BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN036E17

Length=591
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009795521.1|  PREDICTED: photosystem I reaction center sub...    275   2e-90   Nicotiana sylvestris
ref|XP_009621208.1|  PREDICTED: photosystem I reaction center sub...    275   5e-90   Nicotiana tomentosiformis
ref|XP_004241054.2|  PREDICTED: photosystem I reaction center sub...    273   1e-89   
ref|XP_006356675.1|  PREDICTED: photosystem I reaction center sub...    271   6e-89   Solanum tuberosum [potatoes]
ref|XP_009799304.1|  PREDICTED: photosystem I reaction center sub...    268   3e-87   Nicotiana sylvestris
ref|XP_011071575.1|  PREDICTED: photosystem I reaction center sub...    266   1e-86   Sesamum indicum [beniseed]
ref|XP_009366924.1|  PREDICTED: photosystem I reaction center sub...    265   3e-86   Pyrus x bretschneideri [bai li]
ref|XP_008376830.1|  PREDICTED: photosystem I reaction center sub...    265   3e-86   Malus domestica [apple tree]
ref|XP_008340966.1|  PREDICTED: photosystem I reaction center sub...    265   3e-86   Malus domestica [apple tree]
gb|EYU41499.1|  hypothetical protein MIMGU_mgv1a013699mg                265   3e-86   Erythranthe guttata [common monkey flower]
ref|XP_011090732.1|  PREDICTED: photosystem I reaction center sub...    264   7e-86   Sesamum indicum [beniseed]
ref|XP_003556041.1|  PREDICTED: photosystem I reaction center sub...    263   8e-86   Glycine max [soybeans]
ref|XP_007143239.1|  hypothetical protein PHAVU_007G055900g             263   9e-86   Phaseolus vulgaris [French bean]
gb|AGV54746.1|  photosystem I reaction center subunit II chloropl...    263   1e-85   Phaseolus vulgaris [French bean]
ref|XP_008224535.1|  PREDICTED: photosystem I reaction center sub...    263   2e-85   Prunus mume [ume]
ref|XP_004296896.1|  PREDICTED: photosystem I reaction center sub...    263   2e-85   Fragaria vesca subsp. vesca
ref|XP_006419899.1|  hypothetical protein CICLE_v10005892mg             263   2e-85   Citrus clementina [clementine]
ref|NP_001275862.1|  PSI reaction center subunit II                     263   2e-85   Citrus sinensis [apfelsine]
ref|XP_010035248.1|  PREDICTED: photosystem I reaction center sub...    263   2e-85   Eucalyptus grandis [rose gum]
gb|EYU45647.1|  hypothetical protein MIMGU_mgv1a013850mg                261   6e-85   Erythranthe guttata [common monkey flower]
ref|XP_010277521.1|  PREDICTED: photosystem I reaction center sub...    261   1e-84   Nelumbo nucifera [Indian lotus]
ref|XP_009588197.1|  PREDICTED: photosystem I reaction center sub...    261   1e-84   Nicotiana tomentosiformis
ref|NP_001235355.1|  photosystem I subunit PsaD                         261   1e-84   Glycine max [soybeans]
emb|CDY21916.1|  BnaC09g00220D                                          262   5e-84   Brassica napus [oilseed rape]
ref|XP_009344083.1|  PREDICTED: photosystem I reaction center sub...    259   6e-84   Pyrus x bretschneideri [bai li]
gb|ABK96621.1|  unknown                                                 259   6e-84   Populus trichocarpa x Populus deltoides
ref|XP_010474926.1|  PREDICTED: photosystem I reaction center sub...    259   9e-84   Camelina sativa [gold-of-pleasure]
ref|XP_009111256.1|  PREDICTED: photosystem I reaction center sub...    258   1e-83   Brassica rapa
ref|XP_003610706.1|  Photosystem I reaction center subunit II           258   1e-83   Medicago truncatula
ref|XP_006306434.1|  hypothetical protein CARUB_v10012376mg             258   2e-83   Capsella rubella
ref|XP_002281825.1|  PREDICTED: photosystem I reaction center sub...    258   2e-83   Vitis vinifera
ref|XP_002315779.1|  photosystem I 20kD family protein                  257   3e-83   Populus trichocarpa [western balsam poplar]
ref|XP_010108011.1|  Photosystem I reaction center subunit II           257   4e-83   
ref|XP_004511355.1|  PREDICTED: photosystem I reaction center sub...    257   5e-83   Cicer arietinum [garbanzo]
ref|XP_002516772.1|  Photosystem I reaction center subunit II, ch...    256   5e-83   Ricinus communis
gb|AFK43504.1|  unknown                                                 256   7e-83   Lotus japonicus
ref|XP_006288687.1|  hypothetical protein CARUB_v10001997mg             256   7e-83   Capsella rubella
ref|XP_010481602.1|  PREDICTED: photosystem I reaction center sub...    256   8e-83   
emb|CDO99040.1|  unnamed protein product                                255   1e-82   Coffea canephora [robusta coffee]
gb|AFV94477.1|  photosystem I reaction center subunit II                255   2e-82   Saccharum hybrid cultivar GT28
ref|NP_001062511.1|  Os08g0560900                                       255   2e-82   
ref|XP_002892148.1|  hypothetical protein ARALYDRAFT_887465             255   3e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_007050585.1|  Photosystem I subunit D-2                          254   3e-82   
ref|XP_010430302.1|  PREDICTED: photosystem I reaction center sub...    254   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010456951.1|  PREDICTED: photosystem I reaction center sub...    254   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010422538.1|  PREDICTED: photosystem I reaction center sub...    254   4e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010424650.1|  PREDICTED: photosystem I reaction center sub...    254   5e-82   Camelina sativa [gold-of-pleasure]
ref|NP_171812.1|  photosystem I reaction center subunit D-2             254   6e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010935005.1|  PREDICTED: photosystem I reaction center sub...    254   8e-82   Elaeis guineensis
ref|XP_010424649.1|  PREDICTED: photosystem I reaction center sub...    254   9e-82   
ref|XP_011021547.1|  PREDICTED: photosystem I reaction center sub...    253   9e-82   Populus euphratica
ref|XP_011026306.1|  PREDICTED: photosystem I reaction center sub...    253   2e-81   Populus euphratica
gb|KFK42673.1|  hypothetical protein AALP_AA1G025000                    252   3e-81   Arabis alpina [alpine rockcress]
ref|XP_010474916.1|  PREDICTED: photosystem I reaction center sub...    254   3e-81   Camelina sativa [gold-of-pleasure]
ref|XP_002311618.2|  photosystem I 20kD family protein                  252   3e-81   Populus trichocarpa [western balsam poplar]
ref|XP_010474917.1|  PREDICTED: photosystem I reaction center sub...    253   4e-81   
ref|NP_192186.1|  photosystem I subunit D-1                             251   5e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134141.1|  PREDICTED: photosystem I reaction center sub...    251   6e-81   Cucumis sativus [cucumbers]
ref|XP_006838247.1|  hypothetical protein AMTR_s00103p00041210          251   6e-81   Amborella trichopoda
ref|XP_006396500.1|  hypothetical protein EUTSA_v10029178mg             252   7e-81   
gb|AAM66066.1|  putative photosystem I reaction center subunit II...    251   7e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522735.1|  PREDICTED: photosystem I reaction center sub...    251   1e-80   Tarenaya hassleriana [spider flower]
ref|XP_009396832.1|  PREDICTED: photosystem I reaction center sub...    253   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB28316.1|  hypothetical protein B456_005G042000                    251   1e-80   Gossypium raimondii
gb|ACF05868.1|  chloroplast photosystem I protein                       249   1e-80   Populus tremula [European aspen]
ref|XP_004981348.1|  PREDICTED: photosystem I reaction center sub...    253   1e-80   
ref|XP_010542866.1|  PREDICTED: photosystem I reaction center sub...    250   1e-80   Tarenaya hassleriana [spider flower]
gb|ACF05884.1|  chloroplast photosystem I protein                       249   1e-80   Populus tremula [European aspen]
gb|ACF05859.1|  chloroplast photosystem I protein                       249   1e-80   Populus tremula [European aspen]
gb|ACF05876.1|  chloroplast photosystem I protein                       249   1e-80   Populus tremula [European aspen]
gb|ACF05855.1|  chloroplast photosystem I protein                       249   2e-80   Populus tremula [European aspen]
emb|CAN61448.1|  hypothetical protein VITISV_024141                     249   2e-80   Vitis vinifera
gb|ACF05871.1|  chloroplast photosystem I protein                       249   2e-80   Populus tremula [European aspen]
ref|XP_002278284.1|  PREDICTED: photosystem I reaction center sub...    250   2e-80   Vitis vinifera
ref|XP_002872810.1|  hypothetical protein ARALYDRAFT_490280             250   2e-80   
ref|XP_008802683.1|  PREDICTED: photosystem I reaction center sub...    250   3e-80   Phoenix dactylifera
ref|XP_010256006.1|  PREDICTED: photosystem I reaction center sub...    250   3e-80   Nelumbo nucifera [Indian lotus]
ref|XP_011015859.1|  PREDICTED: photosystem I reaction center sub...    249   3e-80   Populus euphratica
emb|CAB52677.1|  photosystem I subunit II precursor                     249   3e-80   Arabidopsis thaliana [mouse-ear cress]
gb|EPS62726.1|  hypothetical protein M569_12065                         249   4e-80   Genlisea aurea
gb|KJB23065.1|  hypothetical protein B456_004G079200                    251   5e-80   Gossypium raimondii
gb|KJB46980.1|  hypothetical protein B456_008G004100                    249   7e-80   Gossypium raimondii
ref|XP_002520727.1|  Photosystem I reaction center subunit II, ch...    249   7e-80   Ricinus communis
ref|XP_010681150.1|  PREDICTED: photosystem I reaction center sub...    249   9e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009400838.1|  PREDICTED: photosystem I reaction center sub...    248   9e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK30882.1|  hypothetical protein AALP_AA6G038200                    248   1e-79   Arabis alpina [alpine rockcress]
ref|XP_008438687.1|  PREDICTED: photosystem I reaction center sub...    248   1e-79   Cucumis melo [Oriental melon]
ref|NP_001130880.1|  photosystem I reaction center subunit II           247   3e-79   Zea mays [maize]
gb|KDO68707.1|  hypothetical protein CISIN_1g047658mg                   248   3e-79   Citrus sinensis [apfelsine]
ref|NP_001275788.1|  PSI reaction center subunit II                     247   4e-79   Citrus sinensis [apfelsine]
ref|XP_006444053.1|  hypothetical protein CICLE_v10022248mg             247   4e-79   Citrus clementina [clementine]
emb|CAA32182.1|  unnamed protein product                                247   4e-79   Spinacia oleracea
emb|CAA68728.1|  unnamed protein product                                247   4e-79   Spinacia oleracea
sp|P12353.2|PSAD_SPIOL  RecName: Full=Photosystem I reaction cent...    246   6e-79   Spinacia oleracea
sp|P36213.1|PSAD_HORVU  RecName: Full=Photosystem I reaction cent...    246   7e-79   Hordeum vulgare [barley]
gb|KDP21451.1|  hypothetical protein JCGZ_21922                         246   9e-79   Jatropha curcas
ref|XP_007034724.1|  Photosystem I subunit D-2                          246   1e-78   Theobroma cacao [chocolate]
gb|ACG25364.1|  photosystem I reaction center subunit II                245   2e-78   Zea mays [maize]
ref|XP_003564108.1|  PREDICTED: photosystem I reaction center sub...    244   2e-78   Brachypodium distachyon [annual false brome]
gb|ACN40159.1|  unknown                                                 243   2e-78   Picea sitchensis
gb|AFW67274.1|  photosystem I reaction center subunit II                246   2e-78   
gb|ACG41754.1|  photosystem I reaction center subunit II                244   2e-78   Zea mays [maize]
gb|ABK21314.1|  unknown                                                 243   2e-77   Picea sitchensis
pdb|2WSC|D  Chain D, Improved Model Of Plant Photosystem I              242   3e-77   Spinacia oleracea
pdb|3LW5|D  Chain D, Improved Model Of Plant Photosystem I              237   2e-76   unidentified
gb|ABK21867.1|  unknown                                                 240   4e-76   Picea sitchensis
pdb|4RKU|D  Chain D, Crystal Structure Of Plant Photosystem I At ...    236   6e-76   Pisum sativum [garden pea]
ref|XP_002991814.1|  hypothetical protein SELMODRAFT_26984              234   6e-75   
emb|CAA54744.1|  psaD                                                   236   9e-75   Spinacia oleracea
ref|XP_001752431.1|  predicted protein                                  234   5e-74   
ref|XP_001751403.1|  predicted protein                                  232   7e-74   
ref|XP_001768962.1|  predicted protein                                  232   7e-74   
pdb|2O01|D  Chain D, The Structure Of A Plant Photosystem I Super...    230   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001765579.1|  predicted protein                                  229   8e-73   
gb|KHN02708.1|  Photosystem I reaction center subunit II, chlorop...    228   2e-71   Glycine soja [wild soybean]
ref|XP_005647040.1|  PSI-D1 precursor                                   214   2e-66   Coccomyxa subellipsoidea C-169
gb|ABK96248.1|  unknown                                                 212   4e-66   Populus trichocarpa x Populus deltoides
gb|EMS56878.1|  Photosystem I reaction center subunit II, chlorop...    210   2e-65   Triticum urartu
ref|XP_007226637.1|  hypothetical protein PRUPE_ppa022366mg             211   3e-65   
ref|XP_002992973.1|  hypothetical protein SELMODRAFT_448960             226   4e-65   
ref|XP_002953316.1|  hypothetical protein VOLCADRAFT_121148             210   4e-65   Volvox carteri f. nagariensis
gb|KIZ01091.1|  Photosystem I reaction center subunit II, chlorop...    209   2e-64   Monoraphidium neglectum
ref|XP_003063552.1|  photosystem I subunit II, chloroplast precursor    209   3e-64   Micromonas pusilla CCMP1545
emb|CEG01861.1|  Photosystem I PsaD                                     208   3e-64   Ostreococcus tauri
ref|XP_007511428.1|  predicted protein                                  207   6e-64   Bathycoccus prasinos
ref|XP_002504652.1|  photosystem I subunit II, chloroplast precursor    208   8e-64   Micromonas commoda
ref|XP_003592408.1|  Photosystem I reaction center subunit II           205   4e-63   
ref|XP_005847397.1|  hypothetical protein CHLNCDRAFT_35549              205   5e-63   Chlorella variabilis
gb|KIZ02718.1|  Photosystem I reaction center subunit II, chlorop...    204   5e-63   Monoraphidium neglectum
emb|CAL25356.1|  photosystem I reaction center subunit II               202   8e-63   Platanus x hispanica [London plane tree]
ref|XP_011400522.1|  Photosystem I reaction center subunit II, ch...    204   1e-62   Auxenochlorella protothecoides
ref|XP_001697722.1|  photosystem I reaction center subunit II, 20...    203   2e-62   Chlamydomonas reinhardtii
ref|XP_001421350.1|  psaD, PSI-D, subunit II, photosystem I protein     202   8e-62   Ostreococcus lucimarinus CCE9901
sp|Q9T4W8.1|PSAD_CYAPA  RecName: Full=Photosystem I reaction cent...    191   2e-57   Cyanophora paradoxa
ref|YP_009019626.1|  photosystem I reaction center subunit II           184   2e-55   Gracilaria salicornia
ref|YP_001293570.1|  photosystem I subunit II                           181   2e-54   Rhodomonas salina
gb|AJO68451.1|  photosystem I subunit II                                181   3e-54   Gracilariopsis lemaneiformis
ref|YP_005088653.1|  photosystem I subunit II                           180   8e-54   Phaeocystis antarctica
ref|YP_008145427.1|  photosystem I subunit II                           179   1e-53   Phaeocystis globosa
ref|WP_009769007.1|  PsaD protein                                       179   2e-53   Oscillatoriales cyanobacterium JSC-12
ref|YP_004376584.1|  photosystem I ferredoxin-binding protein           178   3e-53   Fistulifera solaris
ref|YP_007627400.1|  photosystem I subunit II                           178   3e-53   Chondrus crispus [carageen]
ref|YP_009029191.1|  photosystem I reaction center subunit II           178   3e-53   Didymosphenia geminata
ref|NP_050759.1|  photosystem I subunit II                              178   3e-53   Guillardia theta
ref|WP_008312724.1|  PsaD                                               177   7e-53   Leptolyngbya sp. PCC 6406
ref|WP_015173693.1|  photosystem I protein PsaD                         177   1e-52   Geitlerinema sp. PCC 7407
gb|AIA21513.1|  photosystem I subunit II                                177   1e-52   Pyropia fucicola
ref|YP_008144865.1|  photosystem I reaction center subunit II           176   1e-52   Grateloupia taiwanensis
ref|YP_007947808.1|  photosystem I subunit II                           177   1e-52   Pyropia haitanensis
gb|AFC39948.1|  photosystem I subunit II                                176   2e-52   Porphyra umbilicalis
ref|YP_009029026.1|  photosystem I reaction center subunit II           176   2e-52   Cylindrotheca closterium
ref|WP_015145740.1|  PsaD                                               176   2e-52   Pleurocapsales
ref|YP_001936347.1|  photosystem I subunit II                           176   3e-52   Heterosigma akashiwo
ref|YP_063618.1|  photosystem I subunit II                              176   3e-52   Gracilaria tenuistipitata var. liui
ref|YP_005089671.1|  psaD gene product                                  176   4e-52   Ulnaria acus
ref|YP_008965721.1|  photosystem I reaction center subunit II           176   4e-52   Porphyridium purpureum
ref|YP_874394.1|  photosystem I ferredoxin-binding protein              175   4e-52   Phaeodactylum tricornutum
ref|WP_018400163.1|  Photosystem I reaction center subunit II           175   5e-52   filamentous cyanobacterium ESFC-1
ref|NP_053889.1|  photosystem I subunit II                              175   6e-52   Porphyra purpurea
ref|YP_536961.1|  photosystem I subunit II                              175   6e-52   Pyropia yezoensis
ref|YP_009028878.1|  photosystem I reaction center subunit II           175   6e-52   Coscinodiscus radiatus
ref|YP_009092872.1|  photosystem I subunit II                           175   7e-52   Chaetoceros simplex
ref|YP_009093339.1|  photosystem I subunit II                           174   8e-52   Cerataulina daemon
ref|YP_009059209.1|  photosystem I reaction center subunit II           174   9e-52   Eunotia naegelii
ref|NP_043647.1|  photosystem I subunit II                              174   1e-51   Trieres chinensis
ref|WP_023068767.1|  photosystem I reaction center subunit II           174   1e-51   Lyngbya aestuarii
gb|AIA21307.1|  photosystem I subunit II                                174   1e-51   Pyropia kanakaensis
ref|WP_009787700.1|  photosystem I subunit II                           174   2e-51   Lyngbya sp. PCC 8106
ref|YP_003734986.1|  photosystem I protein subunit II                   174   2e-51   Durinskia baltica
ref|WP_006616635.1|  MULTISPECIES: photosystem I protein PsaD           174   2e-51   Arthrospira
ref|YP_009029302.1|  photosystem I reaction center subunit II           173   2e-51   Leptocylindrus danicus
ref|WP_026795097.1|  MULTISPECIES: Photosystem I reaction center ...    173   3e-51   Planktothrix
gb|AIA20054.1|  photosystem I subunit II                                173   3e-51   Pyropia perforata
ref|YP_003734548.1|  ferredoxin-binding protein II                      173   3e-51   Kryptoperidinium foliaceum
ref|YP_009027562.1|  photosystem I subunit II                           173   3e-51   Pyropia perforata
gb|AHY04349.1|  photosystem I reaction center subunit II                173   4e-51   Chrysochromulina sp. CCMP291
ref|YP_874547.1|  photosystem I ferredoxin-binding protein              172   7e-51   Thalassiosira pseudonana
ref|YP_009029445.1|  photosystem I reaction center subunit II           172   7e-51   Lithodesmium undulatum
ref|WP_017715328.1|  Photosystem I reaction center subunit II           172   9e-51   Oscillatoria sp. PCC 10802
ref|YP_009093464.1|  photosystem I subunit II                           172   1e-50   Conticribra weissflogii
ref|YP_009093018.1|  photosystem I subunit II                           172   1e-50   Rhizosolenia imbricata
ref|YP_009093191.1|  photosystem I subunit II                           172   1e-50   Roundia cardiophora
ref|WP_008189408.1|  PsaD                                               172   1e-50   Moorea producens
sp|O96800.1|PSAD_SKECO  RecName: Full=Photosystem I reaction cent...    171   2e-50   Skeletonema costatum
gb|EHC11738.1|  photosystem I protein PsaD                              172   2e-50   Fischerella thermalis
ref|WP_016872271.1|  MULTISPECIES: Photosystem I reaction center ...    171   2e-50   Fischerella thermalis
ref|YP_277398.1|  photosystem I subunit II                              171   2e-50   Emiliania huxleyi
ref|WP_015195039.1|  photosystem I protein PsaD                         171   2e-50   Stanieria cyanosphaera
ref|WP_036530202.1|  Photosystem I reaction center subunit II           171   3e-50   Neosynechococcus sphagnicola
ref|YP_007878240.1|  photosystem I subunit II                           171   3e-50   Calliarthron tuberculosum
ref|WP_026788324.1|  MULTISPECIES: Photosystem I reaction center ...    171   3e-50   Planktothrix
ref|WP_028824843.1|  Photosystem I reaction center subunit II           170   4e-50   
ref|YP_009051089.1|  photosystem I subunit II                           170   4e-50   Galdieria sulphuraria
gb|AFR24825.1|  photosystem I reaction center subunit II                170   4e-50   uncultured Pelagomonas
ref|YP_009028619.1|  photosystem I reaction center subunit II           170   4e-50   Asterionella formosa
ref|WP_019505782.1|  Photosystem I reaction center subunit II           170   5e-50   Pleurocapsa sp. PCC 7319
ref|WP_044204978.1|  Photosystem I reaction center subunit II           170   5e-50   Coleofasciculus chthonoplastes
ref|WP_017300022.1|  Photosystem I reaction center subunit II           170   6e-50   Nodosilinea nodulosa
ref|WP_035996822.1|  Photosystem I reaction center subunit II           170   6e-50   [Leptolyngbya] sp. JSC-1
ref|WP_015182846.1|  PsaD                                               170   6e-50   Microcoleus sp. PCC 7113
gb|AJH65942.1|  photosystem I reaction center subunit II                170   6e-50   Vertebrata lanosa
gb|EDX77926.1|  photosystem I reaction center subunit II                170   7e-50   Coleofasciculus chthonoplastes PCC 7420
ref|YP_003002181.1|  photosystem I reaction center subunit II           169   7e-50   Aureoumbra lagunensis
