLLSEVKGKDIT  52



>ref|XP_004303010.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Fragaria vesca 
subsp. vesca]
Length=114

 Score = 77.4 bits (189),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGGK  P+A+D+K IL +VGA+ D DRI LLL +V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGKTSPTAEDIKTILGAVGAEADEDRIQLLLKEVKGKDIT  52



>ref|XP_010241325.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Nelumbo nucifera]
Length=116

 Score = 77.0 bits (188),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   PSADDLK IL SVGA+ + DRI LLL++V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNLQPSADDLKTILGSVGAEAEDDRIKLLLTEVKGKDIT  52



>gb|AGE45654.1| ribosomal protein P2B [Picea wilsonii]
Length=115

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            M+V+AAYLLAVLGG + PS+DD+K IL SVGAD D ++ID LLSQ++GKDIT
Sbjct  1    MRVVAAYLLAVLGGNSKPSSDDIKSILGSVGADADDEKIDFLLSQLDGKDIT  52



>ref|XP_004150488.1| PREDICTED: 60S acidic ribosomal protein P2-4-like isoform 2 [Cucumis 
sativus]
 ref|XP_004165175.1| PREDICTED: 60S acidic ribosomal protein P2-4-like isoform 3 [Cucumis 
sativus]
 gb|KGN52200.1| hypothetical protein Csa_5G615230 [Cucumis sativus]
Length=114

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK++AAYLLAVLGG + PSA DLK IL SVGA+ D +RI+LLLS V+GKDIT
Sbjct  1    MKIVAAYLLAVLGGNSNPSAKDLKDILGSVGAEVDEERINLLLSNVKGKDIT  52



>ref|XP_004150487.1| PREDICTED: 60S acidic ribosomal protein P2-4-like isoform 1 [Cucumis 
sativus]
 ref|XP_004165174.1| PREDICTED: 60S acidic ribosomal protein P2-4-like isoform 2 [Cucumis 
sativus]
Length=128

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK++AAYLLAVLGG + PSA DLK IL SVGA+ D +RI+LLLS V+GKDIT
Sbjct  1    MKIVAAYLLAVLGGNSNPSAKDLKDILGSVGAEVDEERINLLLSNVKGKDIT  52



>gb|KJB16640.1| hypothetical protein B456_002G241200 [Gossypium raimondii]
Length=113

 Score = 76.6 bits (187),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSADDLK IL SVGA+ + +R+ LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTSPSADDLKAILGSVGAEAEDERVQLLLSEVKGKDIT  52



>sp|P41099.1|RLA2_PARAR RecName: Full=60S acidic ribosomal protein P2 [Parthenium argentatum]
 emb|CAA55047.1| 60s acidic ribosomal protein P2 [Parthenium argentatum]
Length=114

 Score = 76.3 bits (186),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAA+LLA+LGG   P+ +DLK IL+SVGAD D D+I+LLLSQV+GKDIT
Sbjct  1    MKVIAAFLLALLGGNTSPTDEDLKSILASVGADADDDKIELLLSQVKGKDIT  52



>ref|XP_008351356.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P2B-like [Malus domestica]
Length=116

 Score = 76.3 bits (186),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 1/53 (2%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPS-ADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGKA PS A DLK IL SVGA+ D+D+I+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKASPSLAADLKDILGSVGAEADSDKIELLLSEVKGKDIT  53



>emb|CDP13859.1| unnamed protein product [Coffea canephora]
Length=113

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+ AYLLA+LGG  CPS  D+K IL+SVGAD D ++IDLLLSQV+GKDI
Sbjct  1    MKVVTAYLLALLGGNTCPSTKDIKAILASVGADVDDEKIDLLLSQVDGKDI  51



>ref|XP_008348607.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P2-2-like [Malus domestica]
Length=116

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (87%), Gaps = 1/53 (2%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSAD-DLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGKA PSA  DLK IL SVGA+ D D+I+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKASPSAAADLKDILGSVGAEADXDKIELLLSEVKGKDIT  53



>gb|EYU35149.1| hypothetical protein MIMGU_mgv1a016659mg [Erythranthe guttata]
Length=112

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   PSA+DLKHILSSVGA+ D D I LLL+QV+ KDIT
Sbjct  1    MKIIAAYLLAVLGGNPSPSAEDLKHILSSVGAEADDDMIALLLAQVKDKDIT  52



>ref|XP_004145795.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Cucumis sativus]
 ref|XP_004160090.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Cucumis sativus]
 gb|KGN46936.1| hypothetical protein Csa_6G151730 [Cucumis sativus]
Length=115

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   P ADD+K IL+SVGA+ D +RI LLL++V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTSPGADDVKSILNSVGAEIDEERITLLLAEVKGKDIT  52



>ref|XP_008446770.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Cucumis melo]
Length=114

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK++AAYLLAVLGG   PSA DLK IL SVGA+ D +RI+LLLS V+GKD+T
Sbjct  1    MKIVAAYLLAVLGGNTSPSAKDLKDILGSVGAEIDEERIELLLSNVKGKDVT  52



>gb|EPS73855.1| hypothetical protein M569_00918, partial [Genlisea aurea]
Length=120

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +3

Query  57   EMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            +MKV+AAYLLAVLGG   PS +DLK IL SVGA+   DRI+LLLSQV+GKDIT
Sbjct  2    KMKVVAAYLLAVLGGNNSPSTEDLKDILGSVGAEAADDRIELLLSQVKGKDIT  54



>ref|XP_007162878.1| hypothetical protein PHAVU_001G1882000g, partial [Phaseolus vulgaris]
 gb|ESW34872.1| hypothetical protein PHAVU_001G1882000g, partial [Phaseolus vulgaris]
Length=176

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 2/60 (3%)
 Frame = +3

Query  36   PEEQRKEEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            P  +RK  MKVIAAYLLAVLGG A PSADDL+ IL SVGAD + D I   LS+V+GKDIT
Sbjct  66   PAFRRK--MKVIAAYLLAVLGGNAAPSADDLRLILGSVGADANDDNISNFLSEVKGKDIT  123



>gb|AAS20966.1| 60s acidic ribosomal protein [Hyacinthus orientalis]
Length=114

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSA+ +K IL SVGAD + DRI+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTTPSAEVIKDILGSVGADAEDDRIELLLSEVKGKDIT  52



>ref|XP_010520675.1| PREDICTED: 60S acidic ribosomal protein P2-4-like, partial [Tarenaya 
hassleriana]
Length=74

 Score = 74.3 bits (181),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAA+LLAVLGGKA PSA D+K IL SVGA+ D + I+LLL +V GKDIT
Sbjct  1    MKVIAAFLLAVLGGKASPSAADIKDILGSVGAEVDEESIELLLKEVSGKDIT  52



>gb|ABK24939.1| unknown [Picea sitchensis]
 gb|ACN40890.1| unknown [Picea sitchensis]
Length=115

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            M+V+AAYLLAVLGG + PS++D+K IL SVGAD D ++ID LLSQ++GKDIT
Sbjct  1    MRVVAAYLLAVLGGNSKPSSEDIKSILGSVGADADDEKIDFLLSQLDGKDIT  52



>ref|XP_009618588.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana tomentosiformis]
Length=112

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKVIAAYLL  LGG A P+A+DLK ILSSVGA+ D ++I+LLLSQV+GKD+
Sbjct  1    MKVIAAYLLGALGGNASPTAEDLKAILSSVGAEADNEKIELLLSQVKGKDL  51



>gb|KJB06823.1| hypothetical protein B456_001G120800 [Gossypium raimondii]
Length=116

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAA+LLAVLGG   PSADDLK IL SV A+ D D+I++LLS+V+GKDIT
Sbjct  1    MKVIAAFLLAVLGGNTNPSADDLKAILGSVAAEADDDKIEMLLSEVKGKDIT  52



>ref|XP_009784712.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Nicotiana sylvestris]
Length=111

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLA LGG A P A++LK ILSSVGA+ D ++++LLLSQV+GKD+T
Sbjct  1    MKVIAAYLLAALGGNASPMAEELKAILSSVGAEADNEKMELLLSQVKGKDLT  52



>gb|KHN02245.1| 60S acidic ribosomal protein P2 [Glycine soja]
Length=64

 Score = 73.9 bits (180),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PSADDL+ IL SVGAD + D I   LS+V+GKDI 
Sbjct  1    MKVIAAYLLAVLGGNAAPSADDLRTILGSVGADANDDNISNFLSEVKGKDIV  52