ref|YP_003002042.1|  photosystem I reaction center subunit II           169   1e-49   Aureococcus anophagefferens
gb|AIR75448.1|  photosystem I subunit II                                169   1e-49   Cyclotella sp. L04_2
ref|WP_039725494.1|  MULTISPECIES: Photosystem I reaction center ...    169   1e-49   Lyngbya confervoides
ref|WP_017304392.1|  Photosystem I reaction center subunit II           169   2e-49   Spirulina subsalsa
ref|WP_016876091.1|  Photosystem I reaction center subunit II           168   2e-49   Chlorogloeopsis fritschii
ref|WP_013323038.1|  photosystem I protein PsaD                         168   3e-49   Cyanothece sp. PCC 7822
ref|WP_017321535.1|  Photosystem I reaction center subunit II           168   4e-49   cyanobacterium PCC 7702
ref|WP_016866973.1|  Photosystem I reaction center subunit II           167   4e-49   Fischerella muscicola
ref|WP_002738785.1|  photosystem I reaction center subunit II           167   5e-49   Microcystis aeruginosa
dbj|GAL93034.1|  photosystem I subunit II (PsaD)                        167   7e-49   Microcystis aeruginosa NIES-44
ref|WP_002796771.1|  Photosystem I reaction center subunit II           167   7e-49   Microcystis
ref|WP_026733629.1|  Photosystem I reaction center subunit II           167   8e-49   Fischerella sp. PCC 9605
ref|WP_011613167.1|  photosystem I protein PsaD                         167   8e-49   Trichodesmium erythraeum
ref|WP_007305646.1|  Photosystem I protein PsaD                         167   9e-49   Crocosphaera watsonii
ref|WP_017662216.1|  Photosystem I reaction center subunit II           167   1e-48   Geitlerinema sp. PCC 7105
ref|YP_009028747.1|  photosystem I reaction center subunit II           167   1e-48   Asterionellopsis glacialis
ref|WP_007356552.1|  MULTISPECIES: photosystem I protein PsaD           167   1e-48   Kamptonema
ref|WP_010871317.1|  photosystem I subunit II                           166   1e-48   Synechocystis
ref|WP_015956499.1|  photosystem I protein PsaD                         166   1e-48   Cyanothece sp. PCC 7424
ref|WP_035986603.1|  Photosystem I reaction center subunit II           166   2e-48   Leptolyngbya sp. KIOST-1
ref|WP_017288063.1|  Photosystem I reaction center subunit II           166   2e-48   Leptolyngbya boryana
ref|WP_002740397.1|  MULTISPECIES: photosystem I reaction center ...    166   3e-48   Microcystis
ref|WP_026721381.1|  Photosystem I reaction center subunit II           165   3e-48   Hapalosiphonaceae
ref|WP_006530712.1|  PsaD                                               165   3e-48   Gloeocapsa sp. PCC 73106
ref|WP_017309650.1|  Photosystem I reaction center subunit II           165   4e-48   Fischerella sp. PCC 9339
ref|WP_028947468.1|  Photosystem I reaction center subunit II           165   4e-48   Synechocystis sp. PCC 6714
ref|WP_006509381.1|  PsaD                                               165   4e-48   Xenococcus sp. PCC 7305
ref|WP_006632802.1|  photosystem I protein PsaD                         165   5e-48   Microcoleus vaginatus
ref|WP_016924991.1|  Photosystem I reaction center subunit II           165   5e-48   Prochlorothrix hollandica
ref|WP_012593753.1|  MULTISPECIES: photosystem I protein PsaD           164   7e-48   Cyanothece
ref|WP_015157762.1|  PsaD                                               164   9e-48   Chamaesiphon minutus
ref|WP_015222401.1|  photosystem I protein PsaD                         164   9e-48   
ref|YP_004072560.1|  photosystem I reaction center subunit II           164   1e-47   Thalassiosira oceanica CCMP1005
ref|YP_002327575.1|  PSI reaction center subunit II                     164   2e-47   Vaucheria litorea
ref|WP_016859046.1|  Photosystem I reaction center subunit II           163   2e-47   Fischerella muscicola
ref|WP_041622790.1|  Photosystem I reaction center subunit II           163   2e-47   Oscillatoria nigro-viridis
gb|AFZ10051.1|  photosystem I protein PsaD                              163   4e-47   Oscillatoria nigro-viridis PCC 7112
ref|WP_011377824.1|  MULTISPECIES: photosystem I reaction center ...    162   4e-47   Synechococcus
prf||1510177A  photosystem II                                           162   6e-47
ref|WP_009544162.1|  MULTISPECIES: photosystem I protein PsaD           162   6e-47   Cyanothece
ref|WP_015124443.1|  PsaD                                               162   6e-47   Synechococcus sp. PCC 6312
ref|WP_041918842.1|  Photosystem I reaction center subunit II           162   9e-47   
ref|WP_017292752.1|  Photosystem I reaction center subunit II           162   1e-46   Geminocystis herdmanii
gb|AFZ29137.1|  photosystem I protein PsaD                              162   1e-46   Gloeocapsa sp. PCC 7428
gb|ACB50691.1|  photosystem I reaction center subunit II                162   2e-46   Cyanothece sp. ATCC 51142
ref|WP_015231048.1|  PsaD                                               160   2e-46   Dactylococcopsis salina
ref|WP_015224168.1|  photosystem I protein PsaD                         160   3e-46   Halothece sp. PCC 7418
ref|WP_012629607.1|  photosystem I protein PsaD                         160   3e-46   Cyanothece sp. PCC 7425
ref|WP_015221061.1|  photosystem I protein PsaD                         160   4e-46   Cyanobacterium aponinum
gb|AFY74121.1|  PsaD                                                    160   5e-46   Synechococcus sp. PCC 7502
ref|WP_036477609.1|  Photosystem I reaction center subunit II           159   6e-46   Myxosarcina sp. GI1
ref|WP_008272575.1|  photosystem I subunit II                           159   8e-46   Cyanothece sp. CCY0110
gb|EDX84590.1|  photosystem I reaction center subunit II                160   8e-46   Synechococcus sp. PCC 7335
ref|WP_009633578.1|  PsaD                                               159   9e-46   Synechocystis sp. PCC 7509
ref|WP_038016768.1|  Photosystem I reaction center subunit II           159   1e-45   
ref|WP_012165369.1|  photosystem I protein PsaD                         158   2e-45   Acaryochloris marina
ref|WP_010468189.1|  photosystem I protein PsaD                         158   2e-45   Acaryochloris sp. CCMEE 5410
ref|WP_015151596.1|  PsaD                                               158   3e-45   Oscillatoria acuminata
ref|WP_039754673.1|  Photosystem I reaction center subunit II           157   4e-45   
gb|AAP79147.1|  photosystem I protein PsaD                              162   4e-45   Bigelowiella natans
gb|ACF86694.1|  unknown                                                 156   4e-45   Zea mays [maize]
ref|YP_003289238.1|  Photosystem I reaction center subunit II           157   5e-45   Ectocarpus siliculosus
ref|WP_022606580.1|  PsaD                                               157   5e-45   Rubidibacter lacunae
ref|WP_010314860.1|  photosystem I protein PsaD                         157   6e-45   Synechococcus sp. CB0205
sp|P23076.3|PSAD_SYNP6  RecName: Full=Photosystem I reaction cent...    157   7e-45   Synechococcus elongatus PCC 6301
gb|EMT14162.1|  Photosystem I reaction center subunit II, chlorop...    155   8e-45   
ref|WP_027844942.1|  Photosystem I reaction center subunit II           156   9e-45   Mastigocoleus testarum
ref|WP_044290906.1|  Photosystem I reaction center subunit II           156   1e-44   Rivularia sp. PCC 7116
ref|WP_024124772.1|  photosystem I subunit II PsaD                      156   1e-44   Thermosynechococcus sp. NK55a
ref|WP_041039117.1|  Photosystem I reaction center subunit II           156   2e-44   Tolypothrix campylonemoides
gb|ABK96014.1|  unknown                                                 154   2e-44   Populus trichocarpa [western balsam poplar]
gb|AFY55101.1|  PsaD                                                    156   3e-44   Rivularia sp. PCC 7116
ref|WP_029637180.1|  Photosystem I reaction center subunit II [         155   4e-44   [Scytonema hofmanni] UTEX B 1581
ref|NP_849051.1|  photosystem I subunit II                              155   5e-44   Cyanidioschyzon merolae strain 10D
ref|WP_040938870.1|  Photosystem I reaction center subunit II           154   6e-44   
ref|WP_040933357.1|  Photosystem I reaction center subunit II           154   7e-44   
gb|AIA61184.1|  photosystem I subunit II (chloroplast)                  154   8e-44   
ref|WP_040944569.1|  Photosystem I reaction center subunit II           154   8e-44   
ref|WP_011057561.1|  photosystem I subunit II                           154   9e-44   
pdb|1JB0|D  Chain D, Crystal Structure Of Photosystem I: A Photos...    154   9e-44   
gb|KIE10409.1|  Photosystem I reaction center subunit II                154   1e-43   
ref|WP_017744641.1|  Photosystem I reaction center subunit II           154   1e-43   
ref|WP_017317314.1|  Photosystem I reaction center subunit II           154   1e-43   
ref|WP_013192195.1|  photosystem I protein PsaD                         154   1e-43   
ref|NP_045207.1|  photosystem I subunit II                              154   1e-43   
gb|ACF24542.1|  photosystem I reaction center subunit II                158   1e-43   
gb|KIJ85471.1|  Photosystem I reaction center subunit II                153   1e-43   
ref|YP_005090043.1|  psaD gene product                                  153   2e-43   
ref|YP_007476277.1|  photosystem I reaction center subunit II (fe...    154   2e-43   
ref|WP_038000832.1|  Photosystem I reaction center subunit II           153   2e-43   
ref|WP_006910658.1|  photosystem I reaction center subunit II           153   3e-43   
gb|EAQ68518.1|  photosystem I reaction center subunit II (PsaD)         152   3e-43   
ref|WP_023071664.1|  photosystem i protein                              152   4e-43   
ref|WP_006173380.1|  photosystem I reaction center subunit II (PsaD)    152   4e-43   
ref|WP_006275750.1|  MULTISPECIES: Photosystem I protein PsaD           152   4e-43   
ref|WP_009626149.1|  photosystem I protein PsaD                         152   6e-43   
ref|YP_002049251.1|  Photosystem I reaction center subunit II (PsaD)    152   7e-43   
ref|YP_006639027.1|  photosystem I ferredoxin-binding protein           151   8e-43   
ref|WP_035831507.1|  Photosystem I reaction center subunit II           151   1e-42   
ref|WP_041430107.1|  Photosystem I reaction center subunit II           150   1e-42   
ref|WP_010994505.1|  photosystem I reaction center subunit II           150   2e-42   
ref|WP_011377212.1|  photosystem I protein PsaD                         150   3e-42   
ref|WP_010311728.1|  photosystem I protein PsaD                         150   4e-42   
ref|WP_032521962.1|  Photosystem I reaction center subunit II           150   4e-42   
ref|WP_028083790.1|  Photosystem I reaction center subunit II           149   4e-42   
sp|P56596.1|PSAD_NOSS8  RecName: Full=Photosystem I reaction cent...    149   6e-42   
gb|AAD38699.1|AF148503_2  photosystem I accessory protein D             149   6e-42   
ref|WP_007099913.1|  photosystem I reaction center subunit II (PsaD)    149   6e-42   
ref|WP_006198574.1|  photosystem I reaction center subunit II           149   6e-42   
ref|WP_025927078.1|  Photosystem I reaction center subunit II           149   7e-42   
ref|WP_041225999.1|  Photosystem I reaction center subunit II           149   8e-42   
ref|WP_025915179.1|  Photosystem I reaction center subunit II           149   8e-42   
ref|WP_026032399.1|  Photosystem I reaction center subunit II           149   9e-42   
ref|WP_025954911.1|  Photosystem I reaction center subunit II           149   9e-42   
gb|AFZ12711.1|  photosystem I protein PsaD                              149   9e-42   
ref|WP_025956224.1|  Photosystem I reaction center subunit II           149   1e-41   
ref|WP_011863680.1|  MULTISPECIES: photosystem I protein PsaD           149   1e-41   
ref|WP_012306311.1|  MULTISPECIES: photosystem I subunit II             149   1e-41   
ref|WP_006042180.1|  photosystem I reaction center subunit II (PsaD)    149   1e-41   
ref|WP_019502597.1|  hypothetical protein                               148   1e-41   
gb|ABE11137.1|  photosystem I protein PsaD                              149   1e-41   
ref|WP_011932371.1|  photosystem I reaction center subunit II           149   1e-41   
ref|WP_015215982.1|  photosystem I protein PsaD                         148   1e-41   
ref|WP_025937671.1|  MULTISPECIES: Photosystem I reaction center ...    148   1e-41   
ref|WP_028090681.1|  Photosystem I reaction center subunit II           148   1e-41   
ref|WP_032526300.1|  Photosystem I reaction center subunit II           148   2e-41   
ref|WP_024544608.1|  Photosystem I reaction center subunit II           148   2e-41   
ref|WP_019493410.1|  Photosystem I reaction center subunit II           148   2e-41   
ref|WP_011321384.1|  photosystem I protein PsaD                         148   2e-41   
ref|WP_038547798.1|  Photosystem I reaction center subunit II           148   2e-41   
ref|WP_025889562.1|  MULTISPECIES: Photosystem I reaction center ...    148   2e-41   
ref|WP_032513725.1|  Photosystem I reaction center subunit II           148   2e-41   
ref|WP_042851104.1|  Photosystem I reaction center subunit II           148   2e-41   
ref|WP_025943071.1|  Photosystem I reaction center subunit II           148   2e-41   
ref|WP_011819190.1|  photosystem I protein PsaD                         147   3e-41   
ref|NP_001104945.1|  photosystem I subunit d1                           147   3e-41   
ref|WP_016953057.1|  Photosystem I reaction center subunit II           147   3e-41   
ref|WP_015136451.1|  PsaD                                               147   3e-41   
gb|AII42441.1|  Photosystem I reaction center subunit II                148   3e-41   
ref|WP_032517906.1|  Photosystem I reaction center subunit II           147   3e-41   
ref|WP_015109263.1|  PsaD                                               147   3e-41   
ref|WP_011133206.1|  photosystem I protein PsaD                         147   3e-41   
ref|WP_019477882.1|  MULTISPECIES: Photosystem I reaction center ...    147   3e-41   
ref|WP_028953660.1|  Photosystem I reaction center subunit II           147   4e-41   
ref|WP_025930967.1|  Photosystem I reaction center subunit II           147   4e-41   
ref|WP_011821058.1|  photosystem I protein PsaD                         147   4e-41   
ref|WP_015079642.1|  MULTISPECIES: photosystem I protein PsaD           147   4e-41   
ref|WP_011433827.1|  photosystem I reaction center subunit II           147   5e-41   
ref|WP_019474331.1|  MULTISPECIES: Photosystem I reaction center ...    147   5e-41   
ref|WP_025928909.1|  Photosystem I reaction center subunit II           147   7e-41   
ref|WP_025781322.1|  Photosystem I reaction center subunit II           146   7e-41   
ref|WP_006516877.1|  PsaD protein                                       146   8e-41   
ref|WP_043694980.1|  Photosystem I reaction center subunit II           146   9e-41   
ref|WP_002807018.1|  MULTISPECIES: photosystem I reaction center ...    146   1e-40   
ref|WP_025934063.1|  Photosystem I reaction center subunit II           145   1e-40   
ref|WP_011618423.1|  photosystem I reaction center subunit II           145   2e-40   
ref|WP_012196249.1|  photosystem I protein PsaD                         145   2e-40   
ref|WP_036900706.1|  Photosystem I reaction center subunit II           145   2e-40   
ref|WP_025943458.1|  Photosystem I reaction center subunit II           145   3e-40   
sp|P23808.1|PSAD_MICDP  RecName: Full=Photosystem I reaction cent...    145   3e-40   
ref|WP_015112247.1|  photosystem I protein PsaD                         144   4e-40   
ref|WP_025935474.1|  Photosystem I reaction center subunit II           144   4e-40   
gb|KCW60797.1|  hypothetical protein EUGRSUZ_H03534                     146   4e-40   
ref|WP_012411433.1|  photosystem I protein PsaD                         144   5e-40   
ref|XP_010497891.1|  PREDICTED: photosystem I reaction center sub...    142   6e-40   
ref|WP_011128902.1|  photosystem I reaction center subunit II (PsaD)    144   9e-40   
ref|WP_015208523.1|  PsaD                                               144   9e-40   
ref|WP_011363412.1|  MULTISPECIES: photosystem I reaction center ...    144   1e-39   
ref|WP_035155503.1|  Photosystem I reaction center subunit II           144   1e-39   
ref|WP_011131077.1|  photosystem I protein PsaD                         143   1e-39   
gb|AHF62815.1|  photosystem I reaction center subunit II (PsaD)         144   1e-39   
ref|WP_011936501.1|  photosystem I reaction center subunit II           143   1e-39   
ref|WP_036919402.1|  MULTISPECIES: Photosystem I reaction center ...    143   2e-39   
ref|WP_036911259.1|  MULTISPECIES: Photosystem I reaction center ...    143   2e-39   
ref|WP_011826874.1|  photosystem I protein PsaD                         141   7e-39   
ref|WP_017651861.1|  Photosystem I reaction center subunit II           141   7e-39   
gb|AAB51150.1|  subunit II of photosystem I                             140   7e-39   
ref|WP_015127985.1|  photosystem I protein PsaD                         141   8e-39   
ref|WP_037220235.1|  Photosystem I reaction center subunit II           140   1e-38   
ref|WP_038014855.1|  Photosystem I reaction center subunit II           140   3e-38   
ref|WP_009788961.1|  photosystem I reaction center subunit II (PsaD)    139   4e-38   
ref|WP_011360689.1|  photosystem I reaction center subunit II (PsaD)    139   4e-38   
ref|WP_011125882.1|  MULTISPECIES: photosystem I protein PsaD           139   5e-38   
ref|WP_015134252.1|  photosystem I protein PsaD                         139   8e-38   
gb|ABC98753.1|  photosystem I reaction center subunit II                138   1e-37   
ref|WP_015164131.1|  photosystem I protein PsaD                         138   2e-37   
ref|WP_041438839.1|  Photosystem I reaction center subunit II           138   2e-37   
emb|CDN13363.1|  photosystem I subunit II (PsaD)                        137   2e-37   
ref|WP_015156676.1|  MULTISPECIES: photosystem I protein PsaD           137   5e-37   
ref|WP_040054753.1|  Photosystem I reaction center subunit II           136   7e-37   
ref|WP_012953669.1|  photosystem I reaction center subunit II PsaD      135   1e-36   
ref|WP_011143690.1|  photosystem I reaction centre subunit II           135   2e-36   
ref|YP_003795447.1|  photosystem I subunit II                           133   8e-36   
ref|WP_017327440.1|  hypothetical protein                               133   1e-35   
emb|CBI26230.3|  unnamed protein product                                132   3e-35   
ref|WP_023171757.1|  photosystem I protein PsaD                         132   4e-35   
ref|WP_008235951.1|  photosystem I subunit II (PsaD)                    130   1e-34   
ref|WP_008224714.1|  photosystem I subunit II (PsaD)                    130   1e-34   
pir||PL0034  photosystem I chain II - Synechococcus sp. (PCC 6301...    127   9e-34
gb|AGI04047.1|  photosystem I subunit II                                126   3e-33   
ref|YP_007317065.1|  photosystem I reaction center subunit II           127   3e-33   
ref|YP_008519723.1|  photosystem I reaction center subunit II           126   4e-33   
ref|YP_008519970.1|  photosystem I reaction center subunit II           125   2e-32   
ref|YP_008520096.1|  photosystem I reaction center subunit II           125   2e-32   
gb|KEI67811.1|  PsaD                                                    122   8e-32   
emb|CDY22079.1|  BnaA09g01080D                                          123   1e-31   
ref|WP_038654413.1|  Photosystem I reaction center subunit II           120   8e-31   
ref|WP_011295494.1|  photosystem I protein PsaD                         119   4e-30   
ref|WP_015196995.1|  photosystem I protein PsaD                         118   7e-30   
gb|ABQ52912.1|  photosystem I reaction center subunit II                115   2e-29   
gb|ABQ52913.1|  photosystem I reaction center subunit II                114   3e-29   
gb|ABQ52919.1|  photosystem I reaction center subunit II                114   4e-29   
gb|ABQ52926.1|  photosystem I reaction center subunit II                114   6e-29   
gb|ABQ52927.1|  photosystem I reaction center subunit II                113   9e-29   
gb|ABQ52911.1|  photosystem I reaction center subunit II                113   9e-29   
gb|ABQ52930.1|  photosystem I reaction center subunit II                112   1e-28   
gb|ABQ52922.1|  photosystem I reaction center subunit II                112   3e-28   
gb|ABQ52924.1|  photosystem I reaction center subunit II                112   3e-28   
gb|ABQ52929.1|  photosystem I reaction center subunit II                111   4e-28   
gb|ABQ52910.1|  photosystem I reaction center subunit II                111   4e-28   
gb|ABQ52932.1|  photosystem I reaction center subunit II                111   5e-28   
gb|ABQ52931.1|  photosystem I reaction center subunit II                111   5e-28   
gb|ACO90365.1|  PsaD                                                    102   4e-24   
ref|WP_025900916.1|  Photosystem I reaction center subunit II           102   4e-24   
gb|ACG50087.1|  PsaD                                                    100   5e-23   
dbj|BAD78733.1|  photosystem I reaction center subunit II             98.6    1e-22   
ref|WP_025939988.1|  MULTISPECIES: Photosystem I reaction center ...  94.0    3e-21   
dbj|BAJ87604.1|  predicted protein                                    84.3    2e-16   
gb|ACT34029.1|  PsaD                                                  82.4    2e-16   
ref|WP_025921633.1|  hypothetical protein                             63.5    3e-10   
gb|ACA96901.1|  chloroplast photosystem I subunit D-2                 63.5    4e-10   
gb|ACA96900.1|  chloroplast photosystem I subunit D-2                 63.9    4e-10   
gb|ACA96899.1|  chloroplast photosystem I subunit D-2                 63.5    5e-10   
gb|ACA96898.1|  chloroplast photosystem I subunit D-2                 63.5    5e-10   
ref|WP_029983812.1|  Photosystem I reaction center subunit II         62.0    8e-10   
ref|WP_029980174.1|  Photosystem I reaction center subunit II         59.3    9e-09   
ref|XP_003083422.1|  PSI reaction center, subunit II (ISS)            57.0    1e-07   
sp|P84563.1|PSAD_POPEU  RecName: Full=Photosystem I reaction cent...  53.1    1e-06   
ref|XP_003083423.1|  Photosystem I subunit II, chloroplast precur...  53.1    9e-06   