>gb|AFK46271.1| unknown [Lotus japonicus]
Length=115

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKVIAAYLLAVLGG   PSADDLK ILSSVGAD D +++  LLS+V+GKD+
Sbjct  1    MKVIAAYLLAVLGGNTAPSADDLKSILSSVGADADDEKLSFLLSEVKGKDL  51



>emb|CDP21644.1| unnamed protein product [Coffea canephora]
Length=113

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+ AYLLA+LGG   PSA D+K IL+SVGAD D ++ID+LLSQV+GKDIT
Sbjct  1    MKVVTAYLLALLGGNTYPSAKDIKAILASVGADVDDEKIDVLLSQVDGKDIT  52



>ref|XP_006858566.1| hypothetical protein AMTR_s00071p00177850 [Amborella trichopoda]
 gb|ERN20033.1| hypothetical protein AMTR_s00071p00177850 [Amborella trichopoda]
Length=118

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +A+YLLAVLGG A PS DD+K IL SVGAD D +RI+ LLS+V+GKDIT
Sbjct  1    MKYVASYLLAVLGGNAQPSVDDIKKILGSVGADADEERIEYLLSEVKGKDIT  52



>ref|XP_009394805.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Musa acuminata 
subsp. malaccensis]
Length=114

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG + PSA D+  IL SVGA+ D  RI+L LS+VEGKDIT
Sbjct  1    MKVIAAYLLAVLGGNSHPSAGDITSILESVGAEVDVKRINLFLSEVEGKDIT  52



>ref|NP_001055683.1| Os05g0445500 [Oryza sativa Japonica Group]
 gb|AAU44278.1| putative 60S acidic ribosomal protein [Oryza sativa Japonica 
Group]
 dbj|BAF17597.1| Os05g0445500 [Oryza sativa Japonica Group]
 dbj|BAH00501.1| unnamed protein product [Oryza sativa Japonica Group]
Length=113

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   PSADD+K+IL SVG + + +R++ LLS++EGKDIT
Sbjct  1    MKLIAAYLLAVLGGNTSPSADDIKNILESVGVEANDERLEFLLSELEGKDIT  52



>ref|XP_006419121.1| hypothetical protein EUTSA_v10002732mg [Eutrema salsugineum]
 gb|ESQ37557.1| hypothetical protein EUTSA_v10002732mg [Eutrema salsugineum]
Length=112

 Score = 74.7 bits (182),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AA+LLAVLGG A PSAD++K I+ +VGAD D + IDLLL +V GKDIT
Sbjct  1    MKVVAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIDLLLKEVSGKDIT  52



>ref|XP_008361098.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P2B-like [Malus domestica]
Length=116

 Score = 74.7 bits (182),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPS-ADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGGK  PS A DLK IL SVGA+ D D+I+LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGKTSPSLAADLKDILGSVGAEADXDKIELLLSEVKGKDIT  53



>ref|XP_006654480.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Oryza brachyantha]
Length=113

 Score = 74.3 bits (181),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   PSADD+K+IL SVG + + +R++ L+S++EGKDIT
Sbjct  1    MKLIAAYLLAVLGGNTSPSADDVKNILESVGVEANEERLEFLISELEGKDIT  52



>gb|KHN25194.1| 60S acidic ribosomal protein P2B [Glycine soja]
Length=88

 Score = 73.6 bits (179),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSADD+K IL SVG + D DRI+  LS+V+GKDI 
Sbjct  1    MKVVAAYLLAVLGGNNTPSADDIKEILGSVGIEADEDRIESFLSEVKGKDIV  52



>gb|EEC79308.1| hypothetical protein OsI_20141 [Oryza sativa Indica Group]
Length=188

 Score = 75.5 bits (184),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   PSADD+K+IL SVG + + +R++ LLS++EGKDIT
Sbjct  76   MKLIAAYLLAVLGGNTSPSADDIKNILESVGVEANDERLEFLLSELEGKDIT  127



>ref|XP_002264645.1| PREDICTED: 60S acidic ribosomal protein P2 [Vitis vinifera]
 emb|CBI40248.3| unnamed protein product [Vitis vinifera]
Length=115

 Score = 73.9 bits (180),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLA LGG   P ADDLK IL SVGA+ D D I+LLLS+V+GKDIT
Sbjct  1    MKVIAAYLLAALGGNGSPCADDLKSILGSVGAEADDDGIELLLSEVKGKDIT  52



>ref|XP_008801232.1| PREDICTED: 60S acidic ribosomal protein P2-like [Phoenix dactylifera]
 ref|XP_008779283.1| PREDICTED: 60S acidic ribosomal protein P2-like [Phoenix dactylifera]
Length=115

 Score = 73.9 bits (180),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   PS+DDLK IL SVG +   DRI+ LLS+V+GKDIT
Sbjct  1    MKVIAAYLLAVLGGNNNPSSDDLKDILGSVGVEAGDDRIEFLLSEVKGKDIT  52



>ref|XP_010093218.1| 60S acidic ribosomal protein P2B [Morus notabilis]
 gb|EXB53716.1| 60S acidic ribosomal protein P2B [Morus notabilis]
Length=116

 Score = 73.9 bits (180),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   PSA DLK ILSSVG + D  RI LLL++V+GKDIT
Sbjct  1    MKIIAAYLLAVLGGNTSPSAGDLKDILSSVGVEPDEGRIQLLLTEVKGKDIT  52



>ref|XP_008358569.1| PREDICTED: serpin-ZX-like [Malus domestica]
Length=498

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/52 (77%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV AAYLLAVLGGK  PSA+DLK IL SVGA+ D DRI LLLS+VE KDIT
Sbjct  1    MKVEAAYLLAVLGGKTSPSAEDLKDILGSVGAEADDDRIQLLLSEVESKDIT  52



>ref|XP_009410961.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Musa acuminata 
subsp. malaccensis]
Length=115

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   PSADD+K IL SVGA+ D  RID LLS+ +GKD+T
Sbjct  1    MKVIAAYLLAVLGGNTQPSADDIKCILESVGAEVDDGRIDFLLSEAKGKDVT  52



>ref|XP_003521450.1| PREDICTED: 60S acidic ribosomal protein P2-1-like isoform 1 [Glycine 
max]
Length=113

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG A PSADDL+ IL SVGAD + D I   LS+V+GKDI 
Sbjct  1    MKVIAAYLLAVLGGNAAPSADDLRDILGSVGADANDDNISNFLSEVKGKDIV  52



>ref|XP_006358327.1| PREDICTED: 60S acidic ribosomal protein P2-like [Solanum tuberosum]
Length=118

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLA LGG + PS++DLK IL+SVGA+ D  +I+LLLSQVEGKDI 
Sbjct  1    MKVIAAYLLAQLGGNSNPSSNDLKKILNSVGAEIDDVKIELLLSQVEGKDIN  52



>ref|XP_004490304.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Cicer arietinum]
Length=114

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MK+IAAYLLAVLGGKA P++DD+KHIL+SVG + + ++I+LLL +V+GKD 
Sbjct  1    MKIIAAYLLAVLGGKAAPTSDDIKHILTSVGIEAEDEKIELLLGEVKGKDF  51



>ref|XP_003554422.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Glycine max]
Length=113

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKVIAAYLLAVLGG A PSADDL+ IL SVGAD + D I   LS+V+GKDI
Sbjct  1    MKVIAAYLLAVLGGNAAPSADDLRTILGSVGADANDDNISNFLSEVKGKDI  51



>ref|XP_004297919.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Fragaria vesca 
subsp. vesca]
Length=122

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAY+LAVLGG   P+ADD+K IL SVGA+ D DRI+LLLSQ++ K+I 
Sbjct  1    MKVIAAYMLAVLGGNTSPTADDVKKILGSVGAEVDNDRIELLLSQMKDKEIN  52



>ref|XP_004243028.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Solanum lycopersicum]
Length=112

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYL+A LGG + PSA+DLK IL+SVGA+ D  +I+LLLSQVEG+DI 
Sbjct  1    MKVIAAYLMAQLGGNSNPSANDLKKILNSVGAEIDDVKIELLLSQVEGRDIN  52



>ref|XP_002950613.1| hypothetical protein VOLCADRAFT_120883 [Volvox carteri f. nagariensis]
 gb|EFJ48359.1| hypothetical protein VOLCADRAFT_120883 [Volvox carteri f. nagariensis]
Length=115

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            M+V++AYLLAVLGGKA P+ADD+  ILSSVG + DAD+++ L+S++EGKD+
Sbjct  1    MRVVSAYLLAVLGGKASPTADDINKILSSVGVEADADKVNKLISELEGKDL  51



>ref|NP_001236459.1| uncharacterized protein LOC100500331 [Glycine max]
 ref|XP_006588397.1| PREDICTED: uncharacterized protein LOC100500331 isoform X1 [Glycine 
max]
 gb|ACU15383.1| unknown [Glycine max]
Length=114

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSADD+K IL SVG + D DRI+  LS+V+GKDI 
Sbjct  1    MKVVAAYLLAVLGGNNTPSADDIKEILGSVGIEADEDRIESFLSEVKGKDIV  52



>ref|XP_008458601.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Cucumis melo]
Length=115

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   P  DD+K IL+SVG + D +RI LLLS+V+GKD+T
Sbjct  1    MKVVAAYLLAVLGGNTSPGVDDVKAILNSVGVEIDEERITLLLSEVKGKDVT  52



>ref|XP_009394231.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Musa acuminata 
subsp. malaccensis]
Length=112

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKVIAAYLLAVLGG   PSA DLK IL SVGA+ D  R+DL LS+V+GKD+
Sbjct  1    MKVIAAYLLAVLGGNTRPSAGDLKSILESVGAEVDEKRVDLFLSEVKGKDL  51



>ref|XP_002967170.1| hypothetical protein SELMODRAFT_28094, partial [Selaginella moellendorffii]
 gb|EFJ31769.1| hypothetical protein SELMODRAFT_28094, partial [Selaginella moellendorffii]
Length=69

 Score = 71.6 bits (174),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG  CPS+DD+K ILSSVGA+ D  ++  L+S++EGKDI 
Sbjct  1    MKLIAAYLLAVLGGNECPSSDDIKGILSSVGAEADETKLSHLMSELEGKDIV  52



>ref|XP_006343627.1| PREDICTED: 60S acidic ribosomal protein P2-like [Solanum tuberosum]
Length=112

 Score = 72.4 bits (176),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKVIA YLLAVLGG   P+A+DLK ILSSVGA+ D  +I+LLLSQV+G+D+
Sbjct  1    MKVIATYLLAVLGGNTNPTAEDLKAILSSVGAEADDTKIELLLSQVKGRDL  51



>ref|XP_010231320.1| PREDICTED: 60S acidic ribosomal protein P2B [Brachypodium distachyon]
Length=113

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLA LGG +CP+ADD+K+IL SVGA+ D D+++ LL++++ KDIT
Sbjct  1    MKLIAAYLLAYLGGNSCPTADDIKNILESVGAEADEDKLEFLLAELKDKDIT  52



>gb|AAT08664.1| acidic ribosomal protein [Hyacinthus orientalis]
Length=114

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSA+ +K IL SVGA+ + DRI LLLS+V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNTTPSAEVIKDILGSVGAEAEDDRILLLLSEVKGKDIT  52



>ref|XP_010541287.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Tarenaya hassleriana]
 ref|XP_010541288.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Tarenaya hassleriana]
Length=112

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK IAA+LLAVLGGKA PSA D+K IL SVGA+ D + I+LLL +V GKDIT
Sbjct  1    MKAIAAFLLAVLGGKASPSARDIKDILGSVGAEVDEESIELLLKEVSGKDIT  52



>ref|XP_002439881.1| hypothetical protein SORBIDRAFT_09g021900 [Sorghum bicolor]
 gb|EES18311.1| hypothetical protein SORBIDRAFT_09g021900 [Sorghum bicolor]
Length=112

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   P+ADD+K+IL SVGA+ D ++++ LL++++ KDIT
Sbjct  1    MKVIAAYLLAVLGGNTSPTADDVKNILESVGAEADEEKLEFLLTELKDKDIT  52



>gb|KHN27663.1| 60S acidic ribosomal protein P2B [Glycine soja]
Length=111

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSADD+KHIL +VGA+ + + I+LLL++V+GKD  
Sbjct  1    MKVVAAYLLAVLGGNPSPSADDIKHILGAVGAEAENELIELLLTEVKGKDFN  52



>ref|XP_004297921.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Fragaria vesca 
subsp. vesca]
Length=122

 Score = 72.0 bits (175),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAY+LA+LGG   P+A D+K IL SVGA+ D DRI+LLLSQ++ KDI 
Sbjct  1    MKVIAAYMLAILGGNTSPTAGDVKKILGSVGAEADNDRIELLLSQMKYKDIN  52



>ref|XP_008462549.1| PREDICTED: 60S acidic ribosomal protein P2-like isoform X1 [Cucumis 
melo]
Length=118

 Score = 72.0 bits (175),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSA D+  IL SVGA+ D ++I+LLL++V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNKTPSAQDINTILYSVGAEADVEKIELLLAEVKGKDIT  52



>ref|XP_008462550.1| PREDICTED: 60S acidic ribosomal protein P2-like isoform X2 [Cucumis 
melo]
Length=115

 Score = 71.6 bits (174),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSA D+  IL SVGA+ D ++I+LLL++V+GKDIT
Sbjct  1    MKVVAAYLLAVLGGNKTPSAQDINTILYSVGAEADVEKIELLLAEVKGKDIT  52



>ref|XP_002960843.1| hypothetical protein SELMODRAFT_139397 [Selaginella moellendorffii]
 gb|EFJ38382.1| hypothetical protein SELMODRAFT_139397 [Selaginella moellendorffii]
Length=113

 Score = 71.2 bits (173),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG  CPS+DD+K ILSSVGA+ D  ++  L+S++EGKDI 
Sbjct  1    MKLIAAYLLAVLGGNECPSSDDIKGILSSVGAEADETKLSHLMSELEGKDIV  52



>emb|CAN72528.1| hypothetical protein VITISV_013399 [Vitis vinifera]
Length=111

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLL VLGG   P ADDLK IL SVGA+ D D I+LLLS+V+GKDI 
Sbjct  1    MKVMAAYLLVVLGGNVSPCADDLKSILGSVGAEVDDDGIELLLSEVKGKDII  52



>ref|XP_004167615.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P2B-like [Cucumis sativus]
Length=115

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSA D+  ILSSVGA+ + ++I+LL+++++GKDIT
Sbjct  1    MKVVAAYLLAVLGGNKTPSAQDINTILSSVGAEAEVEKIELLIAELKGKDIT  52



>emb|CDP13301.1| unnamed protein product [Coffea canephora]
Length=106

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+ AYLLA+L G  CPSA D+K I++SVGAD D ++I +LLSQV+GKDIT
Sbjct  1    MKVVTAYLLALLEGNTCPSAKDIKAIIASVGADVDDEKIYVLLSQVDGKDIT  52



>ref|XP_007261576.1| ribosomal protein 60S [Fomitiporia mediterranea MF3/22]
 gb|EJD07624.1| ribosomal protein 60S [Fomitiporia mediterranea MF3/22]
Length=112

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            M+ IAAYLL  +GGK+ PS DD+KH+L SVGAD D DR+  LLS++EGKDI
Sbjct  1    MRYIAAYLLLQIGGKSSPSTDDIKHVLGSVGADVDDDRLSKLLSELEGKDI  51



>ref|NP_001132823.1| uncharacterized protein LOC100194313 [Zea mays]
 ref|XP_008654443.1| PREDICTED: uncharacterized protein LOC100194313 isoform X1 [Zea 
mays]
 gb|ACF81831.1| unknown [Zea mays]
 gb|ACG24896.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACG33360.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|AFW81222.1| acidic ribosomal protein P2a-4 isoform 1 [Zea mays]
 gb|AFW81223.1| acidic ribosomal protein P2a-4 isoform 2 [Zea mays]
 gb|AFW81224.1| acidic ribosomal protein P2a-4 isoform 3 [Zea mays]
 gb|AFW81225.1| acidic ribosomal protein P2a-4 isoform 4 [Zea mays]
Length=112

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVL G A PSA+DL  IL SVG + D +R++LLLSQ+ GKDIT
Sbjct  1    MKVVAAYLLAVLAGNASPSAEDLTGILESVGCEVDNERMELLLSQLSGKDIT  52



>gb|AFW81220.1| acidic ribosomal protein P2a-4 [Zea mays]
Length=120

 Score = 70.9 bits (172),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVL G A PSA+DL  IL SVG + D +R++LLLSQ+ GKDIT
Sbjct  9    MKVVAAYLLAVLAGNASPSAEDLTGILESVGCEVDNERMELLLSQLSGKDIT  60



>gb|EEE63896.1| hypothetical protein OsJ_18721 [Oryza sativa Japonica Group]
Length=308

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   PSADD+K+IL SVG + + +R++ LLS++EGKDIT
Sbjct  85   MKLIAAYLLAVLGGNTSPSADDIKNILESVGVEANDERLEFLLSELEGKDIT  136