>ref|XP_009795521.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nicotiana sylvestris]
 sp|P29302.1|PSAD_NICSY RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Nicotiana sylvestris]
 emb|CAA42623.1| PSI-D2 [Nicotiana sylvestris]
Length=204

 Score =   275 bits (704),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 160/191 (84%), Gaps = 9/191 (5%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF   LSA K +A     PWKQSL  FS  P+ L  + +AP RPIRAMAEE      
Sbjct  6    QASLFTPALSAPKSSA-----PWKQSLASFS--PKQLKSTVSAP-RPIRAMAEEAATKEA  57

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            +  PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  58   EA-PVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIM  116

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REGANLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVYPEKVNAGR+
Sbjct  117  REGANLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKVNAGRQ  176

Query  543  GVGQNMRSIGN  575
            GVGQN RSIG 
Sbjct  177  GVGQNFRSIGK  187



>ref|XP_009621208.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nicotiana tomentosiformis]
Length=207

 Score =   275 bits (702),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 164/193 (85%), Gaps = 10/193 (5%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF   LSA K ++     PWKQSL  FS  P+ L  + +AP RPIRAMAEE   A T
Sbjct  6    QASLFTPALSAPKSSS-----PWKQSLASFS--PKQLKSTVSAP-RPIRAMAEEAAAAAT  57

Query  183  kea--PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAA  356
            KEA  PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAA
Sbjct  58   KEAEAPVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAA  117

Query  357  IMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAG  536
            IMREGANLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVYPEKVNAG
Sbjct  118  IMREGANLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKVNAG  177

Query  537  REGVGQNMRSIGN  575
            R+GVGQN RSIG 
Sbjct  178  RQGVGQNFRSIGK  190



>ref|XP_004241054.2| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Solanum lycopersicum]
 sp|P12372.1|PSAD_SOLLC RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAA34185.1| photosystem I subunit II protein precursor [Solanum lycopersicum]
 prf||1601516A photosystem I reaction center II
Length=208

 Score =   273 bits (699),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 158/192 (82%), Gaps = 7/192 (4%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF  PLS  K        PWKQSL  FS  P+ L KST +  RPIRAMAEE   A  
Sbjct  6    QASLFTPPLSVPKSTTA----PWKQSLVSFST-PKQL-KSTVSVTRPIRAMAEEAPAATE  59

Query  183  ke-aPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAI  359
            ++ AP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAI
Sbjct  60   EKPAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAI  119

Query  360  MREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  539
            MR+G NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN GR
Sbjct  120  MRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGR  179

Query  540  EGVGQNMRSIGN  575
            EGVGQN RSIG 
Sbjct  180  EGVGQNFRSIGK  191



>ref|XP_006356675.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Solanum tuberosum]
 emb|CAD89270.1| putative photosystem I reaction centre PSI-D subunit precursor 
[Solanum tuberosum]
Length=207

 Score =   271 bits (694),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 158/192 (82%), Gaps = 8/192 (4%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF   LS  K  A     PWKQSL  FS  P+ L KST +  RPIRAMAEE   A  
Sbjct  6    QASLFTPALSVPKSTA-----PWKQSLLSFST-PKQL-KSTVSVTRPIRAMAEEAPAATE  58

Query  183  ke-aPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAI  359
            ++ AP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAI
Sbjct  59   EKPAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAI  118

Query  360  MREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  539
            MREG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN GR
Sbjct  119  MREGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGR  178

Query  540  EGVGQNMRSIGN  575
            EGVGQN RSIG 
Sbjct  179  EGVGQNFRSIGK  190



>ref|XP_009799304.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA02871.1| PSI-D1 precursor [Nicotiana sylvestris]
Length=214

 Score =   268 bits (684),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 162/195 (83%), Gaps = 7/195 (4%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF   +S +K A  RV APWKQS   FS  P+ L+KS  A  RPI+AMA E  ++ T
Sbjct  6    QASLFTPSISTSKTADPRVVAPWKQSASSFSA-PK-LSKSVVA-YRPIKAMAVEKAQSAT  62

Query  183  k----eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGG  350
            K     APVGFTPP LDP+TPSPIFGGSTGGLLRKAQV+EFYVITW SPKEQIFEMPTGG
Sbjct  63   KEAEPAAPVGFTPPQLDPSTPSPIFGGSTGGLLRKAQVDEFYVITWESPKEQIFEMPTGG  122

Query  351  AAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN  530
            AAIMREG NLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVYPEKVN
Sbjct  123  AAIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKVN  182

Query  531  AGREGVGQNMRSIGN  575
             GR+GVGQN RSIG 
Sbjct  183  PGRQGVGQNFRSIGK  197



>ref|XP_011071575.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Sesamum indicum]
Length=213

 Score =   266 bits (679),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 159/195 (82%), Gaps = 3/195 (2%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF   LSAAKPA    A PWKQS+  FS     +    +   RPIRAMAEE   A  
Sbjct  6    QASLFTPTLSAAKPADRVAA-PWKQSIAQFSTPKAPIKGVASVSHRPIRAMAEEAPAATK  64

Query  183  k-eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAI  359
            + EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAI
Sbjct  65   EPEAPAGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQVFEMPTGGAAI  124

Query  360  MREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  539
            MR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR
Sbjct  125  MRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGR  184

Query  540  EGVGQNMRSIG-NIS  581
             GVGQNMRSIG N+S
Sbjct  185  TGVGQNMRSIGKNVS  199



>ref|XP_009366924.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=213

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF    S  K  ADR  APWKQS+    + P+ L  STT   R   +  E+T     
Sbjct  6    QASLFTPTPSVPKTIADRTTAPWKQSVSSSFMAPKPLKLSTTRTMRINASAEEKTVTPTK  65

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            +EAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  66   EEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTGGAAIM  125

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  126  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  185

Query  543  GVGQNMRSIGN  575
            GVGQN RSIG 
Sbjct  186  GVGQNFRSIGK  196



>ref|XP_008376830.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Malus domestica]
Length=212

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 157/194 (81%), Gaps = 2/194 (1%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF    SA K  ADR   PWKQS+    + P+ L  ST    R I A AEE T  PT
Sbjct  6    QASLFTPTPSAPKTTADRTTTPWKQSVSSSFMAPKPLKLSTARTMR-INASAEEKTVTPT  64

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  65   KEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTGGAAIM  124

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  125  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  184

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  185  GVGQNFRSIGKNVS  198



>ref|XP_008340966.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Malus domestica]
Length=213

 Score =   265 bits (678),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF    S  K  ADR  APWKQS+    + P+ L  STT   R   +  E+T     
Sbjct  6    QASLFTPTPSVPKTTADRTTAPWKQSVSSSFMPPKPLKLSTTRTMRINASAEEKTVTTTK  65

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            +EAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  66   EEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTGGAAIM  125

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  126  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  185

Query  543  GVGQNMRSIGN  575
            GVGQN RSIG 
Sbjct  186  GVGQNFRSIGK  196



>gb|EYU41499.1| hypothetical protein MIMGU_mgv1a013699mg [Erythranthe guttata]
Length=212

 Score =   265 bits (677),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 155/192 (81%), Gaps = 3/192 (2%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF   LS  K      A PWKQSL  FS V + +  ++    RPIRAMA+E   A  
Sbjct  6    QASLFTPTLSGPKSGDRAAA-PWKQSLAQFSAV-KPMKGASAVSHRPIRAMADEAPAATK  63

Query  183  k-eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAI  359
            + EAP GFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAI
Sbjct  64   EPEAPAGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPTGGAAI  123

Query  360  MREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  539
            MR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR
Sbjct  124  MRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  183

Query  540  EGVGQNMRSIGN  575
             GVG NMRSIG 
Sbjct  184  TGVGLNMRSIGK  195



>ref|XP_011090732.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Sesamum indicum]
Length=215

 Score =   264 bits (675),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 161/198 (81%), Gaps = 7/198 (4%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF   LS  K A   VA PWKQSL  FS  P+ +  ++    RPIRAMAEE   A  
Sbjct  6    QASLFTPTLSGPKSADRVVA-PWKQSLAQFST-PKPMKVASAVAHRPIRAMAEEAPPATK  63

Query  183  k-eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAI  359
            + EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAI
Sbjct  64   EPEAPAGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPTGGAAI  123

Query  360  MREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  539
            MR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR
Sbjct  124  MRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  183

Query  540  EGVG---QNMRSIG-NIS  581
             GVG   QNMRSIG N+S
Sbjct  184  TGVGQNMQNMRSIGKNVS  201



>ref|XP_003556041.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Glycine max]
 gb|KHN15781.1| Photosystem I reaction center subunit II, chloroplastic [Glycine 
soja]
Length=203

 Score =   263 bits (673),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 155/194 (80%), Gaps = 11/194 (6%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF  PLS  KP+    A PWKQS          L+ ST+ P +  R +    T+  T
Sbjct  6    QASLFTPPLSGLKPSDRATA-PWKQS--------STLSFSTSKPLKFSRTIRAAATDQTT  56

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            +  PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  57   EA-PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIM  115

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+
Sbjct  116  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQ  175

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  176  GVGQNFRSIGKNVS  189



>ref|XP_007143239.1| hypothetical protein PHAVU_007G055900g [Phaseolus vulgaris]
 gb|ESW15233.1| hypothetical protein PHAVU_007G055900g [Phaseolus vulgaris]
Length=207

 Score =   263 bits (673),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 157/194 (81%), Gaps = 7/194 (4%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF  P S  K +      PWKQS       P+ L  S T     IRA A+ET EA T
Sbjct  6    QASLFTPPFSGLKLSDRASV-PWKQSPTFSFTSPKPLKLSKT-----IRAAADETAEAAT  59

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  60   KEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIM  119

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  120  REGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  179

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  180  GVGQNFRSIGKNVS  193



>gb|AGV54746.1| photosystem I reaction center subunit II chloroplastic-like protein 
[Phaseolus vulgaris]
Length=207

 Score =   263 bits (673),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 158/194 (81%), Gaps = 7/194 (4%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF  P S  KP+      PWKQS       P+ L  S T     IRA A+ET EA T
Sbjct  6    QASLFTPPFSGLKPSDRASV-PWKQSPTFSFTSPKPLKLSKT-----IRAAADETAEAAT  59

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  60   KEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIM  119

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  120  REGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  179

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  180  GVGQNFRSIGKNVS  193



>ref|XP_008224535.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Prunus mume]
Length=213

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/191 (76%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QA+LF    SA K + +R   PWKQS+    + P+ L  S+T     I A AEE T AP 
Sbjct  6    QATLFTPTPSAPKTSVERSTVPWKQSVSSSFMAPKPLMLSSTTRTMRINAAAEEKTVAPP  65

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  66   KEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTGGAAIM  125

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  126  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  185

Query  543  GVGQNMRSIGN  575
            GVGQN RSIG 
Sbjct  186  GVGQNFRSIGK  196



>ref|XP_004296896.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=205

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 143/176 (81%), Gaps = 5/176 (3%)
 Frame = +3

Query  66   PWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeette---aptkeaPVGFTPPTLDPNTPS  236
            PWKQS+    + P+ L  ST A  RP+R  A E          EAPVGFTPP LDP TPS
Sbjct  17   PWKQSVTSTFMAPKSLTLSTVA-SRPMRISAAEEKTVAPTKEAEAPVGFTPPELDPTTPS  75

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            PIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLAL
Sbjct  76   PIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLAL  135

Query  417  GTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            GTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN RSIG N+S
Sbjct  136  GTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQNFRSIGKNVS  191



>ref|XP_006419899.1| hypothetical protein CICLE_v10005892mg [Citrus clementina]
 ref|XP_006489366.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Citrus sinensis]
 dbj|BAF80470.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80477.1| PSI reaction center subunit II [Citrus sinensis]
 gb|ESR33139.1| hypothetical protein CICLE_v10005892mg [Citrus clementina]
 gb|KDO74646.1| hypothetical protein CISIN_1g028581mg [Citrus sinensis]
Length=207

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 159/194 (82%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLFA     A  +  + +APWKQS   FSV P   N   T     I+AMAE  TE PT
Sbjct  8    QASLFAP----ANFSTTKSSAPWKQS-SSFSVRPLKHNAPRT---NTIKAMAEGKTETPT  59

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  60   KEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIM  119

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GRE
Sbjct  120  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRE  179

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  180  GVGQNYRSIGKNVS  193



>ref|NP_001275862.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80475.1| PSI reaction center subunit II [Citrus sinensis]
Length=207

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 159/194 (82%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLFA     A  +  + +APWKQS   FSV P   N   T     I+AMAE  TE PT
Sbjct  8    QASLFAP----ANFSTTKSSAPWKQS-SSFSVRPLKHNAPRT---NTIKAMAEGKTETPT  59

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  60   KEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIM  119

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GRE
Sbjct  120  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRE  179

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  180  GVGQNYRSIGKNVS  193



>ref|XP_010035248.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84226.1| hypothetical protein EUGRSUZ_B01088 [Eucalyptus grandis]
Length=214

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 153/196 (78%), Gaps = 4/196 (2%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLH--CFSVVPRGLNKSTTAPCRPIRamaeettea  176
            QASLF   L+A K   DRV APWKQS     F+  P+    S     R   A   +    
Sbjct  6    QASLFTPALAAPKSGVDRVIAPWKQSASSLAFAATPKAAKSSPRTAIR-AAAAEGKAEAP  64

Query  177  ptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAA  356
              +EAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAA
Sbjct  65   VKEEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAA  124

Query  357  IMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAG  536
            IMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN G
Sbjct  125  IMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNKG  184

Query  537  REGVGQNMRSIG-NIS  581
            R+GVGQN RSIG N+S
Sbjct  185  RQGVGQNFRSIGKNVS  200



>gb|EYU45647.1| hypothetical protein MIMGU_mgv1a013850mg [Erythranthe guttata]
Length=209

 Score =   261 bits (668),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 161/196 (82%), Gaps = 9/196 (5%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QA+LFA+ +SA + AA     PWKQSL  FS   + + KS  A  RPIRAMAE+   A T
Sbjct  6    QATLFAATISADRVAA-----PWKQSLAQFSTATKPIIKSA-ATHRPIRAMAEDAPAAAT  59

Query  183  ke--aPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAA  356
            KE  AP GFTPP LDP TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAA
Sbjct  60   KEPEAPAGFTPPELDPTTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPTGGAA  119

Query  357  IMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAG  536
            IMR+G NLLKLARKEQCLALGT+LRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN G
Sbjct  120  IMRQGPNLLKLARKEQCLALGTKLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPG  179

Query  537  REGVGQNMRSIG-NIS  581
            R GVG NMRSIG N+S
Sbjct  180  RTGVGLNMRSIGKNVS  195



>ref|XP_010277521.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nelumbo nucifera]
Length=213

 Score =   261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/197 (75%), Positives = 154/197 (78%), Gaps = 7/197 (4%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVV-PRGLNKSTTAPCRPIRamaeetteap  179
            QA+LF   LSA K     +  PWK S    S + PR LN S     R IRA A +     
Sbjct  6    QAALFTPTLSAPKSGNRALV-PWKPSSTSLSFISPRPLNLSVAQ--RTIRAAAADEKTEA  62

Query  180  --tkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  353
                EAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGA
Sbjct  63   PPAAEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGA  122

Query  354  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  533
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNA
Sbjct  123  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNA  182

Query  534  GREGVGQNMRSIG-NIS  581
            GR+GVGQN RSIG N+S
Sbjct  183  GRQGVGQNFRSIGKNVS  199



>ref|XP_009588197.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=209

 Score =   261 bits (666),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 156/195 (80%), Gaps = 12/195 (6%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF   +S  K AA     PWKQS+  FS  P+      T   RPI+A A+E  ++ T
Sbjct  6    QASLFTPSISGPKTAA-----PWKQSVSSFSA-PKPSKSGVT--YRPIKATADEKAQSAT  57

Query  183  k----eaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGG  350
            K     APVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGG
Sbjct  58   KEAELAAPVGFTPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGG  117

Query  351  AAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN  530
            AAIMREG NLLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHPKDGVYPEKVN
Sbjct  118  AAIMREGPNLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKVN  177

Query  531  AGREGVGQNMRSIGN  575
             GR+GVGQN RSIG 
Sbjct  178  PGRQGVGQNFRSIGK  192



>ref|NP_001235355.1| photosystem I subunit PsaD [Glycine max]
 gb|ABQ63097.1| photosystem I subunit PsaD [Glycine max]
 gb|ACU14192.1| unknown [Glycine max]
Length=210

 Score =   261 bits (666),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 149/194 (77%), Gaps = 4/194 (2%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASL   PLS  K +      PWKQ+       P+ L  S T   R   A       A  
Sbjct  6    QASLLTPPLSGLKASDRASV-PWKQNSSLSFSSPKPLKFSRT--IRAAAADETTEAPAKV  62

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            + APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  63   EAAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIM  122

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+
Sbjct  123  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQ  182

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  183  GVGQNFRSIGKNVS  196



>emb|CDY21916.1| BnaC09g00220D [Brassica napus]
Length=281

 Score =   262 bits (669),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK NAGREGVG
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANAGREGVG  185

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  186  QNMRSIGKNVS  196



>ref|XP_009344083.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Pyrus x bretschneideri]
Length=210

 Score =   259 bits (662),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 157/194 (81%), Gaps = 2/194 (1%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF    SA K  ADR  APW+QS+    +  + L  ST    R I A AEE T  PT
Sbjct  4    QASLFTPTPSAPKTPADRTTAPWRQSVFSSFMALKPLKLSTARTVR-INASAEEKTVTPT  62

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  63   KEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFYVITWESPKEQIFEMPTGGAAIM  122

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  123  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  182

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  183  GVGQNFRSIGKNVS  196



>gb|ABK96621.1| unknown [Populus trichocarpa x Populus deltoides]
Length=201

 Score =   259 bits (661),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 150/196 (77%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQS--LHCFSVVPRGLNKSTTAPCRPIRamaeettea  176
            QASLF  P  +   ++++  APWKQS  L   +V P+   K   A    ++         
Sbjct  4    QASLFTPPTLSTLKSSNQAIAPWKQSSFLPISNVKPQRTMKVAAAEETAVKEA-------  56

Query  177  ptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAA  356
                 PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAA
Sbjct  57   -----PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAA  111

Query  357  IMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAG  536
            IMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN G
Sbjct  112  IMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPG  171

Query  537  REGVGQNMRSIG-NIS  581
            R+GVGQN RSIG N+S
Sbjct  172  RQGVGQNFRSIGKNVS  187



>ref|XP_010474926.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic 
[Camelina sativa]
Length=207

 Score =   259 bits (661),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 142/173 (82%), Gaps = 4/173 (2%)
 Frame = +3

Query  75   QSLHCFSVV--PRGLNKSTTA-PCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIF  245
            + LH FS    P+ L+ + TA       + +     A  +EAPVGFTPP LDPNTPSPIF
Sbjct  21   KKLHLFSTSHRPKSLSYTKTAIRAEKTDSSSAAPATAVKEEAPVGFTPPQLDPNTPSPIF  80

Query  246  GGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTR  425
             GSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTR
Sbjct  81   AGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTR  140

Query  426  LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            LRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVGQNMRSIG N+S
Sbjct  141  LRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGQNMRSIGKNVS  193



>ref|XP_009111256.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic 
[Brassica rapa]
Length=208

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/131 (95%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  64   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  123

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK NAGREGVG
Sbjct  124  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANAGREGVG  183

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  184  QNMRSIGKNVS  194



>ref|XP_003610706.1| Photosystem I reaction center subunit II [Medicago truncatula]
 gb|AES93664.1| photosystem I reaction center subunit II [Medicago truncatula]
 gb|AFK47938.1| unknown [Medicago truncatula]
Length=209

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 150/198 (76%), Gaps = 13/198 (7%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQ--SLHCFSVVPRGLNKSTT--APCRPIRamaeett  170
            QASLF  PLS+ K        PWKQ  +L   S+ P      TT  +        A  TT
Sbjct  6    QASLFTPPLSSPK--------PWKQPSTLSFISLKPIKFTTKTTKISAADEKTEAASVTT  57

Query  171  eaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGG  350
            +     APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGG
Sbjct  58   KEEAPAAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGG  117

Query  351  AAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN  530
            AAIMREG NLLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN
Sbjct  118  AAIMREGPNLLKLARKEQCLALGNRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVN  177

Query  531  AGREGVGQNMRSIG-NIS  581
             GR+GVGQN RSIG N+S
Sbjct  178  PGRQGVGQNFRSIGKNVS  195



>ref|XP_006306434.1| hypothetical protein CARUB_v10012376mg [Capsella rubella]
 gb|EOA39332.1| hypothetical protein CARUB_v10012376mg [Capsella rubella]
Length=206

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 142/173 (82%), Gaps = 4/173 (2%)
 Frame = +3

Query  75   QSLHCFSVV--PRGLNKSTTA-PCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIF  245
            + LH FS    P+ L+ + TA       + +     A  ++APVGFTPP LDPNTPSPIF
Sbjct  20   KKLHLFSTSHRPKSLSFTKTAIRAEKTDSSSGAPAAAVKEDAPVGFTPPQLDPNTPSPIF  79

Query  246  GGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTR  425
             GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTR
Sbjct  80   AGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTR  139

Query  426  LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N GREGVGQNMRSIG N+S
Sbjct  140  LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGQNMRSIGKNVS  192



>ref|XP_002281825.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Vitis vinifera]
 emb|CAN62373.1| hypothetical protein VITISV_036477 [Vitis vinifera]
Length=204

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 147/191 (77%), Gaps = 9/191 (5%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF   LS  +        PWK S       P+ L KS+ AP   IRAMAEE      
Sbjct  6    QASLFTPTLSGDRVTV-----PWKSSSSLSFTTPK-LPKSSVAPRTTIRAMAEEAPTKEA  59

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
               PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  60   ---PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIM  116

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            R+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  117  RQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  176

Query  543  GVGQNMRSIGN  575
            GVG N RSIG 
Sbjct  177  GVGVNFRSIGK  187



>ref|XP_002315779.1| photosystem I 20kD family protein [Populus trichocarpa]
 gb|ABK95430.1| unknown [Populus trichocarpa]
 gb|ABK95668.1| unknown [Populus trichocarpa]
 gb|EEF01950.1| photosystem I 20kD family protein [Populus trichocarpa]
Length=201

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 149/196 (76%), Gaps = 15/196 (8%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQS--LHCFSVVPRGLNKSTTAPCRPIRamaeettea  176
            QASLF  P  +   ++++   PWKQ+  L   +V P+   K   A    ++         
Sbjct  4    QASLFTPPTLSTLKSSNQAFVPWKQASFLPISNVKPQRTMKVAAAEETAVKEA-------  56

Query  177  ptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAA  356
                 PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAA
Sbjct  57   -----PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAA  111

Query  357  IMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAG  536
            IMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN G
Sbjct  112  IMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPG  171

Query  537  REGVGQNMRSIG-NIS  581
            R+GVGQN RSIG N+S
Sbjct  172  RQGVGQNFRSIGKNVS  187



>ref|XP_010108011.1| Photosystem I reaction center subunit II [Morus notabilis]
 gb|EXC17576.1| Photosystem I reaction center subunit II [Morus notabilis]
Length=215

 Score =   257 bits (657),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 158/194 (81%), Gaps = 3/194 (2%)
 Frame = +3

Query  9    SLFASPLSaakpaadrvaaPWKQSLHCFSVVPR--GLNKSTTAPCRPIRamaeetteapt  182
            +LF   LSA K     VA  WKQSL      P+   L++ ++     +RA AEE T+APT
Sbjct  8    TLFTPTLSAPKAGDRGVAVTWKQSLTSSFTTPKPFKLSRPSSGSSTIVRAAAEEATKAPT  67

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEM TGGAAIM
Sbjct  68   KEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMVTGGAAIM  127

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            R+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  128  RQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  187

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  188  GVGQNFRSIGKNVS  201



>ref|XP_004511355.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Cicer arietinum]
Length=215

 Score =   257 bits (656),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 147/201 (73%), Gaps = 18/201 (9%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF  PLS  K        PWKQ      +  + +  +T +P   IR  A    +  T
Sbjct  6    QASLFTPPLSTPK--------PWKQPSTLSFITLKPIKFTTASPRTTIRTAASADDKTET  57

Query  183  ----------keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIF  332
                        APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIF
Sbjct  58   PVKTEKAPAPAPAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIF  117

Query  333  EMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGV  512
            EMPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGV
Sbjct  118  EMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGV  177