 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   PSADD+K+IL SVG + + +R++ LLS++EGKDIT
Sbjct  196  MKLIAAYLLAVLGGNTSPSADDIKNILESVGVEANDERLEFLLSELEGKDIT  247



>ref|XP_010683782.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Beta vulgaris 
subsp. vulgaris]
Length=111

 Score = 70.5 bits (171),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLA LGG A PSA DLK I ++VG + D  RI+L +SQV+GKDIT
Sbjct  1    MKVVAAYLLACLGGNANPSASDLKSIFNAVGIEADDKRIELFMSQVKGKDIT  52



>gb|AFW81221.1| hypothetical protein ZEAMMB73_796524, partial [Zea mays]
Length=317

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVL G A PSA+DL  IL SVG + D +R++LLLSQ+ GKDIT
Sbjct  9    MKVVAAYLLAVLAGNASPSAEDLTGILESVGCEVDNERMELLLSQLSGKDIT  60



>gb|ABD74514.1| ribosomal protein, partial [Pteris vittata]
Length=127

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  51   KEEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            + +MKV+AAYLLA+LGGKA PS DD++ IL SVGA+ D D++DL   ++ GKD+ 
Sbjct  7    RTKMKVVAAYLLALLGGKAAPSPDDIRSILGSVGAEADDDKLDLFFKELAGKDVN  61



>ref|XP_004961921.1| PREDICTED: 60S acidic ribosomal protein P2B-like isoform X2 [Setaria 
italica]
Length=112

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   P+ADD+K IL SVGA+ D +++D LL++++ KDIT
Sbjct  1    MKMIAAYLLAVLGGNTSPTADDVKSILESVGAETDEEKLDFLLTELKDKDIT  52



>gb|ACJ86110.1| unknown [Medicago truncatula]
 gb|AFK38581.1| unknown [Medicago truncatula]
 gb|KEH16333.1| 60S acidic ribosomal protein [Medicago truncatula]
Length=113

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MK+IAAY+LAVLGG + PSADD+K ILSSVG + +   I+LLLS+V+GKD 
Sbjct  1    MKIIAAYMLAVLGGNSAPSADDIKTILSSVGVEAEDSNIELLLSEVKGKDF  51



>ref|NP_001235654.1| uncharacterized protein LOC100499761 [Glycine max]
 gb|ACU13532.1| unknown [Glycine max]
Length=114

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSAD +K IL SVG + D DRI+  LS+V+GKDI 
Sbjct  1    MKVVAAYLLAVLGGNNSPSADVIKEILGSVGVEADEDRIESFLSEVKGKDIV  52



>gb|AFK45307.1| unknown [Medicago truncatula]
Length=113

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MK+IAAY+LAVLGG + PSADD+K ILSSVG + +   I+LLLS+V+GKD 
Sbjct  1    MKIIAAYMLAVLGGNSAPSADDIKTILSSVGVEAEDSNIELLLSEVKGKDF  51



>gb|KHN21444.1| 60S acidic ribosomal protein P2B [Glycine soja]
Length=92

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSADD+K+IL +VGA+ + + I+LLL++V+GKD  
Sbjct  1    MKVVAAYLLAVLGGNPSPSADDIKNILGAVGAEAEHELIELLLTEVKGKDFN  52



>ref|XP_003543439.2| PREDICTED: 60S acidic ribosomal protein P2B-like [Glycine max]
Length=149

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 49/67 (73%), Gaps = 7/67 (10%)
 Frame = +3

Query  36   PEEQRKE-------EMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQ  194
            P+ Q+K        +MKV+AAYLLAVLGG   PSADD+K+IL +VGA+ + + I+LLL++
Sbjct  21   PKSQKKRNRNRNLADMKVVAAYLLAVLGGNPSPSADDIKNILGAVGAEAEHELIELLLTE  80

Query  195  VEGKDIT  215
            V+GKD  
Sbjct  81   VKGKDFN  87



>ref|XP_004295494.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Fragaria vesca 
subsp. vesca]
Length=109

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKVIAAYLLA LGG   PSADDLK I  +VGA+ D DR++L  SQV+GK+I
Sbjct  1    MKVIAAYLLARLGGNTDPSADDLKRICGAVGAEIDGDRLELFFSQVDGKNI  51



>gb|AFW81770.1| 60S acidic ribosomal protein P2B [Zea mays]
Length=136

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   P+ADD+K IL SVGA+ D ++++ LL++++ KDIT
Sbjct  24   MKVIAAYLLAVLGGNTSPTADDVKSILESVGAEADEEKLEFLLTELKDKDIT  75



>ref|XP_004297978.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Fragaria vesca 
subsp. vesca]
Length=110

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAY+LA LGG   PSADDLK IL +VGA+ D  RI+L LS+V GK+I
Sbjct  1    MKVLAAYMLARLGGNTNPSADDLKRILGAVGAEIDGHRIELFLSKVNGKNI  51



>ref|XP_008655428.1| PREDICTED: acidic ribosomal protein P2a-2 isoform X2 [Zea mays]
 ref|XP_008655429.1| PREDICTED: acidic ribosomal protein P2a-2 isoform X2 [Zea mays]
 gb|ACR38037.1| unknown [Zea mays]
 gb|AFW81214.1| hypothetical protein ZEAMMB73_006495 [Zea mays]
Length=131

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G A PSA+DL  IL SVG + D +R++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNASPSAEDLTAILESVGCEVDNERMELLLSQLSGKDIT  52



>ref|NP_001105390.1| 60S acidic ribosomal protein P2B [Zea mays]
 ref|XP_008655432.1| PREDICTED: 60S acidic ribosomal protein P2B isoform X1 [Zea mays]
 sp|O24415.1|RLA2B_MAIZE RecName: Full=60S acidic ribosomal protein P2B [Zea mays]
 gb|AAB71080.1| acidic ribosomal protein P2b [Zea mays]
 gb|ACF80071.1| unknown [Zea mays]
 gb|ACG35973.1| 60S acidic ribosomal protein P2B [Zea mays]
 gb|ACG37482.1| 60S acidic ribosomal protein P2B [Zea mays]
 gb|AFW81766.1| 60S acidic ribosomal protein P2B isoform 1 [Zea mays]
 gb|AFW81767.1| 60S acidic ribosomal protein P2B isoform 2 [Zea mays]
Length=113

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   P+ADD+K IL SVGA+ D ++++ LL++++ KDIT
Sbjct  1    MKVIAAYLLAVLGGNTSPTADDVKSILESVGAEADEEKLEFLLTELKDKDIT  52



>ref|NP_001105388.1| acidic ribosomal protein P2a-2 [Zea mays]
 ref|XP_008655430.1| PREDICTED: acidic ribosomal protein P2a-2 isoform X1 [Zea mays]
 gb|AAD11459.1| acidic ribosomal protein P2a-2 [Zea mays]
 gb|ACG37632.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACG39438.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACL52769.1| unknown [Zea mays]
 gb|ACN27443.1| unknown [Zea mays]
 gb|AFW81212.1| 60S acidic ribosomal protein P2AAcidic ribosomal protein P2a-2 
isoform 1 [Zea mays]
 gb|AFW81213.1| 60S acidic ribosomal protein P2AAcidic ribosomal protein P2a-2 
isoform 2 [Zea mays]
Length=112

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G A PSA+DL  IL SVG + D +R++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNASPSAEDLTAILESVGCEVDNERMELLLSQLSGKDIT  52



>ref|XP_007145332.1| hypothetical protein PHAVU_007G230200g [Phaseolus vulgaris]
 gb|ESW17326.1| hypothetical protein PHAVU_007G230200g [Phaseolus vulgaris]
Length=114

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSA  +K IL SVGA+ D DRI+L LS+V+GKDI 
Sbjct  1    MKVVAAYLLAVLGGNQSPSAAVIKDILGSVGAEADDDRIELFLSEVKGKDIV  52



>ref|NP_001236220.1| uncharacterized protein LOC100306264 [Glycine max]
 gb|ACU14365.1| unknown [Glycine max]
Length=111

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAVLGG   PSAD +KHIL +VGA+ + + I+LLL++V+GKD  
Sbjct  1    MKVVAAYLLAVLGGNPSPSADGIKHILGAVGAEAENELIELLLTEVKGKDFN  52



>ref|NP_001105377.1| 60S acidic ribosomal protein P2A precursor [Zea mays]
 gb|AAC49360.1| acidic ribosomal protein P2 [Zea mays]
Length=112

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G A PSADDL  IL SVG + D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNASPSADDLTAILESVGCEVDNEKMELLLSQLSGKDIT  52