Query  513  YPEKVNAGREGVGQNMRSIGN  575
            YPEKVN GREGVGQN RSIG 
Sbjct  178  YPEKVNPGREGVGQNFRSIGK  198



>ref|XP_002516772.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF45386.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
Length=208

 Score =   256 bits (655),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 149/194 (77%), Gaps = 6/194 (3%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF     +   +++    PWKQS   F  +P    +  +   + I+A A E      
Sbjct  6    QASLFTPTTLSTPKSSNHAIVPWKQS--SFLSIPTAKPRKYSIAQKTIKAAAAEGKTKEA  63

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
               PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  64   ---PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIM  120

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            R+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GRE
Sbjct  121  RQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRE  180

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  181  GVGQNFRSIGKNVS  194



>gb|AFK43504.1| unknown [Lotus japonicus]
Length=210

 Score =   256 bits (655),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 151/209 (72%), Gaps = 34/209 (16%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQS--LHCFSVVP-------------RGLNKSTTAPC  137
            QASLF+ PLS    A      PWKQS  L   +  P             R  ++ T AP 
Sbjct  6    QASLFSPPLSGRVSA------PWKQSPTLSFTNTKPLKFTTSPRTTTTIRAADEKTEAPV  59

Query  138  RPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSP  317
                        A  + APVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SP
Sbjct  60   ------------ATKEAAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESP  107

Query  318  KEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLH  497
            KEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLH
Sbjct  108  KEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLH  167

Query  498  PKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            PKDGVYPEKVN GR+GVGQN RSIG N+S
Sbjct  168  PKDGVYPEKVNPGRQGVGQNFRSIGKNVS  196



>ref|XP_006288687.1| hypothetical protein CARUB_v10001997mg [Capsella rubella]
 gb|EOA21585.1| hypothetical protein CARUB_v10001997mg [Capsella rubella]
Length=202

 Score =   256 bits (654),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  58   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  117

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  118  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  177

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  178  QNMRSIGKNVS  188



>ref|XP_010481602.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
[Camelina sativa]
Length=206

 Score =   256 bits (654),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG
Sbjct  63   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  122

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  123  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  182

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  183  QNMRSIGKNVS  193



>emb|CDO99040.1| unnamed protein product [Coffea canephora]
Length=205

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 150/194 (77%), Gaps = 9/194 (5%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF   LS+          PWKQS       P+ +   T    R IRAMAEE + A  
Sbjct  6    QASLFTPTLSSPSDRVTV---PWKQSSLVAFASPKPIK--TNMATRTIRAMAEEASTAAA  60

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
               P GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  61   ---PAGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIM  117

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            R+G NLLKLARKEQCLALGTRLRSKYKI+YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  118  RQGPNLLKLARKEQCLALGTRLRSKYKISYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  177

Query  543  GVGQNMRSIG-NIS  581
            GVG N+RSIG NIS
Sbjct  178  GVGLNLRSIGKNIS  191



>gb|AFV94477.1| photosystem I reaction center subunit II [Saccharum hybrid cultivar 
GT28]
Length=200

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GF PP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  56   PKGFVPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  115

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVG
Sbjct  116  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVG  175

Query  552  QNMRSIG-NIS  581
            QN RSIG N+S
Sbjct  176  QNFRSIGKNVS  186



>ref|NP_001062511.1| Os08g0560900 [Oryza sativa Japonica Group]
 gb|AAO72568.1| chloroplast photosystem I reaction center subunit II precursor-like 
protein [Oryza sativa Japonica Group]
 dbj|BAD13214.1| putative photosystem I reaction center subunit II, chloroplast 
precursor (Photosystem I 20 kDa subunit) (PSI-D) [Oryza sativa 
Japonica Group]
 dbj|BAF24425.1| Os08g0560900 [Oryza sativa Japonica Group]
 gb|EAZ08015.1| hypothetical protein OsI_30281 [Oryza sativa Indica Group]
 gb|EAZ43663.1| hypothetical protein OsJ_28289 [Oryza sativa Japonica Group]
 dbj|BAG88105.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99984.1| unnamed protein product [Oryza sativa Japonica Group]
Length=203

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GF PP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  59   PAGFVPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  118

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVG
Sbjct  119  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVG  178

Query  552  QNMRSIG-NIS  581
            QN RSIG N+S
Sbjct  179  QNFRSIGKNVS  189



>ref|XP_002892148.1| hypothetical protein ARALYDRAFT_887465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68407.1| hypothetical protein ARALYDRAFT_887465 [Arabidopsis lyrata subsp. 
lyrata]
Length=205

 Score =   255 bits (651),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 138/171 (81%), Gaps = 2/171 (1%)
 Frame = +3

Query  75   QSLHCFSVVPRGLNKS-TTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGG  251
            + LH FS   R  + S T    R  +  +     A  +EAPVGFTPP LDPNTPSPIF G
Sbjct  21   KKLHLFSTSHRLKSLSFTKTAIRAEKTESSSAAPAVKEEAPVGFTPPQLDPNTPSPIFAG  80

Query  252  STGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLR  431
            STGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLR
Sbjct  81   STGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLR  140

Query  432  SKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            SKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG NMRSIG N+S
Sbjct  141  SKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVS  191



>ref|XP_007050585.1| Photosystem I subunit D-2 [Theobroma cacao]
 gb|EOX94742.1| Photosystem I subunit D-2 [Theobroma cacao]
Length=204

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 149/194 (77%), Gaps = 8/194 (4%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QA LF   +S  K        PWK S       P+ LN S       IRA A +   A  
Sbjct  4    QAGLFTPTISTPKSLV-----PWKPSWSFSFATPKSLNLSMAHST--IRAAAADQEAATK  56

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            +EAPVGFTPP LDPNTPSP+F GSTGGLLRKAQVEEFYVITW SP+EQIFEMPTGGAAIM
Sbjct  57   EEAPVGFTPPELDPNTPSPMFSGSTGGLLRKAQVEEFYVITWDSPREQIFEMPTGGAAIM  116

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            R+G NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  117  RQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  176

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  177  GVGQNFRSIGKNVS  190



>ref|XP_010430302.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Camelina sativa]
Length=213

 Score =   254 bits (650),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  69   PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  128

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  129  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  188

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  189  QNMRSIGKNVS  199



>ref|XP_010456951.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like, 
partial [Camelina sativa]
Length=205

 Score =   254 bits (649),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66   PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  185

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  186  QNMRSIGKNVS  196



>ref|XP_010422538.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic 
[Camelina sativa]
Length=210

 Score =   254 bits (649),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66   PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  185

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  186  QNMRSIGKNVS  196



>ref|XP_010424650.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like, 
partial [Camelina sativa]
Length=205

 Score =   254 bits (649),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66   PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  185

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  186  QNMRSIGKNVS  196



>ref|NP_171812.1| photosystem I reaction center subunit D-2 [Arabidopsis thaliana]
 sp|Q9SA56.1|PSAD2_ARATH RecName: Full=Photosystem I reaction center subunit II-2, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit 2; Short=PSI-D2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD25795.1|AC006550_3 Strong similarity to gb|X14017 photosystem I reaction centre 
subunit II precursor (psaD) from Spinacia oleracea. ESTs gb|R30423, 
gb|T42998, gb|Z18178, gb|T14133, gb|N65521, gb|T42498, 
gb|T41918, gb|N38024, gb|R65109, gb|T43849, gb|AA394388, 
gb|T20925 and gb|N65696 come from this gene [Arabidopsis thaliana]
 gb|AAG40059.1|AF324708_1 At1g03130 [Arabidopsis thaliana]
 gb|AAG48776.1|AF332413_1 putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAK62620.1| At1g03130/F10O3_4 [Arabidopsis thaliana]
 gb|AAM63823.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAN38693.1| At1g03130/F10O3_4 [Arabidopsis thaliana]
 gb|AEE27534.1| photosystem I reaction center subunit D-2 [Arabidopsis thaliana]
Length=204

 Score =   254 bits (648),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = +3

Query  75   QSLHCFSVVPRGLNKSTTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGS  254
            + LH FS   R  + S T            +     KEAPVGFTPP LDPNTPSPIF GS
Sbjct  21   KKLHLFSSSHRPKSLSFTKTAIRAEKTESSSAAPAVKEAPVGFTPPQLDPNTPSPIFAGS  80

Query  255  TGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRS  434
            TGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRS
Sbjct  81   TGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRS  140

Query  435  KYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            KYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG NMRSIG N+S
Sbjct  141  KYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVS  190



>ref|XP_010935005.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Elaeis guineensis]
Length=210

 Score =   254 bits (648),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 148/196 (76%), Gaps = 8/196 (4%)
 Frame = +3

Query  3    QASLFASPL--SaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeettea  176
            QASLF  P   ++   A    A PW  S   F+  PR L  ST  P     A  + +   
Sbjct  6    QASLFTPPTLSASKPAAPRSAAIPWTNS--PFAATPRPLTLSTNTPRN---ATFKVSATE  60

Query  177  ptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAA  356
               EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAA
Sbjct  61   EKTEAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAA  120

Query  357  IMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAG  536
            IMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN G
Sbjct  121  IMRQGPNLLKLARKEQCLALGTRLRSKYKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNPG  180

Query  537  REGVGQNMRSIG-NIS  581
            R+GVG N RSIG N+S
Sbjct  181  RQGVGLNFRSIGKNVS  196



>ref|XP_010424649.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Camelina sativa]
Length=230

 Score =   254 bits (649),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  66   PVGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  125

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  185

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  186  QNMRSIGKNVS  196



>ref|XP_011021547.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=201

 Score =   253 bits (646),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 150/194 (77%), Gaps = 11/194 (6%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF     +A  ++++  APWK  L  F      L  S   P R ++  A E T    
Sbjct  4    QASLFTPTALSALKSSNQAIAPWK--LSSF------LPISNVKPQRTMKVAAAEETAVKE  55

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
               PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  56   A--PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIM  113

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  114  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  173

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  174  GVGQNFRSIGKNVS  187



>ref|XP_011026306.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=203

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 143/191 (75%), Gaps = 10/191 (5%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF     +   ++++   PWKQS          L  S     R  +  A E T    
Sbjct  6    QASLFTPTTLSTLKSSNQTIVPWKQSTF--------LPISNVKAQRSFKVAAAEETATKE  57

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
               PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  58   A--PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIM  115

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  116  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  175

Query  543  GVGQNMRSIGN  575
            GVGQN RSIG 
Sbjct  176  GVGQNFRSIGK  186



>gb|KFK42673.1| hypothetical protein AALP_AA1G025000 [Arabis alpina]
Length=204

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  60   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  119

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  120  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  179

Query  552  QNMRSIG-NIS  581
             NMRSIG N+S
Sbjct  180  LNMRSIGKNVS  190



>ref|XP_010474916.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=247

 Score =   254 bits (648),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMRE 
Sbjct  103  PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMRER  162

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  163  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  222

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  223  QNMRSIGKNVS  233



>ref|XP_002311618.2| photosystem I 20kD family protein [Populus trichocarpa]
 gb|EEE88985.2| photosystem I 20kD family protein [Populus trichocarpa]
Length=204

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 146/191 (76%), Gaps = 9/191 (5%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF     +   ++++   PWKQS    S +P     S     R  +  A E   A  
Sbjct  6    QASLFTPTTLSTLKSSNQTIVPWKQS----SFLPI----SNVKAQRSFKVAAVEGKTATK  57

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            +  PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  58   EA-PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIM  116

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  117  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  176

Query  543  GVGQNMRSIGN  575
            GVGQN RSIG 
Sbjct  177  GVGQNFRSIGK  187



>ref|XP_010474917.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=241

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMRE 
Sbjct  103  PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMRER  162

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  163  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  222

Query  552  QNMRSIG-NIS  581
            QNMRSIG N+S
Sbjct  223  QNMRSIGKNVS  233



>ref|NP_192186.1| photosystem I subunit D-1 [Arabidopsis thaliana]
 sp|Q9S7H1.1|PSAD1_ARATH RecName: Full=Photosystem I reaction center subunit II-1, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit 1; Short=PSI-D1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG40026.1|AF324675_1 AT4g02770 [Arabidopsis thaliana]
 gb|AAG41469.1|AF326887_1 putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAK63862.1|AF389290_1 AT4g02770/T5J8_7 [Arabidopsis thaliana]
 gb|AAD15351.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 emb|CAB52676.1| photosystem I subunit II precursor [Arabidopsis thaliana]
 emb|CAB77762.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AAL32590.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10233.1| unknown protein [Arabidopsis thaliana]
 gb|AAM26726.1| AT4g02770/T5J8_7 [Arabidopsis thaliana]
 gb|AAM44987.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
 gb|AEE82228.1| photosystem I subunit D-1 [Arabidopsis thaliana]
Length=208

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 140/173 (81%), Gaps = 4/173 (2%)
 Frame = +3

Query  75   QSLHCFSVV--PRGLNKSTTA-PCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIF  245
            + LH FS    P+ L+ + TA       + A       TKEAPVGFTPP LDPNTPSPIF
Sbjct  22   KKLHFFSTTHRPKSLSFTKTAIRAEKTDSSAAAAAAPATKEAPVGFTPPQLDPNTPSPIF  81

Query  246  GGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTR  425
             GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTR
Sbjct  82   AGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTR  141

Query  426  LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            LRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG NMRSIG N+S
Sbjct  142  LRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVS  194



>ref|XP_004134141.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Cucumis sativus]
 sp|P32869.1|PSAD_CUCSA RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=PS I subunit 5; AltName: Full=Photosystem 
I 20 kDa subunit; Short=PSI-D; Flags: Precursor [Cucumis 
sativus]
 gb|KGN56995.1| hypothetical protein Csa_3G147780 [Cucumis sativus]
 prf||1710320A photosystem I 20kD protein
Length=207

 Score =   251 bits (642),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 147/194 (76%), Gaps = 7/194 (4%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QA+LF   LS  K     +  PWKQS     +  +   K+ ++     R+         +
Sbjct  6    QATLFTPSLSTPKSTGISI--PWKQSSTLSFLTSKPHLKAASSS----RSFKVSAEAETS  59

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
             EAP GF+PP LDP+TPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  60   VEAPAGFSPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIM  119

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GRE
Sbjct  120  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRE  179

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  180  GVGQNFRSIGKNVS  193



>ref|XP_006838247.1| hypothetical protein AMTR_s00103p00041210 [Amborella trichopoda]
 gb|ERN00816.1| hypothetical protein AMTR_s00103p00041210 [Amborella trichopoda]
Length=202

 Score =   251 bits (641),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  58   PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  117

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  118  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  177

Query  552  QNMRSIG-NIS  581
             N RS+G NIS
Sbjct  178  LNFRSVGKNIS  188



>ref|XP_006396500.1| hypothetical protein EUTSA_v10029178mg [Eutrema salsugineum]
 gb|ESQ37953.1| hypothetical protein EUTSA_v10029178mg [Eutrema salsugineum]
Length=237

 Score =   252 bits (644),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  93   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  152

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  153  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  212

Query  552  QNMRSIG-NIS  581
             NMRSIG N+S
Sbjct  213  LNMRSIGKNVS  223



>gb|AAM66066.1| putative photosystem I reaction center subunit II precursor [Arabidopsis 
thaliana]
Length=208

 Score =   251 bits (641),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  64   PVGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREG  123

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG
Sbjct  124  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVG  183

Query  552  QNMRSIG-NIS  581
             NMRSIG N+S
Sbjct  184  LNMRSIGKNVS  194



>ref|XP_010522735.1| PREDICTED: photosystem I reaction center subunit II-2, chloroplastic 
[Tarenaya hassleriana]
Length=207

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/126 (94%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  195  VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  374
            VGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG 
Sbjct  64   VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP  123

Query  375  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQ  554
            NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N GR+GVGQ
Sbjct  124  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANPGRQGVGQ  183

Query  555  NMRSIG  572
            NMRSIG
Sbjct  184  NMRSIG  189



>ref|XP_009396832.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=259

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 153/197 (78%), Gaps = 13/197 (7%)
 Frame = +3

Query  3    QASLFASP--LSaakpaadrvaaPWKQS-LHCFSVVPRGLNKSTTAPCRPIRamaeette  173
            QASLF  P  L ++KP+A R   PWK + L   ++  RG +          R  A E   
Sbjct  58   QASLFTPPAALPSSKPSAPRSLLPWKHTPLTAGAMSLRGAS---------FRVSATEEKT  108

Query  174  aptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGA  353
                EAP GFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGA
Sbjct  109  EAAPEAPAGFTPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQVFEMPTGGA  168

Query  354  AIMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNA  533
            AIMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN 
Sbjct  169  AIMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNP  228

Query  534  GREGVGQNMRSIG-NIS  581
            GR+GVGQNMRSIG N+S
Sbjct  229  GRQGVGQNMRSIGKNVS  245



>gb|KJB28316.1| hypothetical protein B456_005G042000 [Gossypium raimondii]
Length=228

 Score =   251 bits (642),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  70   PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQG  129

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  130  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  189

Query  552  QNMRSIG-NIS  581
            QN RSIG N+S
Sbjct  190  QNFRSIGKNVS  200



>gb|ACF05868.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05879.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05880.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  552  QNMRSIGN  575
            QN RSIG 
Sbjct  156  QNFRSIGK  163



>ref|XP_004981348.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Setaria italica]
Length=275

 Score =   253 bits (646),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 125/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GF PP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  131  PKGFVPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  190

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVG
Sbjct  191  PNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVG  250

Query  552  QNMRSIG-NIS  581
            QN RSIG N+S
Sbjct  251  QNFRSIGKNVS  261



>ref|XP_010542866.1| PREDICTED: photosystem I reaction center subunit II-1, chloroplastic-like 
[Tarenaya hassleriana]
Length=206