>sp|P46252.3|RLA2A_MAIZE RecName: Full=60S acidic ribosomal protein P2A; Short=P2 [Zea 
mays]
 emb|CAA60251.1| 60S acidic ribosomal protein [Zea mays]
 gb|ACG24651.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACG27449.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACG36965.1| 60S acidic ribosomal protein P2A [Zea mays]
Length=112

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G A PSADDL  IL SVG + D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNASPSADDLTAILESVGCEVDNEKMELLLSQLSGKDIT  52



>ref|XP_008655427.1| PREDICTED: 60S acidic ribosomal protein P2A isoform X1 [Zea mays]
 gb|ACR34136.1| unknown [Zea mays]
 gb|AFW81215.1| acidic ribosomal protein P2a isoform 1 [Zea mays]
 gb|AFW81216.1| acidic ribosomal protein P2a isoform 2 [Zea mays]
 gb|AFW81217.1| acidic ribosomal protein P2a isoform 3 [Zea mays]
Length=112

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G A PSADDL  IL SVG + D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNASPSADDLTAILESVGCEVDNEKMELLLSQLSGKDIT  52



>ref|XP_001694856.1| acidic ribosomal protein P2 [Chlamydomonas reinhardtii]
 gb|EDP02008.1| acidic ribosomal protein P2 [Chlamydomonas reinhardtii]
Length=109

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            M+V++AYLLAVLGGKA P+ADD+  ILSSVG + +A++++ L+S++EGK++
Sbjct  1    MRVVSAYLLAVLGGKANPTADDVNKILSSVGVEAEAEKVNKLISELEGKNL  51



>ref|XP_004961920.1| PREDICTED: 60S acidic ribosomal protein P2B-like isoform X1 [Setaria 
italica]
Length=128

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   P+ADD+K IL SVGA+ D +++D LL++++ KDIT
Sbjct  1    MKMIAAYLLAVLGGNTSPTADDVKSILESVGAETDEEKLDFLLTELKDKDIT  52



>ref|NP_190045.1| 60S acidic ribosomal protein P2-4 [Arabidopsis thaliana]
 ref|NP_974384.1| 60S acidic ribosomal protein P2-4 [Arabidopsis thaliana]
 sp|Q9LXM8.1|RLA24_ARATH RecName: Full=60S acidic ribosomal protein P2-4 [Arabidopsis 
thaliana]
 emb|CAB88541.1| acidic ribosomal protein P2-like [Arabidopsis thaliana]
 gb|AAO44014.1| At3g44590 [Arabidopsis thaliana]
 dbj|BAF00290.1| acidic ribosomal protein P2 -like [Arabidopsis thaliana]
 gb|AEE77918.1| 60S acidic ribosomal protein P2-4 [Arabidopsis thaliana]
 gb|AEE77919.1| 60S acidic ribosomal protein P2-4 [Arabidopsis thaliana]
Length=111

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV AA+LLAVLGG A PSAD++K I+ +VGAD D + I+LLL +V GKDI 
Sbjct  1    MKVAAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIELLLKEVSGKDIA  52



>ref|XP_002441563.1| hypothetical protein SORBIDRAFT_09g029390 [Sorghum bicolor]
 gb|EES19993.1| hypothetical protein SORBIDRAFT_09g029390 [Sorghum bicolor]
Length=112

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK IAAYLLAVL G + PSA+DL  IL SVG + D +R++LLLSQ+ GKDIT
Sbjct  1    MKFIAAYLLAVLAGNSSPSAEDLTAILESVGCEVDNERMELLLSQLSGKDIT  52



>gb|KJB06824.1| hypothetical protein B456_001G120800 [Gossypium raimondii]
Length=114

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 43/52 (83%), Gaps = 2/52 (4%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAA+LLAVLGG   PSADDLK IL S  A+ D D+I++LLS+V+GKDIT
Sbjct  1    MKVIAAFLLAVLGGNTNPSADDLKAILGS--AEADDDKIEMLLSEVKGKDIT  50



>ref|XP_008655431.1| PREDICTED: 60S acidic ribosomal protein P2B isoform X2 [Zea mays]
 gb|ACN33932.1| unknown [Zea mays]
 gb|AFW81768.1| 60S acidic ribosomal protein P2B [Zea mays]
Length=136

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   P+ADD+K IL SVGA+ D ++++ LL++++ KDIT
Sbjct  24   MKVIAAYLLAVLGGNTSPTADDVKSILESVGAEADEEKLEFLLTELKDKDIT  75



>ref|XP_006292078.1| hypothetical protein CARUB_v10018273mg [Capsella rubella]
 gb|EOA24976.1| hypothetical protein CARUB_v10018273mg [Capsella rubella]
Length=112

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV AA+LLAVLGG A PSAD++K I+ +VGAD D + I+LLL +V+GKDI 
Sbjct  1    MKVAAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIELLLKEVKGKDIA  52



>ref|XP_006279385.1| hypothetical protein CARUB_v10008004mg [Capsella rubella]
 gb|EOA12283.1| hypothetical protein CARUB_v10008004mg [Capsella rubella]
Length=113

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV AA+LLAVLGG A PSAD++K I+ +VGAD D + I+LLL +V+GKDI 
Sbjct  1    MKVAAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIELLLKEVKGKDIA  52



>ref|XP_010521669.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Tarenaya hassleriana]
Length=113

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AA+LL+VLGGKA P+A+D+K IL SVGA+   + I LLL +V GKDIT
Sbjct  1    MKVVAAFLLSVLGGKASPTAEDIKDILGSVGAEASDEEIQLLLKEVSGKDIT  52



>ref|XP_008387857.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Malus domestica]
 ref|XP_008359754.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Malus domestica]
 ref|XP_008366740.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Malus domestica]
Length=112

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLL VLGG   PS +DLK IL SVGA+ D   I LLLS VEGKDI
Sbjct  1    MKVLAAYLLXVLGGNTAPSTEDLKDILRSVGAEADDGEIQLLLSGVEGKDI  51



>ref|XP_004975549.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X2 [Setaria 
italica]
Length=112

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G   PSA+DL  IL SVGA+ D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNNSPSAEDLTTILESVGAEVDNEKMELLLSQLSGKDIT  52



>ref|XP_004973771.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X2 [Setaria 
italica]
Length=112

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G   PSA+DL  IL SVGA+ D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNNSPSAEDLTTILESVGAEVDNEKMELLLSQLSGKDIT  52



>ref|XP_009421130.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009421131.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Musa acuminata 
subsp. malaccensis]
Length=116

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAYLLAVLGG   P+  D+K IL SVGAD   ++I+LLLSQV GKD+T
Sbjct  1    MKVIAAYLLAVLGGNISPTTGDVKGILESVGADVVDEKIELLLSQVGGKDLT  52



>ref|XP_010686061.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Beta vulgaris 
subsp. vulgaris]
Length=112

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MK++ AYLLA LGGK+ P+ DD+KHILSSVG + D DR+ L  ++V GKD+
Sbjct  1    MKIVCAYLLAALGGKSSPTVDDVKHILSSVGIEADEDRLKLFFNEVSGKDL  51



>ref|XP_010425874.1| PREDICTED: 60S acidic ribosomal protein P2-4 [Camelina sativa]
Length=113

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV AA+LLAVLGG A PSA+++K I+ +VGAD D + IDLLL +V GKDI 
Sbjct  1    MKVAAAFLLAVLGGNANPSAENIKDIIGAVGADVDGESIDLLLKEVSGKDIA  52



>gb|EMT02685.1| 60S acidic ribosomal protein P2B [Aegilops tauschii]
Length=113

 Score = 68.6 bits (166),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLA LGG + PSA D+K+IL SVGA+ D ++++ LL++++GKDIT
Sbjct  1    MKLIAAYLLAYLGGNSSPSAADVKNILDSVGAEADEEKLEFLLAELKGKDIT  52



>gb|EMS66726.1| 60S acidic ribosomal protein P2B [Triticum urartu]
Length=113

 Score = 68.6 bits (166),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLA LGG + PSA D+K+IL SVGA+ D ++++ LL++++GKDIT
Sbjct  1    MKLIAAYLLAYLGGNSSPSAADVKNILDSVGAEADEEKLEFLLAELKGKDIT  52



>ref|XP_005849033.1| hypothetical protein CHLNCDRAFT_51198 [Chlorella variabilis]
 gb|EFN56931.1| hypothetical protein CHLNCDRAFT_51198 [Chlorella variabilis]
Length=106

 Score = 68.6 bits (166),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLA LGG A P   D+K ILSSVG + DA+R+  LLS++EGKD+
Sbjct  1    MKVVAAYLLAALGGNAAPGEADIKKILSSVGVEADAERVQKLLSELEGKDV  51



>gb|AFW81218.1| acidic ribosomal protein P2a [Zea mays]
Length=164

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G A PSADDL  IL SVG + D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNASPSADDLTAILESVGCEVDNEKMELLLSQLSGKDIT  52



>ref|XP_002448737.1| hypothetical protein SORBIDRAFT_06g032330 [Sorghum bicolor]
 gb|EES13065.1| hypothetical protein SORBIDRAFT_06g032330 [Sorghum bicolor]
Length=112

 Score = 68.6 bits (166),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK IAAYLLAVLGG   PSA+DL  IL SVG + D ++++LLLSQ+ GKDIT
Sbjct  1    MKFIAAYLLAVLGGNLSPSAEDLAAILESVGCEVDNEKMELLLSQLSGKDIT  52



>gb|AFK40789.1| unknown [Lotus japonicus]
Length=115

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLAVLGG + PSADDLK+IL SVG + + + I+LLL +V+GKD 
Sbjct  1    MKVVAAYLLAVLGGNSSPSADDLKNILGSVGIEIEDELIELLLKEVKGKDF  51



>ref|XP_002315449.1| 60s acidic ribosomal family protein [Populus trichocarpa]
 gb|EEF01620.1| 60s acidic ribosomal family protein [Populus trichocarpa]
Length=110

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AA+LLAVLGG   PSA+D+K IL+SVGA+ D D+I+LLLSQV+ KDIT
Sbjct  1    MKTVAAFLLAVLGGNNSPSAEDIKKILASVGAEAD-DKIELLLSQVKDKDIT  51



>ref|XP_010503106.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Camelina sativa]
Length=113

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV AA+LLAVLGG A PSA ++K I+ +VGAD D + IDLLL +V GKDI 
Sbjct  1    MKVAAAFLLAVLGGNANPSAQNIKDIIGAVGADVDGESIDLLLKEVSGKDIA  52



>ref|XP_001758040.1| predicted protein [Physcomitrella patens]
 gb|EDQ77282.1| predicted protein [Physcomitrella patens]
Length=114

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLA+LGG + P+A D++ IL +VGA+ DA R+ LLL ++EGKDI
Sbjct  1    MKVVAAYLLALLGGNSAPTAKDIESILGAVGAEADAARVSLLLKELEGKDI  51



>gb|AAP80630.1|AF475108_1 acidic ribosomal protein [Triticum aestivum]
Length=138

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLA LGG + PSA D+K+IL SVGA+ D ++++ LL++++GKDIT
Sbjct  26   MKLIAAYLLAYLGGNSSPSAADVKNILDSVGAEADEEKLEFLLAELKGKDIT  77



>pdb|3J61|SS Chain s, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 pdb|3J61|TT Chain t, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|EMS51076.1| 60S acidic ribosomal protein P2A [Triticum urartu]
 gb|EMT13753.1| 60S acidic ribosomal protein P2A [Aegilops tauschii]
Length=113

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK IAAYLLA L G A PSA+DL  IL SVG + D ++++L+LSQV+GKDIT
Sbjct  1    MKFIAAYLLAYLSGNASPSAEDLTSILESVGCEIDNEKMELMLSQVKGKDIT  52



>ref|XP_001761876.1| predicted protein [Physcomitrella patens]
 gb|EDQ73317.1| predicted protein [Physcomitrella patens]
Length=114

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLA+LGG   PSA D++ IL +VGA+ DA R+ LLL ++EGKDI
Sbjct  1    MKVVAAYLLALLGGNPSPSAKDIEAILGAVGAEADASRVSLLLKELEGKDI  51



>gb|ACN30980.1| unknown [Zea mays]
Length=112

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G + PSA+DL  IL SVG + D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNSSPSAEDLTAILESVGCEVDNEKMELLLSQLSGKDIT  52



>ref|XP_001784528.1| predicted protein [Physcomitrella patens]
 gb|EDQ50649.1| predicted protein [Physcomitrella patens]
Length=115

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLA+LGG + PSA D++ IL +VGA+ D  RI LLL ++EGKDI
Sbjct  1    MKVVAAYLLALLGGNSAPSAKDIESILGAVGAEADPSRISLLLKELEGKDI  51



>ref|XP_004975548.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X1 [Setaria 
italica]
Length=252

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G   PSA+DL  IL SVGA+ D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNNSPSAEDLTTILESVGAEVDNEKMELLLSQLSGKDIT  52



>gb|ACG45911.1| 60S acidic ribosomal protein P2A [Zea mays]
Length=113

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G + PSA+DL  IL SVG + D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNSSPSAEDLTSILESVGCEVDNEKMELLLSQLSGKDIT  52



>ref|XP_004487515.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Cicer arietinum]
Length=113

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MK+IAAYLL+VLGG + PSADD+K IL SVG + + ++I+LLL++V+GKD 
Sbjct  1    MKIIAAYLLSVLGGNSSPSADDVKKILHSVGIEAEDEKIELLLTEVKGKDF  51



>ref|XP_004973770.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X1 [Setaria 
italica]
Length=148

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G   PSA+DL  IL SVGA+ D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNNSPSAEDLTTILESVGAEVDNEKMELLLSQLSGKDIT  52



>ref|XP_011399325.1| 60S acidic ribosomal protein P2 [Auxenochlorella protothecoides]
 gb|KFM22404.1| 60S acidic ribosomal protein P2 [Auxenochlorella protothecoides]
Length=109

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            +KV+AAYLLA LGG A PSA+D+  ILSSVG + D++R+  LL +V+GKDI 
Sbjct  2    VKVVAAYLLAALGGNATPSAEDISKILSSVGIEADSERVATLLKEVDGKDIN  53



>dbj|BAC83094.1| putative 60S acidic ribosomal protein [Oryza sativa Japonica 
Group]
Length=167

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +3

Query  45   QRKEEMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            QR++ M+ +AAYL+A +GG A P+ DD++ IL +VGAD D D++  L  QV GKD+
Sbjct  54   QRRQTMRFVAAYLMATIGGNASPTKDDVRAILGAVGADIDEDKLGYLFDQVAGKDL  109



>gb|KFK32382.1| hypothetical protein AALP_AA6G233900 [Arabis alpina]
Length=115

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AA+LLAVLGGKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+
Sbjct  1    MKVVAAFLLAVLGGKASPTSGDIKAILGSVGAESEDAQIELLLKEVKGKDV  51



>ref|XP_008663721.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Zea mays]
 gb|ACF86127.1| unknown [Zea mays]
 gb|ACG30918.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|AFW59828.1| acidic ribosomal protein P2a-4 [Zea mays]
Length=111

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G + PSA+DL  IL SVG + D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNSSPSAEDLTAILESVGCEVDNEKMELLLSQLSGKDIT  52



>ref|XP_008668723.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Zea mays]
 gb|ACG24768.1| 60S acidic ribosomal protein P2A [Zea mays]
 gb|ACN35134.1| unknown [Zea mays]
 tpg|DAA35449.1| TPA: acidic ribosomal protein P2a-3 [Zea mays]
Length=113

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G + PSA+DL  IL SVG + D ++++LLLSQ+ GKDIT
Sbjct  1    MKFVAAYLLAVLAGNSSPSAEDLTAILESVGCEVDNEKMELLLSQLSGKDIT  52



>ref|XP_011024241.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Populus euphratica]
Length=109

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AA+LLAVLGG   PSA+D+K IL+SVGA+ D D+I+LLLSQV+ +DIT
Sbjct  1    MKTVAAFLLAVLGGNNSPSAEDIKKILASVGAEAD-DKIELLLSQVKDRDIT  51



>ref|XP_010473164.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Camelina sativa]
Length=114

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAA+LLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+T
Sbjct  1    MKVIAAFLLAVLSGKASPTSSDIKDILGSVGAETEDSQIELLLKEVKGKDLT  52



>ref|XP_002447780.1| hypothetical protein SORBIDRAFT_06g015440 [Sorghum bicolor]
 gb|EES12108.1| hypothetical protein SORBIDRAFT_06g015440 [Sorghum bicolor]
Length=112

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G   PS +DLK IL SVGA+ D+++++ LLSQV GKDIT
Sbjct  1    MKFVAAYLLAVLAGNNDPSVEDLKTILESVGAETDSEKMEHLLSQVSGKDIT  52



>gb|KJB62189.1| hypothetical protein B456_009G405600 [Gossypium raimondii]
Length=126

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AAYLLAV G K  PSA D+K IL+SVGA+ D D+I LLL +++GKD+T
Sbjct  1    MKVVAAYLLAVPGSKTNPSAADIKKILASVGAEADDDKIQLLLYEMKGKDVT  52