 Score =   250 bits (639),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 123/130 (95%), Gaps = 1/130 (1%)
 Frame = +3

Query  195  VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  374
            VGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG 
Sbjct  63   VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP  122

Query  375  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQ  554
            NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEK N GR+GVGQ
Sbjct  123  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKANPGRQGVGQ  182

Query  555  NMRSIG-NIS  581
            NMRSIG N+S
Sbjct  183  NMRSIGKNVS  192



>gb|ACF05884.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  552  QNMRSIGN  575
            QN RSIG 
Sbjct  156  QNFRSIGK  163



>gb|ACF05859.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05860.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05869.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05870.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05873.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05875.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05877.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05885.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  552  QNMRSIGN  575
            QN RSIG 
Sbjct  156  QNFRSIGK  163



>gb|ACF05876.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05886.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  552  QNMRSIGN  575
            QN RSIG 
Sbjct  156  QNFRSIGK  163



>gb|ACF05855.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05856.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05857.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05858.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05861.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05862.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05863.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05864.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05865.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05866.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05867.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05872.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05874.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05878.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05881.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05882.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05883.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05887.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05888.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05889.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05890.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05891.1| chloroplast photosystem I protein, partial [Populus tremula]
 gb|ACF05892.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   249 bits (635),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREG  95

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  552  QNMRSIGN  575
            QN RSIG 
Sbjct  156  QNFRSIGK  163



>emb|CAN61448.1| hypothetical protein VITISV_024141 [Vitis vinifera]
Length=183

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  41   PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQG  100

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  101  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  160

Query  552  QNMRSIG-NIS  581
            QN RSIG N+S
Sbjct  161  QNFRSIGKNVS  171



>gb|ACF05871.1| chloroplast photosystem I protein, partial [Populus tremula]
Length=167

 Score =   249 bits (635),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/128 (93%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  36   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  95

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  96   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  155

Query  552  QNMRSIGN  575
            QN RSIG 
Sbjct  156  QNFRSIGK  163



>ref|XP_002278284.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Vitis vinifera]
 emb|CBI28699.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 146/173 (84%), Gaps = 8/173 (5%)
 Frame = +3

Query  66   PWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIF  245
            PWK S        + +N       R I+AMAEE TEAP KEAPVGFTPP LDPNTPSPIF
Sbjct  25   PWKPSSFSSFSTSKPIN-------RAIKAMAEEKTEAPVKEAPVGFTPPELDPNTPSPIF  77

Query  246  GGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTR  425
            GGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G NLLKLARKEQCLALGTR
Sbjct  78   GGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTR  137

Query  426  LRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            LRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN RSIG N+S
Sbjct  138  LRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQNFRSIGKNVS  190



>ref|XP_002872810.1| hypothetical protein ARALYDRAFT_490280 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49069.1| hypothetical protein ARALYDRAFT_490280 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 141/172 (82%), Gaps = 4/172 (2%)
 Frame = +3

Query  75   QSLHCFSVV--PRGLNKSTTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFG  248
            + LH FS    P+ L+ + T+  R  +  ++       KEAPVGFTPP LDPNTPSPIF 
Sbjct  22   KKLHFFSTTHRPKSLSFTKTS-IRAEKTDSKAAAAPAVKEAPVGFTPPQLDPNTPSPIFA  80

Query  249  GSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRL  428
            GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRL
Sbjct  81   GSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRL  140

Query  429  RSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            RSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG NMRSIG N+S
Sbjct  141  RSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVS  192



>ref|XP_008802683.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Phoenix dactylifera]
Length=209

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 145/193 (75%), Gaps = 8/193 (4%)
 Frame = +3

Query  3    QASLFASPL--SaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeettea  176
            QASLF  P   ++   A    A PW +S   F+  PR L  S      P  A  + +   
Sbjct  6    QASLFTPPTLPASKPAAPRSAAIPWTKS--PFAASPRPLTLSIA----PRNATIKVSATE  59

Query  177  ptkeaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAA  356
               EAP GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAA
Sbjct  60   EKTEAPAGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAA  119

Query  357  IMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAG  536
            IMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGV+PEKVN G
Sbjct  120  IMRQGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVFPEKVNPG  179

Query  537  REGVGQNMRSIGN  575
            R+GVG N RSIG 
Sbjct  180  RQGVGVNFRSIGK  192



>ref|XP_010256006.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Nelumbo nucifera]
Length=212

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 149/196 (76%), Gaps = 6/196 (3%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWK-QSLHCFSVVPRGLNKSTTAPCRPIRamaeetteap  179
            QA LF   LS        +  PWK  S     + PR LN S     R IRA A +     
Sbjct  6    QAGLFTPTLSTPNSGNRALV-PWKPSSSSLSFLSPRPLNLSLA--HRTIRASAADGKTEA  62

Query  180  t-keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAA  356
               EAPVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAA
Sbjct  63   PPAEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAA  122

Query  357  IMREGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAG  536
            IMR+G NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN G
Sbjct  123  IMRQGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPG  182

Query  537  REGVGQNMRSIG-NIS  581
            R+GVGQN RSIG N+S
Sbjct  183  RQGVGQNFRSIGKNVS  198



>ref|XP_011015859.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Populus euphratica]
Length=203

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 146/191 (76%), Gaps = 10/191 (5%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QASLF     +   ++++   PWKQS    S +P    K+  +             E  T
Sbjct  6    QASLFTPTTLSTLKSSNQTIVPWKQS----SFLPISNVKAQRS------FKVAAAEETAT  55

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  56   KEAPVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIM  115

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKE CLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  116  REGPNLLKLARKELCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  175

Query  543  GVGQNMRSIGN  575
            GVGQN RSIG 
Sbjct  176  GVGQNFRSIGK  186



>emb|CAB52677.1| photosystem I subunit II precursor [Arabidopsis thaliana]
Length=204

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 134/170 (79%), Gaps = 1/170 (1%)
 Frame = +3

Query  75   QSLHCFSVVPRGLNKSTTAPCRPIRamaeetteaptkeaPVGFTPPTLDPNTPSPIFGGS  254
            + LH FS   R  + S T            +     KEAPVGFTPP LDPNTPSPIF GS
Sbjct  21   KKLHLFSSSHRPKSLSFTKTAIRAEKTESSSAAPAVKEAPVGFTPPQLDPNTPSPIFAGS  80

Query  255  TGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRS  434
            TGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRS
Sbjct  81   TGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRS  140

Query  435  KYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            K+KI YQFYRVFPNGEVQYLHPKDG+YPEK N GREG G NMRSIG N+S
Sbjct  141  KFKITYQFYRVFPNGEVQYLHPKDGIYPEKANPGREGFGLNMRSIGKNVS  190



>gb|EPS62726.1| hypothetical protein M569_12065 [Genlisea aurea]
Length=196

 Score =   249 bits (635),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 124/129 (96%), Gaps = 1/129 (1%)
 Frame = +3

Query  198  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  377
            GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMREG N
Sbjct  54   GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQVFEMPTGGAAIMREGPN  113

Query  378  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  557
            LLKLARKEQCLALGTRLRSKYKINY+FYRVFPNGEVQYLHP+DGVYPEKVNAGR GVGQN
Sbjct  114  LLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPRDGVYPEKVNAGRTGVGQN  173

Query  558  MRSIG-NIS  581
             RSIG N+S
Sbjct  174  FRSIGKNVS  182



>gb|KJB23065.1| hypothetical protein B456_004G079200 [Gossypium raimondii]
Length=250

 Score =   251 bits (640),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  106  PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMRQG  165

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  166  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  225

Query  552  QNMRSIG-NIS  581
            QN RSIG N+S
Sbjct  226  QNFRSIGKNVS  236



>gb|KJB46980.1| hypothetical protein B456_008G004100 [Gossypium raimondii]
Length=210

 Score =   249 bits (635),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMR+G
Sbjct  66   PVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQVFEMPTGGAAIMRQG  125

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  126  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  185

Query  552  QNMRSIG-NIS  581
            QN RSIG N+S
Sbjct  186  QNFRSIGKNVS  196



>ref|XP_002520727.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
 gb|EEF41689.1| Photosystem I reaction center subunit II, chloroplast precursor, 
putative [Ricinus communis]
Length=209

 Score =   249 bits (635),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  65   PVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMRQG  124

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  125  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  184

Query  552  QNMRSIG-NIS  581
            QN RSIG N+S
Sbjct  185  QNFRSIGKNVS  195



>ref|XP_010681150.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=217

 Score =   249 bits (635),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/129 (93%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +3

Query  198  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  377
            GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG N
Sbjct  75   GFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPN  134

Query  378  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  557
            LLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN
Sbjct  135  LLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQN  194

Query  558  MRSIG-NIS  581
            MRSIG N+S
Sbjct  195  MRSIGKNVS  203



>ref|XP_009400838.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=207

 Score =   248 bits (634),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 123/129 (95%), Gaps = 1/129 (1%)
 Frame = +3

Query  198  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  377
            GFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMR+G N
Sbjct  65   GFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQVFEMPTGGAAIMRQGPN  124

Query  378  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  557
            LLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN
Sbjct  125  LLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQN  184

Query  558  MRSIG-NIS  581
            MRSIG N+S
Sbjct  185  MRSIGKNVS  193



>gb|KFK30882.1| hypothetical protein AALP_AA6G038200 [Arabis alpina]
Length=207

 Score =   248 bits (634),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/130 (92%), Positives = 121/130 (93%), Gaps = 1/130 (1%)
 Frame = +3

Query  195  VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  374
            VGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG 
Sbjct  64   VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGP  123

Query  375  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQ  554
            NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK N GREGVG 
Sbjct  124  NLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGL  183

Query  555  NMRSIG-NIS  581
            NMRSIG N+S
Sbjct  184  NMRSIGKNVS  193



>ref|XP_008438687.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Cucumis melo]
Length=207

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 147/194 (76%), Gaps = 7/194 (4%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QA+LF   LS  K +A  +  PWKQS    S +    +  T +  R ++  AE       
Sbjct  6    QATLFTPSLSTPKSSAISI--PWKQS-PTLSFLTSKPHLKTASSSRSLKVSAEAEAAVEA  62

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
                 GFTPP LDP+TPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  63   P---AGFTPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIM  119

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GRE
Sbjct  120  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRE  179

Query  543  GVGQNMRSIG-NIS  581
            GVGQN RSIG N+S
Sbjct  180  GVGQNFRSIGKNVS  193



>ref|NP_001130880.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACF79256.1| unknown [Zea mays]
 gb|ACG34065.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACR35291.1| unknown [Zea mays]
 tpg|DAA52067.1| TPA: photosystem I reaction center subunit II [Zea mays]
Length=199

 Score =   247 bits (630),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  56   PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  115

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GREGVG
Sbjct  116  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVG  175

Query  552  QNMRSIGN  575
            QN RSIG 
Sbjct  176  QNFRSIGK  183



>gb|KDO68707.1| hypothetical protein CISIN_1g047658mg [Citrus sinensis]
Length=229

 Score =   248 bits (632),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  65   PVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQG  124

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  125  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  184

Query  552  QNMRSIG-NIS  581
             N RSIG N+S
Sbjct  185  VNYRSIGKNVS  195



>ref|NP_001275788.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80479.1| PSI reaction center subunit II [Citrus sinensis]
Length=209

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  65   PVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQG  124

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  125  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  184

Query  552  QNMRSIG-NIS  581
             N RSIG N+S
Sbjct  185  LNYRSIGKNVS  195



>ref|XP_006444053.1| hypothetical protein CICLE_v10022248mg [Citrus clementina]
 dbj|BAF80471.1| PSI reaction center subunit II [Citrus sinensis]
 dbj|BAF80473.1| PSI reaction center subunit II [Citrus sinensis]
 gb|ESR57293.1| hypothetical protein CICLE_v10022248mg [Citrus clementina]
Length=209

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/131 (92%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  65   PVGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQG  124

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  125  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  184

Query  552  QNMRSIG-NIS  581
             N RSIG N+S
Sbjct  185  VNYRSIGKNVS  195



>emb|CAA32182.1| unnamed protein product [Spinacia oleracea]
Length=212

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  68   PKGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  127

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  128  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVG  187

Query  552  QNMRSIG-NIS  581
             NMRSIG N+S
Sbjct  188  LNMRSIGKNVS  198



>emb|CAA68728.1| unnamed protein product [Spinacia oleracea]
Length=212

 Score =   247 bits (630),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  68   PKGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  127

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  128  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVG  187

Query  552  QNMRSIG-NIS  581
             NMRSIG N+S
Sbjct  188  LNMRSIGKNVS  198



>sp|P12353.2|PSAD_SPIOL RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Spinacia oleracea]
Length=212

 Score =   246 bits (629),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  68   PKGFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  127

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  128  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVG  187

Query  552  QNMRSIG-NIS  581
             NMRSIG N+S
Sbjct  188  LNMRSIGKNVS  198



>sp|P36213.1|PSAD_HORVU RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Hordeum vulgare]
 gb|AAA18567.1| PSI-D subunit [Hordeum vulgare subsp. vulgare]
 dbj|BAK07564.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=205

 Score =   246 bits (628),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +3

Query  198  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  377
            GF PP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG N
Sbjct  63   GFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPN  122

Query  378  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  557
            LLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN
Sbjct  123  LLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQN  182

Query  558  MRSIG-NIS  581
             RSIG N+S
Sbjct  183  FRSIGKNVS  191



>gb|KDP21451.1| hypothetical protein JCGZ_21922 [Jatropha curcas]
Length=205

 Score =   246 bits (627),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G
Sbjct  61   PVGFTPPELDPNTPSPIFSGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMRQG  120

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  121  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVG  180

Query  552  QNMRSIG-NIS  581
             N RSIG N+S
Sbjct  181  LNFRSIGKNVS  191



>ref|XP_007034724.1| Photosystem I subunit D-2 [Theobroma cacao]
 gb|EOY05650.1| Photosystem I subunit D-2 [Theobroma cacao]
Length=210

 Score =   246 bits (627),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 150/190 (79%), Gaps = 3/190 (2%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            Q SLF     +A  ++DRVA PWKQ+   F  +P        AP       AEE  E  T
Sbjct  6    QTSLFTPATLSAPKSSDRVAVPWKQA--SFVTLP-SFKSQKFAPRTIKAEAAEEKAETAT  62

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDP+TPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIM
Sbjct  63   KEAPVGFTPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIM  122

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            R+G NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  123  RQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  182

Query  543  GVGQNMRSIG  572
            GVG N R+IG
Sbjct  183  GVGLNFRNIG  192



>gb|ACG25364.1| photosystem I reaction center subunit II [Zea mays]
 gb|ACG45485.1| photosystem I reaction center subunit II [Zea mays]
Length=204

 Score =   245 bits (625),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMREG
Sbjct  61   PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWVSPKEQVFEMPTGGAAIMREG  120

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GREGVG
Sbjct  121  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVG  180

Query  552  QNMRSIGN  575
            QN RSIG 
Sbjct  181  QNFRSIGK  188



>ref|XP_003564108.1| PREDICTED: photosystem I reaction center subunit II, chloroplastic 
[Brachypodium distachyon]
Length=204

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 122/129 (95%), Gaps = 1/129 (1%)
 Frame = +3

Query  198  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  377
            GF PP LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG N
Sbjct  62   GFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPN  121

Query  378  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  557
            LLKLARKEQCLALG RLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVNAGR+GVGQN
Sbjct  122  LLKLARKEQCLALGNRLRSKYKIAYQFYRVFPSGEVQYLHPKDGVYPEKVNAGRQGVGQN  181

Query  558  MRSIG-NIS  581
             RSIG N+S
Sbjct  182  FRSIGKNVS  190



>gb|ACN40159.1| unknown [Picea sitchensis]
Length=161

 Score =   243 bits (620),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  17   PVGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  76

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  77   PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRKGVG  136

Query  552  QNMRSIG  572
             N RSIG
Sbjct  137  VNFRSIG  143



>gb|AFW67274.1| photosystem I reaction center subunit II [Zea mays]
Length=236

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMREG
Sbjct  93   PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWVSPKEQVFEMPTGGAAIMREG  152

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GREGVG
Sbjct  153  PNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVG  212

Query  552  QNMRSIGN  575
            QN RSIG 
Sbjct  213  QNFRSIGK  220



>gb|ACG41754.1| photosystem I reaction center subunit II [Zea mays]
Length=199

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GF  P LDP+TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG
Sbjct  56   PKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREG  115

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLAR EQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GREGVG
Sbjct  116  PNLLKLARNEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVG  175

Query  552  QNMRSIG  572
            QN RSIG
Sbjct  176  QNFRSIG  182



>gb|ABK21314.1| unknown [Picea sitchensis]
 gb|ABK24570.1| unknown [Picea sitchensis]
 gb|ABK26950.1| unknown [Picea sitchensis]
 gb|ABR17153.1| unknown [Picea sitchensis]
Length=234

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  90   PVGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  149

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  150  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRKGVG  209

Query  552  QNMRSIG  572
             N RSIG
Sbjct  210  VNFRSIG  216



>pdb|2WSC|D Chain D, Improved Model Of Plant Photosystem I
 pdb|2WSE|D Chain D, Improved Model Of Plant Photosystem I
 pdb|2WSF|D Chain D, Improved Model Of Plant Photosystem I
Length=212

 Score =   242 bits (618),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
            FTPP LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NL
Sbjct  71   FTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNL  130

Query  381  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  560
            LKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG NM
Sbjct  131  LKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNM  190

Query  561  RSIG-NIS  581
            RSIG N+S
Sbjct  191  RSIGKNVS  198



>pdb|3LW5|D Chain D, Improved Model Of Plant Photosystem I
Length=138

 Score =   237 bits (605),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/123 (94%), Positives = 118/123 (96%), Gaps = 1/123 (1%)
 Frame = +3

Query  216  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  395
            LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLAR
Sbjct  2    LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLAR  61

Query  396  KEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-  572
            KEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN RSIG 
Sbjct  62   KEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGK  121

Query  573  NIS  581
            N+S
Sbjct  122  NVS  124



>gb|ABK21867.1| unknown [Picea sitchensis]
Length=234

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG
Sbjct  90   PVGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG  149

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVY EKVN GR+GVG
Sbjct  150  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYQEKVNPGRKGVG  209

Query  552  QNMRSIG  572
             N RSIG
Sbjct  210  VNFRSIG  216



>pdb|4RKU|D Chain D, Crystal Structure Of Plant Photosystem I At 3 Angstrom 
Resolution
Length=137

 Score =   236 bits (602),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = +3

Query  204  TPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLL  383
            TPP LDPNTPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLL
Sbjct  1    TPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLL  60

Query  384  KLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  563
            KLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG N R
Sbjct  61   KLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGVNFR  120

Query  564  SIG-NIS  581
            SIG N+S
Sbjct  121  SIGKNVS  127



>ref|XP_002991814.1| hypothetical protein SELMODRAFT_26984, partial [Selaginella moellendorffii]
 gb|EFJ07076.1| hypothetical protein SELMODRAFT_26984, partial [Selaginella moellendorffii]
Length=147

 Score =   234 bits (597),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GFTPP L P+TPSPIFGGSTGGLLRKAQVEEFYVITW S KEQIFEMPTGGAAIMR G
Sbjct  3    PAGFTPPELKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESGKEQIFEMPTGGAAIMRSG  62

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGT+LRSK+KINYQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  63   PNLLKLARKEQCLALGTQLRSKFKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRKGVG  122

Query  552  QNMRSIG  572
             N+RSIG
Sbjct  123  VNLRSIG  129



>emb|CAA54744.1| psaD [Spinacia oleracea]
Length=211

 Score =   236 bits (601),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 119/128 (93%), Gaps = 2/128 (2%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
            FTPP LDPNTPSPIF GSTG LLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NL
Sbjct  71   FTPPELDPNTPSPIFAGSTG-LLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNL  129

Query  381  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  560
            LKLARKEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG NM
Sbjct  130  LKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNM  189

Query  561  RSIG-NIS  581
            RSIG N+S
Sbjct  190  RSIGKNVS  197



>ref|XP_001752431.1| predicted protein [Physcomitrella patens]
 gb|EDQ82670.1| predicted protein [Physcomitrella patens]
Length=210

 Score =   234 bits (596),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G
Sbjct  66   PKGFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSG  125

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  VG
Sbjct  126  PNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRTAVG  185

Query  552  QNMRSIG  572
             N RSIG
Sbjct  186  VNNRSIG  192



>ref|XP_001751403.1| predicted protein [Physcomitrella patens]
 gb|EDQ83720.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   232 bits (591),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G
Sbjct  22   PKGFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSG  81

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  VG
Sbjct  82   PNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRSPVG  141

Query  552  QNMRSIG  572
             N RSIG
Sbjct  142  VNNRSIG  148



>ref|XP_001768962.1| predicted protein [Physcomitrella patens]
 gb|EDQ66316.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   232 bits (591),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G
Sbjct  22   PKGFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSG  81

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  VG
Sbjct  82   PNLLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRSPVG  141

Query  552  QNMRSIG  572
             N RSIG
Sbjct  142  VNNRSIG  148



>pdb|2O01|D Chain D, The Structure Of A Plant Photosystem I Supercomplex 
At 3.4 Angstrom Resolution
Length=138

 Score =   230 bits (587),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 116/123 (94%), Gaps = 1/123 (1%)
 Frame = +3

Query  216  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  395
            LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLAR
Sbjct  2    LDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLAR  61

Query  396  KEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-  572
            KEQCLALGTRLRSKYKI YQFYRVFP+GEVQYLHPKDGVYPEKVN GR+GVG NMRSIG 
Sbjct  62   KEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGK  121

Query  573  NIS  581
            N+S
Sbjct  122  NVS  124



>ref|XP_001765579.1| predicted protein [Physcomitrella patens]
 gb|EDQ69629.1| predicted protein, partial [Physcomitrella patens]
Length=156

 Score =   229 bits (583),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +3

Query  198  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  377
            GFTPPTL+ +TP+PIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR G N
Sbjct  14   GFTPPTLNADTPAPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRSGPN  73

Query  378  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  557
            LLKLARKEQCLALG RLR+K+KI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR  VG N
Sbjct  74   LLKLARKEQCLALGARLRTKFKIQYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRSPVGVN  133

Query  558  MRSIG  572
             RSIG
Sbjct  134  NRSIG  138



>gb|KHN02708.1| Photosystem I reaction center subunit II, chloroplastic [Glycine 
soja]
Length=241

 Score =   228 bits (582),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 114/122 (93%), Gaps = 1/122 (1%)
 Frame = +3

Query  219  DPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARK  398
            D   PSPIFGGSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARK
Sbjct  29   DHRGPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLARK  88

Query  399  EQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-N  575
            EQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN RSIG N
Sbjct  89   EQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKN  148

Query  576  IS  581
            +S
Sbjct  149  VS  150


 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/63 (92%), Positives = 60/63 (95%), Gaps = 1/63 (2%)
 Frame = +3

Query  396  KEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-  572
            KEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN RSIG 
Sbjct  165  KEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGK  224

Query  573  NIS  581
            N+S
Sbjct  225  NVS  227



>ref|XP_005647040.1| PSI-D1 precursor [Coccomyxa subellipsoidea C-169]
 gb|EIE22496.1| PSI-D1 precursor [Coccomyxa subellipsoidea C-169]
Length=192

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  195  VGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGA  374
              + PPTLDP+TPSPIFGGSTGGLLRKAQ+EEFYVITW + KEQ+FEMPTGGAAIMR G 
Sbjct  48   AAWKPPTLDPSTPSPIFGGSTGGLLRKAQIEEFYVITWDAKKEQVFEMPTGGAAIMRSGP  107

Query  375  NLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQ  554
            NLLKLARKEQCLAL T+LR+K+K + Q YRVFP+GEVQYLHPKDGVYPEKVNAGR  VG 
Sbjct  108  NLLKLARKEQCLALLTQLRNKFKTDGQIYRVFPDGEVQYLHPKDGVYPEKVNAGRTAVGA  167

Query  555  NMRSIGN  575
              RSIG 
Sbjct  168  KDRSIGK  174



>gb|ABK96248.1| unknown [Populus trichocarpa x Populus deltoides]
Length=166

 Score =   212 bits (540),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = +3

Query  228  TPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQC  407
             P   F  STGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREG NLLKLARKEQC
Sbjct  34   VPHHQFLVSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLARKEQC  93

Query  408  LALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            LALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN RSIG N+S
Sbjct  94   LALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQNFRSIGKNVS  152



>gb|EMS56878.1| Photosystem I reaction center subunit II, chloroplastic [Triticum 
urartu]
Length=156

 Score =   210 bits (535),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 105/110 (95%), Gaps = 1/110 (1%)
 Frame = +3

Query  255  TGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRS  434
            TGGLLRKAQVEEFYVITWTSPKEQ+FEMPTGGAAIMREG NLLKLARKEQCLALG RLRS
Sbjct  33   TGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGNRLRS  92

Query  435  KYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG-NIS  581
            KYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNAGR+GVGQN RSIG N+S
Sbjct  93   KYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNVS  142



>ref|XP_007226637.1| hypothetical protein PRUPE_ppa022366mg [Prunus persica]
 gb|EMJ27836.1| hypothetical protein PRUPE_ppa022366mg [Prunus persica]
Length=192

 Score =   211 bits (536),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 135/191 (71%), Gaps = 19/191 (10%)
 Frame = +3

Query  3    QASLFASPLSaakpaadrvaaPWKQSLHCFSVVPRGLNKSTTAPCRPIRamaeetteapt  182
            QA+LF    SA K + +R   PWKQS+    + P+ L  S+T     I A AEE T AP 
Sbjct  4    QATLFTPTPSAPKTSVERSTVPWKQSVSSSFMAPKPLKLSSTTRTMRINAAAEEKTVAPP  63

Query  183  keaPVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIM  362
            KEAPVGFTPP LDP TPSPIFGGSTGGLLRKAQ EEF                    +IM
Sbjct  64   KEAPVGFTPPELDPTTPSPIFGGSTGGLLRKAQEEEFL-------------------SIM  104

Query  363  REGANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRE  542
            REG NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+
Sbjct  105  REGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQ  164

Query  543  GVGQNMRSIGN  575
            GVGQN RSIG 
Sbjct  165  GVGQNFRSIGK  175



>ref|XP_002992973.1| hypothetical protein SELMODRAFT_448960 [Selaginella moellendorffii]
 gb|EFJ05919.1| hypothetical protein SELMODRAFT_448960 [Selaginella moellendorffii]
Length=976

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +3

Query  216  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  395
            L P+TPSPIFGGSTGGLLRKAQVEEFYVITW S KEQIFEMPTGGAAIMR G NLLKLAR
Sbjct  840  LKPDTPSPIFGGSTGGLLRKAQVEEFYVITWESGKEQIFEMPTGGAAIMRSGPNLLKLAR  899

Query  396  KEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            KEQCLALGT+LRSK+KINYQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG N+RSIG
Sbjct  900  KEQCLALGTQLRSKFKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRKGVGVNLRSIG  958



>ref|XP_002953316.1| hypothetical protein VOLCADRAFT_121148 [Volvox carteri f. nagariensis]
 gb|EFJ45626.1| hypothetical protein VOLCADRAFT_121148 [Volvox carteri f. nagariensis]
Length=179

 Score =   210 bits (534),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
            +TPPTL+P+TPSPIFGGSTGGLLRKAQ EEFYVITW S KEQIFEMPTGGAAIMR+G NL
Sbjct  36   WTPPTLNPDTPSPIFGGSTGGLLRKAQQEEFYVITWDSKKEQIFEMPTGGAAIMRQGPNL  95

Query  381  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  560
            LK A+KEQCLAL T+LR+K+K+   FYRVFP+G+VQYLHP DGVYPEKVNAGR GV QN 
Sbjct  96   LKFAKKEQCLALTTQLRTKFKLTPAFYRVFPDGKVQYLHPADGVYPEKVNAGRVGVNQNF  155

Query  561  RSIGN  575
            R IG 
Sbjct  156  RRIGQ  160



>gb|KIZ01091.1| Photosystem I reaction center subunit II, chloroplastic [Monoraphidium 
neglectum]
Length=187

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  198  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  377
             FT PTL+P+TPSPIFGGSTGGLL+KAQVEEFYVITW S KEQIFEMP GGAAIMR+G N
Sbjct  45   AFTAPTLNPDTPSPIFGGSTGGLLKKAQVEEFYVITWESAKEQIFEMPLGGAAIMRKGPN  104

Query  378  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  557
            LLKLARKE CLAL T+LR+K+KI   FYRV+P GEV+YLHPKDGVYPEKVNAGR G  QN
Sbjct  105  LLKLARKEHCLALTTQLRNKFKIQPAFYRVYPTGEVEYLHPKDGVYPEKVNAGRIGENQN  164

Query  558  MRSIG  572
             R IG
Sbjct  165  FRRIG  169



>ref|XP_003063552.1| photosystem I subunit II, chloroplast precursor [Micromonas pusilla 
CCMP1545]
 gb|EEH51925.1| photosystem I subunit II, chloroplast precursor [Micromonas pusilla 
CCMP1545]
Length=225

 Score =   209 bits (533),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
            ++PP L+PNTPSPIFGGSTGGLLRKAQVEEFYV+TW +PKE IFEMPTGGAAIMR+G NL
Sbjct  70   WSPPKLNPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAPKEMIFEMPTGGAAIMRKGPNL  129

Query  381  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  560
            LKLARKEQCLAL   +R+K KIN   YRVFP+GEVQYLHPKDGVYPEKVN GR G   NM
Sbjct  130  LKLARKEQCLALLNSMRAKNKINGCVYRVFPSGEVQYLHPKDGVYPEKVNKGRVGANNNM  189

Query  561  RSIG  572
            RSIG
Sbjct  190  RSIG  193



>emb|CEG01861.1| Photosystem I PsaD [Ostreococcus tauri]
Length=188

 Score =   208 bits (529),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P  +T P LDPNTPSPIFGGSTGGLLRKAQVEEFYV+TW + KE IFEMPTGGAAIMR+G
Sbjct  43   PAVWTAPKLDPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAKKEAIFEMPTGGAAIMRKG  102

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLAL    RSK K++   YRVFP+GEVQYLHPKDGVYPEKVN GR G  
Sbjct  103  PNLLKLARKEQCLALLNTFRSKMKLDGCIYRVFPSGEVQYLHPKDGVYPEKVNKGRVGAN  162

Query  552  QNMRSIG  572
            QNMRSIG
Sbjct  163  QNMRSIG  169



>ref|XP_007511428.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17549.1| predicted protein [Bathycoccus prasinos]
Length=199

 Score =   207 bits (528),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  198  GFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGAN  377
             ++ P LDPNTPSPIFGGSTGGLLRKAQVEEFYV+TW + KEQIFEMPTGGAAIMR+G N
Sbjct  57   AWSAPKLDPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAKKEQIFEMPTGGAAIMRKGPN  116

Query  378  LLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  557
            LLKLARKEQC+AL T  R+K   N   YRVFP+GEVQYLHPKDGVYPEKVNAGR G  QN
Sbjct  117  LLKLARKEQCMALVTTFRAKKIANGCIYRVFPSGEVQYLHPKDGVYPEKVNAGRVGANQN  176

Query  558  MRSIG  572
            MRSIG
Sbjct  177  MRSIG  181



>ref|XP_002504652.1| photosystem I subunit II, chloroplast precursor [Micromonas sp. 
RCC299]
 gb|ACO65910.1| photosystem I subunit II, chloroplast precursor [Micromonas sp. 
RCC299]
Length=216

 Score =   208 bits (529),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
            ++PP L+PNTPSPIFGGSTGGLLRKAQVEEFYV+TW +PKE IFEMPTGGAAIMR+G NL
Sbjct  61   WSPPKLNPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAPKEMIFEMPTGGAAIMRKGPNL  120

Query  381  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  560
            LKLARKEQCLAL   +R+K KIN   YRVFP+GEVQYLHPKDGVYPEKVN GR G   NM
Sbjct  121  LKLARKEQCLALLNSMRAKNKINGCVYRVFPSGEVQYLHPKDGVYPEKVNKGRVGANNNM  180

Query  561  RSIG  572
            RSIG
Sbjct  181  RSIG  184



>ref|XP_003592408.1| Photosystem I reaction center subunit II [Medicago truncatula]
 gb|AES62659.1| photosystem I reaction center subunit II [Medicago truncatula]
Length=193

 Score =   205 bits (522),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 107/131 (82%), Gaps = 14/131 (11%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            PVGFTPP LDPNTPSPIF              EF+VITW SPKEQIFE+  GGAAIMREG
Sbjct  62   PVGFTPPELDPNTPSPIFS-------------EFHVITWDSPKEQIFEIANGGAAIMREG  108

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVG
Sbjct  109  PNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNLGRQGVG  168

Query  552  QNMRSIG-NIS  581
            QN  SIG N+S
Sbjct  169  QNFGSIGKNVS  179



>ref|XP_005847397.1| hypothetical protein CHLNCDRAFT_35549 [Chlorella variabilis]
 gb|EFN55295.1| hypothetical protein CHLNCDRAFT_35549 [Chlorella variabilis]
Length=186

 Score =   205 bits (521),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P  + PP LD + PSPIFGGSTGGLLR+AQVEEF+VITW + KEQIFEMPTGGAAIMR+G
Sbjct  42   PKPWAPPALDASAPSPIFGGSTGGLLRQAQVEEFHVITWEAKKEQIFEMPTGGAAIMRQG  101

Query  372  ANLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVG  551
             NLLKLARKEQCLAL T+LR+K+K +   YRVFPNGEVQYLHPKDGVYPEKVNAGR G  
Sbjct  102  PNLLKLARKEQCLALLTQLRTKFKTDGFIYRVFPNGEVQYLHPKDGVYPEKVNAGRSGDN  161

Query  552  QNMRSIGN  575
             NMR IG 
Sbjct  162  TNMRRIGQ  169



>gb|KIZ02718.1| Photosystem I reaction center subunit II, chloroplastic [Monoraphidium 
neglectum]
Length=169

 Score =   204 bits (519),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
            F+ PTL+P+TPSPIFGGSTGGLL+KAQVEEFYVITW S KEQIFEMP GGAAIMR+G NL
Sbjct  28   FSAPTLNPDTPSPIFGGSTGGLLKKAQVEEFYVITWESAKEQIFEMPLGGAAIMRKGPNL  87

Query  381  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  560
            LKLARKE CLAL T+LR+K+KI   FYRV+P GEV+YLHPKDGVYPEKVNAGR G  QN 
Sbjct  88   LKLARKEHCLALTTQLRNKFKIQPAFYRVYPTGEVEYLHPKDGVYPEKVNAGRIGENQNF  147

Query  561  RSIG  572
            R IG
Sbjct  148  RRIG  151



>emb|CAL25356.1| photosystem I reaction center subunit II [Platanus x acerifolia]
Length=122

 Score =   202 bits (514),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/104 (93%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +3