>ref|XP_001754567.1| predicted protein [Physcomitrella patens]
 gb|EDQ80537.1| predicted protein [Physcomitrella patens]
Length=114

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLA+LGG + PSA D++ IL +VGA+ D  R+ LLL ++EGKDI
Sbjct  1    MKVVAAYLLALLGGNSSPSAKDIEAILGAVGAEADPSRVSLLLKELEGKDI  51



>dbj|BAH57243.1| AT2G27710 [Arabidopsis thaliana]
Length=97

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+
Sbjct  1    MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDL  51



>ref|NP_001189621.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 gb|AEC08032.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
Length=98

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+
Sbjct  1    MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDL  51



>ref|XP_004165173.1| PREDICTED: 60S acidic ribosomal protein P2-4-like isoform 1 [Cucumis 
sativus]
Length=131

 Score = 66.6 bits (161),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 44/69 (64%), Gaps = 17/69 (25%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSS-----------------VGADCDADRIDLLL  188
            MK++AAYLLAVLGG + PSA DLK IL S                 VGA+ D +RI+LLL
Sbjct  1    MKIVAAYLLAVLGGNSNPSAKDLKDILGSVKYVEWGHNLSFPNRFAVGAEVDEERINLLL  60

Query  189  SQVEGKDIT  215
            S V+GKDIT
Sbjct  61   SNVKGKDIT  69



>ref|XP_002642304.1| Hypothetical protein CBG18296 [Caenorhabditis briggsae]
 emb|CAP35773.1| Protein CBG18296 [Caenorhabditis briggsae]
Length=110

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            M+ I+AYLLAVLGG A P ADD+K+ILS+VG D +A+ ++L++S  +GK+I
Sbjct  1    MRYISAYLLAVLGGNANPQADDIKNILSAVGVDANAESVNLVVSGFKGKNI  51



>ref|XP_010510738.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Camelina sativa]
 ref|XP_010510744.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Camelina sativa]
Length=114

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AA+LLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+T
Sbjct  1    MKVVAAFLLAVLSGKASPTSTDIKDILGSVGAETEDSQIELLLKEVKGKDLT  52



>gb|AFK33658.1| unknown [Medicago truncatula]
 gb|KEH42065.1| 60S acidic ribosomal protein [Medicago truncatula]
Length=112

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLAVLGG   PSA  +K IL SVGAD + +RI+  LS+++GKDI
Sbjct  1    MKVVAAYLLAVLGGDNTPSAKTIKDILGSVGADAEDNRIESFLSEIKGKDI  51



>ref|XP_002639930.1| Hypothetical protein CBG08266 [Caenorhabditis briggsae]
 emb|CAP28124.1| Protein CBG08266 [Caenorhabditis briggsae]
Length=110

 Score = 65.9 bits (159),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            M+ I+AYLLAVLGG A P ADD+++ILS+VG D +A+ ++L++S +EGK+I
Sbjct  1    MRYISAYLLAVLGGNANPHADDIENILSAVGVDANAESVNLVVSGLEGKNI  51



>ref|XP_010514785.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Camelina sativa]
 ref|XP_010514786.1| PREDICTED: 60S acidic ribosomal protein P2-4-like [Camelina sativa]
Length=113

 Score = 65.9 bits (159),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV AA+LLAVLGG A PSA+++K I+ +VGAD D + I+LLL ++ GKDI 
Sbjct  1    MKVAAAFLLAVLGGNANPSAENIKDIIGAVGADVDGESIELLLKEMSGKDIA  52



>ref|NP_180339.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 ref|NP_850106.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 ref|NP_973549.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 sp|Q9SLF7.1|RLA22_ARATH RecName: Full=60S acidic ribosomal protein P2-2 [Arabidopsis 
thaliana]
 gb|AAL16198.1|AF428429_1 At2g27710/F15K20.19 [Arabidopsis thaliana]
 gb|AAC73029.1| 60S acidic ribosomal protein P2 [Arabidopsis thaliana]
 gb|AAL32932.1| 60S acidic ribosomal protein P2 [Arabidopsis thaliana]
 gb|AAP21326.1| At2g27710 [Arabidopsis thaliana]
 dbj|BAH19900.1| AT2G27710 [Arabidopsis thaliana]
 gb|AEC08029.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 gb|AEC08030.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
 gb|AEC08031.1| 60S acidic ribosomal protein P2-2 [Arabidopsis thaliana]
Length=115

 Score = 65.9 bits (159),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+
Sbjct  1    MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDL  51



>gb|KIZ04174.1| 60S acidic ribosomal protein P2-4 [Monoraphidium neglectum]
Length=107

 Score = 65.9 bits (159),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            M+V++A LLAVLGGKA P+ DD+K IL SVG + DAD +  LL ++EGKDI
Sbjct  1    MRVVSAVLLAVLGGKANPTEDDVKKILGSVGVEADADSVQRLLKELEGKDI  51



>gb|KGN48246.1| hypothetical protein Csa_6G451490 [Cucumis sativus]
Length=115

 Score = 65.9 bits (159),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MK++AAYLLA+LGG   PS  D+K IL+SVG + + +RI+LLLSQV+GKD+
Sbjct  1    MKIVAAYLLAILGGNTHPSIHDIKAILASVGVEAEDERIELLLSQVKGKDV  51



>gb|EGC44602.1| 60S acidic ribosomal protein P2 [Histoplasma capsulatum H88]
Length=111

 Score = 65.9 bits (159),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK IAAYLL  LGG   PSA D+K++LSSVG D D++R++ LL+++EGK+IT
Sbjct  1    MKHIAAYLLLGLGGNTSPSASDIKNVLSSVGIDADSERLEKLLAELEGKNIT  52



>ref|XP_004167613.1| PREDICTED: 60S acidic ribosomal protein P2B-like [Cucumis sativus]
Length=115

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MK++AAYLLA+LGG   PS  D+K IL+SVG + + +RI+LLLSQV+GKD+
Sbjct  1    MKIVAAYLLAILGGNTHPSIHDIKAILASVGVEAEDERIELLLSQVKGKDV  51



>ref|XP_006295265.1| hypothetical protein CARUB_v10024352mg [Capsella rubella]
 gb|EOA28163.1| hypothetical protein CARUB_v10024352mg [Capsella rubella]
Length=114

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLAVL GKA PS+ D+K IL SVGA+ +  +I+LLL +V+GKD+
Sbjct  1    MKVVAAYLLAVLSGKASPSSADIKGILGSVGAETEDSQIELLLKEVKGKDL  51



>ref|XP_010417919.1| PREDICTED: 60S acidic ribosomal protein P2-1 [Camelina sativa]
Length=114

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AA+LLAVL GKA P++ D+K +L SVGA+ +  +I+LLL +V+GKD+T
Sbjct  1    MKVVAAFLLAVLSGKASPTSSDIKDVLGSVGAETEDSQIELLLKEVKGKDLT  52



>emb|CDX77131.1| BnaC04g39260D [Brassica napus]
Length=113

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AA+LLAVL GKACP++ D+K IL+SVG + +  +I+LLL +V GKD+
Sbjct  1    MKVVAAFLLAVLSGKACPTSADIKVILNSVGCETEDSQIELLLKEVNGKDV  51



>gb|KIK47394.1| hypothetical protein CY34DRAFT_247207 [Suillus luteus UH-Slu-Lm8-n1]
Length=112

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            M+ IAAYLL  +GG A PSADD+K +LS+VG + D DR+D L+S++EGKDI 
Sbjct  1    MRHIAAYLLLQIGGNASPSADDVKKVLSAVGIEADDDRLDTLISELEGKDIN  52



>ref|XP_001756207.1| predicted protein [Physcomitrella patens]
 gb|EDQ79073.1| predicted protein [Physcomitrella patens]
Length=114

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLL +LGG A PSA D++ +L SVGA+ D+ R+ LLL ++EGKDI
Sbjct  1    MKVVAAYLLCLLGGNASPSAKDIEAVLGSVGAEADSARVRLLLKELEGKDI  51



>ref|XP_001907105.1| hypothetical protein [Podospora anserina S mat+]
 sp|Q9C3Z5.1|RLA2_PODAS RecName: Full=60S acidic ribosomal protein P2 [Podospora anserina]
 gb|AAK11263.1|AF331715_1 ribosomal protein P2 [Podospora anserina]
 emb|CAP67776.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP24033.1| Acidic cytosolic 60S ribosomal protein RplP2 [Podospora anserina 
S mat+]
Length=111

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLL  LGGKA PSA D+K +L SVG + D+DR+D L+S++EGKD+ 
Sbjct  1    MKHLAAYLLLTLGGKATPSAADVKAVLESVGIEADSDRLDKLISELEGKDVN  52



>gb|AFK39918.1| unknown [Medicago truncatula]
Length=113

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   PSA DLK IL SVG + +   I+LLLS+V+GKD  
Sbjct  1    MKIIAAYLLAVLGGNQSPSASDLKQILGSVGVEAEDCNIELLLSEVKGKDFA  52



>gb|AAM65044.1| 60S acidic ribosomal protein P2 [Arabidopsis thaliana]
Length=115

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AAYLLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+
Sbjct  1    MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDL  51



>gb|KEH38965.1| 60S acidic ribosomal protein [Medicago truncatula]
Length=113

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK+IAAYLLAVLGG   PSA DLK IL SVG + +   I+LLLS+V+GKD  
Sbjct  1    MKIIAAYLLAVLGGNQSPSASDLKQILGSVGVEAEDCNIELLLSEVKGKDFA  52



>ref|XP_006643860.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Oryza brachyantha]
Length=113

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK ++AYL+AVL G + P+A+DL  IL SVG + D+++++LLLSQV G+DIT
Sbjct  1    MKFVSAYLMAVLAGNSNPTAEDLTAILESVGCEIDSEKMELLLSQVSGRDIT  52



>ref|XP_010473159.1| PREDICTED: 60S acidic ribosomal protein P2-1-like [Camelina sativa]
Length=114

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV+AA+LLAVL GKA P++ D+K IL SVGA+ +  +I+LLL +V+GKD+T
Sbjct  1    MKVVAAFLLAVLSGKASPTSADIKDILGSVGAETEDSQIELLLKEVKGKDLT  52



>gb|AAP80619.1|AF475097_1 acidic ribosomal protein P2, partial [Triticum aestivum]
 gb|AAP80644.1|AF475123_1 acidic ribosomal protein P2a-2 [Triticum aestivum]
Length=112

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  63   KVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            K IAAYLLA L G A PSA+DL  IL SVG + D ++++L+LSQV+GKDIT
Sbjct  1    KFIAAYLLAYLSGNASPSAEDLTSILESVGCEIDNEKMELMLSQVKGKDIT  51



>dbj|BAJ92129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=113

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK IAAYLLA L G A PSA+DL  IL SVG + D ++++L+L QV+GKDIT
Sbjct  1    MKFIAAYLLAYLSGNASPSAEDLTSILESVGCEIDNEKMELMLCQVKGKDIT  52



>ref|XP_010514554.1| PREDICTED: 60S acidic ribosomal protein P2-3-like [Camelina sativa]
Length=115

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAA+LLA LGGK  P+++DLK IL SVGA+ D  RIDLL S ++  D+T
Sbjct  1    MKVIAAFLLAKLGGKENPTSNDLKKILESVGAEIDESRIDLLFSLIKDHDVT  52



>gb|KIP10036.1| hypothetical protein PHLGIDRAFT_34126 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=112

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            M+ IAAYLL  +GGKA PSADD+K +L SVG + D DR+  L+S++EGKD+ 
Sbjct  1    MRYIAAYLLLQIGGKASPSADDIKKVLDSVGIETDDDRLSKLISELEGKDVN  52



>ref|XP_004955604.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X1 [Setaria 
italica]
Length=138

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G   PSA+DL  IL SVG + D ++++LLLSQ+ G+DIT
Sbjct  1    MKFVAAYLLAVLAGNPSPSAEDLSAILESVGCEIDNEKMELLLSQLSGRDIT  52



>ref|XP_003579690.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Brachypodium 
distachyon]
 ref|XP_010239875.1| PREDICTED: 60S acidic ribosomal protein P2A-like [Brachypodium 
distachyon]
Length=113

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MK IAAYLLA L G + PSA+DL  IL SVG + D ++++L+LSQV+GKDI
Sbjct  1    MKFIAAYLLAYLSGNSSPSAEDLTTILESVGCEIDNEKMELMLSQVKGKDI  51



>gb|EEH10128.1| 60S acidic ribosomal protein P2 [Histoplasma capsulatum G186AR]
Length=191

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  57   EMKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            +MK IAAYLL  LGG   PSA D+K +LSSVG D D++R++ LL+++EGK+IT
Sbjct  80   KMKHIAAYLLLGLGGNTSPSASDIKSVLSSVGIDADSERLEKLLAELEGKNIT  132



>gb|AAN52372.1| ribosomal protein P2 [Branchiostoma belcheri]
Length=115

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            M+ +AAYLLAVLGG A PSA D+K IL SVG D D +R++ ++S++ GKDI
Sbjct  1    MRYVAAYLLAVLGGNANPSAGDIKKILGSVGIDADDERLNKVISELNGKDI  51



>ref|XP_002875674.1| hypothetical protein ARALYDRAFT_484870 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51933.1| hypothetical protein ARALYDRAFT_484870 [Arabidopsis lyrata subsp. 
lyrata]
Length=111

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKV AA+LLAVLGG A P A+++K I+ +VGAD D + I+LLL +V GKDI 
Sbjct  1    MKVAAAFLLAVLGGNANPCAENIKDIIGAVGADVDGESIELLLKEVSGKDIA  52



>ref|XP_009140817.1| PREDICTED: 60S acidic ribosomal protein P2-2-like [Brassica rapa]
 emb|CDY30535.1| BnaA04g15980D [Brassica napus]
Length=113

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            MKV+AA+LLAVL GKACP++ D+K IL+SVG + +  +I+LLL +V GKD+
Sbjct  1    MKVVAAFLLAVLSGKACPTSADIKVILNSVGCETEDSQIELLLKEVNGKDV  51



>ref|XP_004955605.1| PREDICTED: 60S acidic ribosomal protein P2A-like isoform X2 [Setaria 
italica]
Length=112

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MK +AAYLLAVL G   PSA+DL  IL SVG + D ++++LLLSQ+ G+DIT
Sbjct  1    MKFVAAYLLAVLAGNPSPSAEDLSAILESVGCEIDNEKMELLLSQLSGRDIT  52



>emb|CCO30861.1| 60S acidic ribosomal protein P2 AltName: Full=Acyl carrier protein 
[Rhizoctonia solani AG-1 IB]
Length=66

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            M+ IAAYLL  +GGK  P ADD+K +LS+ G D D +R++ LLS++EGKD+ 
Sbjct  1    MRYIAAYLLLQIGGKTSPVADDIKKVLSAAGVDVDEERLNKLLSELEGKDVN  52



>ref|XP_002634216.1| Hypothetical protein CBG01785 [Caenorhabditis briggsae]
 emb|CAP22851.1| Protein CBG01785 [Caenorhabditis briggsae]
Length=110

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDI  212
            M+ I+AYLLAVLGG A P  DD+K+ILS+VG D +A+ ++L++S ++GK+I
Sbjct  1    MRYISAYLLAVLGGNANPQTDDIKNILSAVGVDANAESVNLVVSGLKGKNI  51



>gb|ACM09200.1| 60S acidic ribosomal protein P2 [Salmo salar]
Length=112

 Score = 64.3 bits (155),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            M+ +AAYLLAVLGG   PS+ D+K+IL SVG + +A+R+D ++S++ GKDI 
Sbjct  1    MRYVAAYLLAVLGGNTSPSSKDIKNILGSVGIEAEAERLDKVVSELNGKDIN  52



>gb|AFK35524.1| unknown [Lotus japonicus]
 gb|AFK44218.1| unknown [Lotus japonicus]
Length=114

 Score = 64.3 bits (155),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            MKVIAAY+LAVLGG   PSA ++K I+ SVG D D DRI   LS+++GKD+ 
Sbjct  1    MKVIAAYMLAVLGGNNSPSAAEIKKIIGSVGGDADDDRIASFLSELKGKDLA  52



>ref|NP_001133207.1| ribosomal protein, large P2, like 1-2 [Salmo salar]
 gb|ACH70993.1| ribosomal protein, large P2, like 1-2 [Salmo salar]
 gb|ACN09859.1| 60S acidic ribosomal protein P2 [Salmo salar]
 gb|ACN12206.1| 60S acidic ribosomal protein P2 [Salmo salar]
Length=112

 Score = 64.3 bits (155),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +3

Query  60   MKVIAAYLLAVLGGKACPSADDLKHILSSVGADCDADRIDLLLSQVEGKDIT  215
            M+ +AAYLLAVLGG   PS+ D+K+IL SVG + +A+R+D ++S++ GKDI 
Sbjct  1    MRYVAAYLLAVLGGNTSPSSKDIKNILGSVGIEAEAERLDKVVSELNGKDIN  52



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556171087500