Query  261  GLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKY  440
            GLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMR+G NLLKLARKEQCLALGTRLRSKY
Sbjct  1    GLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKY  60

Query  441  KINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            KI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN RSIG
Sbjct  61   KIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQNFRSIG  104



>ref|XP_011400522.1| Photosystem I reaction center subunit II, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27539.1| Photosystem I reaction center subunit II, chloroplastic [Auxenochlorella 
protothecoides]
Length=199

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
            F+PPTLDP+TPSP FGGSTGGLLRKAQVEEF+VITW S KEQ+FEMPT GAAIMREG NL
Sbjct  56   FSPPTLDPDTPSPTFGGSTGGLLRKAQVEEFHVITWNSKKEQVFEMPTAGAAIMREGPNL  115

Query  381  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  560
            LKL+RKEQCLAL T+LR+K+KI+   YRVFPNGE QYLHPKDGVYPEKVN GR+ V    
Sbjct  116  LKLSRKEQCLALLTQLRTKFKIDGAIYRVFPNGETQYLHPKDGVYPEKVNPGRKEVNAVF  175

Query  561  RSIGN  575
            R IG+
Sbjct  176  RRIGS  180



>ref|XP_001697722.1| photosystem I reaction center subunit II, 20 kDa [Chlamydomonas 
reinhardtii]
 sp|Q39615.1|PSAD_CHLRE RecName: Full=Photosystem I reaction center subunit II, chloroplastic; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Chlamydomonas reinhardtii]
 gb|AAL73208.1|AF335592_1 photosystem I subunit [Chlamydomonas reinhardtii]
 emb|CAA56122.1| psaD [Chlamydomonas reinhardtii]
 emb|CAA52440.1| PSI reaction center, subunit II [Chlamydomonas reinhardtii]
 gb|EDO99874.1| photosystem I reaction center subunit II, 20 kDa [Chlamydomonas 
reinhardtii]
Length=196

 Score =   203 bits (517),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
            +T PTL+P+TPSPIFGGSTGGLLRKAQ EEFYVITW + KEQIFEMPTGGAAIMR+G NL
Sbjct  53   WTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNL  112

Query  381  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  560
            LK  +KEQCLAL T+LR+K+K+   FYRVFP+G+VQYLHP DGVYPEKVNAGR G  QNM
Sbjct  113  LKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNM  172

Query  561  RSIG  572
            R IG
Sbjct  173  RRIG  176



>ref|XP_001421350.1| psaD, PSI-D, subunit II, photosystem I protein [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO99643.1| psaD, PSI-D, subunit II, photosystem I protein [Ostreococcus 
lucimarinus CCE9901]
Length=192

 Score =   202 bits (514),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
            +T P L+PNTPSPIFGGSTGGLLRKAQVEEFYV+TW + KE IFEMPTGGAAIMR+G NL
Sbjct  50   WTAPKLNPNTPSPIFGGSTGGLLRKAQVEEFYVLTWEAKKEAIFEMPTGGAAIMRKGPNL  109

Query  381  LKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNM  560
            LKLARKEQCLAL    R+K K++   YRVFP+GEVQYLHPKDGVYPEKVN GR G  QNM
Sbjct  110  LKLARKEQCLALLNNFRAKMKLDGCIYRVFPSGEVQYLHPKDGVYPEKVNKGRVGANQNM  169

Query  561  RSIG  572
            RSIG
Sbjct  170  RSIG  173



>sp|Q9T4W8.1|PSAD_CYAPA RecName: Full=Photosystem I reaction center subunit II, cyanelle; 
AltName: Full=Photosystem I 20 kDa subunit; Short=PSI-D; 
Flags: Precursor [Cyanophora paradoxa]
 emb|CAB64901.1| photosystem I reaction centre subunit II precursor [Cyanophora 
paradoxa]
Length=220

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +3

Query  192  PVGFTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREG  371
            P  F+ PTL+ N P+PIFGGSTGGLLRKA+VEEFY ITWT   E +FE+PTGGAAIMR G
Sbjct  71   PKPFSVPTLNLNAPTPIFGGSTGGLLRKAEVEEFYSITWTGKSETVFELPTGGAAIMRAG  130

Query  372  ANLLKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGV  548
             NLL+LARKEQC+ALG +L+ K+KI +Y+ YRV+P+GEVQ+LHPKDGV+PEKVN GR  V
Sbjct  131  ENLLRLARKEQCIALGAQLKDKFKITDYKIYRVYPSGEVQFLHPKDGVFPEKVNPGRVAV  190

Query  549  GQNMRSIGN  575
            G N R IG 
Sbjct  191  GSNKRRIGQ  199



>ref|YP_009019626.1| photosystem I reaction center subunit II (chloroplast) [Gracilaria 
salicornia]
 gb|AHH24594.1| photosystem I reaction center subunit II (chloroplast) [Gracilaria 
salicornia]
Length=141

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            T+D   PSP FGGSTGG LR A++EE Y ITWTS KEQIFEMPTGGAAIM+EG NLL LA
Sbjct  4    TIDLKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKKEQIFEMPTGGAAIMQEGNNLLYLA  63

Query  393  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+L++++KI +++ YR+FPN EVQYLHPKDGV+PEKVNAGR G+G    SI
Sbjct  64   RKEQCLALGTQLKTQFKITDFKIYRIFPNSEVQYLHPKDGVFPEKVNAGRVGIGNIDHSI  123

Query  570  G  572
            G
Sbjct  124  G  124



>ref|YP_001293570.1| photosystem I subunit II [Rhodomonas salina]
 gb|ABO70759.1| photosystem I subunit II [Rhodomonas salina]
Length=141

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+   PSP F GSTGG LR A+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LA
Sbjct  4    TLNLQIPSPTFEGSTGGWLRAAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGENLLYLA  63

Query  393  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLAL T++++ +KI +Y+ YR+FP+GEVQYLHPKDGV+PEKVNAGR GVG    SI
Sbjct  64   RKEQCLALATQVKNSFKITDYKVYRIFPSGEVQYLHPKDGVFPEKVNAGRVGVGNVSHSI  123

Query  570  G  572
            G
Sbjct  124  G  124



>gb|AJO68451.1| photosystem I subunit II (chloroplast) [Gracilariopsis lemaneiformis]
Length=141

 Score =   181 bits (459),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            T+D   PSP FGGSTGG LR A++EE Y ITWTS +EQIFEMPTGG+AIMREG NLL LA
Sbjct  4    TIDLKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKQEQIFEMPTGGSAIMREGNNLLYLA  63

Query  393  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            +KEQCLAL ++L +K+KI +++ YR+FPNGEVQYLHPKDGV+PEKVNAGR  VG    SI
Sbjct  64   KKEQCLALSSQLNTKFKITDFKIYRIFPNGEVQYLHPKDGVFPEKVNAGRSSVGNISHSI  123

Query  570  G  572
            G
Sbjct  124  G  124



>ref|YP_005088653.1| photosystem I subunit II [Phaeocystis antarctica]
 gb|AEK26757.1| photosystem I subunit II [Phaeocystis antarctica]
Length=141

 Score =   180 bits (456),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +3

Query  216  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  395
            LD    SP FGGSTGG LR A+ EE Y ITWTS KEQIFEMPT G+AIM++G NLL LA+
Sbjct  5    LDLQIASPTFGGSTGGWLRAAETEEKYAITWTSKKEQIFEMPTSGSAIMQKGENLLYLAK  64

Query  396  KEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            KEQCLALGT+LR+ +KIN Y+ YR+FPN EVQYLHPKDGV+PEK+NAGR GVG  M SIG
Sbjct  65   KEQCLALGTQLRTSFKINDYKIYRIFPNSEVQYLHPKDGVFPEKLNAGRLGVGNVMHSIG  124



>ref|YP_008145427.1| photosystem I subunit II (chloroplast) [Phaeocystis globosa]
 gb|AGO44889.1| photosystem I subunit II (chloroplast) [Phaeocystis globosa]
Length=141

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 1/120 (1%)
 Frame = +3

Query  216  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  395
            LD    SP FGGSTGG LR A+ EE Y ITWTS KEQIFEMPT G+AIM++G NLL LA+
Sbjct  5    LDLQIASPTFGGSTGGWLRAAETEEKYAITWTSKKEQIFEMPTSGSAIMQKGENLLYLAK  64

Query  396  KEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            KEQCLALGT+LR+ +K+N Y+ YR+FPN EVQYLHPKDGV+PEK+NAGR GVG  M SIG
Sbjct  65   KEQCLALGTQLRTSFKVNDYKIYRIFPNSEVQYLHPKDGVFPEKLNAGRLGVGNVMHSIG  124



>ref|WP_009769007.1| PsaD protein [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ66743.1| PsaD protein [Oscillatoriales cyanobacterium JSC-12]
Length=139

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            PIFGGSTGGLL KA VEE Y ITW+SPKEQ+FEMPT GAA+MR+G NLL LARKEQCLAL
Sbjct  10   PIFGGSTGGLLTKALVEEKYAITWSSPKEQVFEMPTAGAAVMRQGDNLLYLARKEQCLAL  69

Query  417  GTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            GT+L++K+KI+Y+ YRVFPNG++QYLHP DGVYPEKVN GR  V    R+IG
Sbjct  70   GTQLKTKFKIDYKIYRVFPNGDIQYLHPADGVYPEKVNPGRVAVNSVPRNIG  121



>ref|YP_004376584.1| photosystem I ferredoxin-binding protein (chloroplast) [Fistulifera 
solaris]
 dbj|BAK18950.1| photosystem I ferredoxin-binding protein (chloroplast) [Fistulifera 
solaris]
Length=139

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62   RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRSAVNSRQFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|YP_007627400.1| photosystem I subunit II [Chondrus crispus]
 emb|CCP38147.1| photosystem I subunit II [Chondrus crispus]
Length=141

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            T++   PSP FGGSTGG LR A++EE Y ITWTS  EQIFEMPTGGAAIMREG NLL LA
Sbjct  4    TINFKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKSEQIFEMPTGGAAIMREGDNLLYLA  63

Query  393  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            +KEQCLAL  +LR  +KI +++ YR+FPNGEVQYLHPKDGV+PEKVN GREGVG    SI
Sbjct  64   KKEQCLALSAQLRKSFKIRDFKIYRIFPNGEVQYLHPKDGVFPEKVNPGREGVGNISHSI  123

Query  570  G  572
            G
Sbjct  124  G  124



>ref|YP_009029191.1| photosystem I reaction center subunit II (chloroplast) [Didymosphenia 
geminata]
 gb|AGH28722.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Didymosphenia geminata]
Length=139

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62   RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTAVNSRQFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|NP_050759.1| photosystem I subunit II (chloroplast) [Guillardia theta]
 sp|O78502.1|PSAD_GUITH RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Guillardia theta]
 gb|AAC35693.1| PSI ferredoxin-binding protein II (chloroplast) [Guillardia theta]
Length=141

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+   PSP F GSTGG LR A+ EE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LA
Sbjct  4    TLNLQIPSPTFEGSTGGWLRAAETEEKYAITWTSPKEQVFEMPTGGAAIMRKGENLLYLA  63

Query  393  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT++++ +KI +Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR GVG    SI
Sbjct  64   RKEQCLALGTQVKTSFKITDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRIGVGNVSHSI  123

Query  570  G  572
            G
Sbjct  124  G  124



>ref|WP_008312724.1| PsaD [Leptolyngbya sp. PCC 6406]
Length=142

 Score =   177 bits (450),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KA VEE Y ITWTS +EQ+FE+PTGGAAIM EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAAVEEKYAITWTSTQEQVFELPTGGAAIMNEGENLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LGT+LR+K+K   ++Y+ YR++PNGE QYLHP DGV+PEKVN GRE VG   RSIG
Sbjct  69   LGTQLRTKFKPKIVDYKIYRIYPNGETQYLHPADGVFPEKVNEGREAVGSVSRSIG  124



>ref|WP_015173693.1| photosystem I protein PsaD [Geitlerinema sp. PCC 7407]
 gb|AFY68129.1| photosystem I protein PsaD [Geitlerinema sp. PCC 7407]
Length=142

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KA+VEE Y ITWTS K+Q+FEMPTGGAA+M EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAEVEEKYAITWTSKKQQVFEMPTGGAAVMNEGENLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LG +LR+K+K    +Y+ YRVFPNGE+QYLHPKDGV+PEKVN GR  V  N R IG+
Sbjct  69   LGAQLRTKFKPKMEDYKIYRVFPNGEIQYLHPKDGVFPEKVNEGRTSVNHNPRKIGD  125



>gb|AIA21513.1| photosystem I subunit II [Pyropia fucicola]
Length=141

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +3

Query  207  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  386
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  387  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  563
            LA+KEQCLALGT+L+SK+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  V     
Sbjct  62   LAKKEQCLALGTQLKSKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASVNSVDH  121

Query  564  SIG  572
            SIG
Sbjct  122  SIG  124



>ref|YP_008144865.1| photosystem I reaction center subunit II [Grateloupia taiwanensis]
 gb|AGO19836.1| photosystem I reaction center subunit II [Grateloupia taiwanensis]
Length=133

 Score =   176 bits (447),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +3

Query  231  PSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCL  410
            PSP FGGSTGG LR A++EE Y ITWTS  EQIFEMPTGGAAIMREG NLL LA+KEQCL
Sbjct  2    PSPTFGGSTGGWLRAAEIEEKYAITWTSKSEQIFEMPTGGAAIMREGNNLLYLAKKEQCL  61

Query  411  ALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            AL T+LR+K+KI +++ YR+FP+GEVQYLHPKDGV+PEK N GRE VG    SIG
Sbjct  62   ALSTQLRAKFKITDFKIYRIFPDGEVQYLHPKDGVFPEKANPGRESVGNIQHSIG  116



>ref|YP_007947808.1| photosystem I subunit II (chloroplast) [Pyropia haitanensis]
 gb|AGG37057.1| photosystem I subunit II (chloroplast) [Pyropia haitanensis]
Length=141

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +3

Query  207  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  386
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  387  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  563
            LA+KEQCLALGT+L+SK+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  V     
Sbjct  62   LAKKEQCLALGTQLKSKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASVNSVDH  121

Query  564  SIG  572
            SIG
Sbjct  122  SIG  124



>gb|AFC39948.1| photosystem I subunit II [Porphyra umbilicalis]
Length=141

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = +3

Query  207  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  386
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR+G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRDGENLLY  61

Query  387  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  563
            LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR+ +     
Sbjct  62   LAKKEQCLALGTQLKGKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRDSINSVDH  121

Query  564  SIG  572
            SIG
Sbjct  122  SIG  124



>ref|YP_009029026.1| photosystem I reaction center subunit II (chloroplast) [Cylindrotheca 
closterium]
 gb|AGH28565.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Cylindrotheca closterium]
Length=139

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSAKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  VG    SIG
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRISVGSRDFSIG  121



>ref|WP_015145740.1| PsaD [Pleurocapsa minor]
 gb|AFY79442.1| PsaD [Pleurocapsa sp. PCC 7327]
Length=142

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA VEE Y ITWTSPKEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PKFGGSTGGLLTKADVEEKYAITWTSPKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            G +LR+K+K    NY+ YR++PNGE+QYLHP DGV+PEKVN GR  VG+  RSIG
Sbjct  70   GAQLRTKFKPKIENYKIYRIYPNGEIQYLHPADGVFPEKVNEGRVAVGKKDRSIG  124



>ref|YP_001936347.1| photosystem I subunit II [Heterosigma akashiwo]
 gb|ABV65953.1| photosystem I reaction center subunit II [Heterosigma akashiwo]
 gb|ABV70094.1| photosystem I reaction center subunit II [Heterosigma akashiwo]
Length=139

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  T SPIFGGSTGG LR A++EE YVITW+S KEQ+FEMPTGGAAIM +G NLL LA
Sbjct  2    TLNLQTFSPIFGGSTGGWLRAAEIEEKYVITWSSSKEQLFEMPTGGAAIMLQGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LRS +KIN Y+ YR+FPNGE+QYLHPKDGV+PEKVN GR  VG    SI
Sbjct  62   RKEQCLALGTQLRS-FKINDYKIYRLFPNGEIQYLHPKDGVFPEKVNPGRLAVGSRNFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|YP_063618.1| photosystem I subunit II [Gracilaria tenuistipitata var. liui]
 gb|AAT79693.1| photosystem I reaction center subunit II [Gracilaria tenuistipitata 
var. liui]
Length=141

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 1/121 (1%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            T+D   PSP FGGSTGG LR A++EE Y ITWTS +EQIFEMP GGAAIMREG NLL LA
Sbjct  4    TIDLKMPSPTFGGSTGGWLRSAEIEEKYAITWTSKQEQIFEMPIGGAAIMREGNNLLYLA  63

Query  393  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLAL T+L+ ++KI +++ YR+FPN EVQYLHPKDGV+PEKVN GR G+G    SI
Sbjct  64   RKEQCLALSTQLKMQFKIKDFKIYRIFPNSEVQYLHPKDGVFPEKVNPGRVGIGNIDHSI  123

Query  570  G  572
            G
Sbjct  124  G  124



>ref|YP_005089671.1| psaD gene product (chloroplast) [Ulnaria acus]
 gb|AEX37796.1| photosystem I subunit II (chloroplast) [Ulnaria acus]
Length=139

 Score =   176 bits (445),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSTKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SIG
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRSAVNSREFSIG  121



>ref|YP_008965721.1| photosystem I reaction center subunit II (chloroplast) [Porphyridium 
purpureum]
 dbj|BAO23697.1| photosystem I reaction center subunit II (chloroplast) [Porphyridium 
purpureum]
Length=142

 Score =   176 bits (445),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 102/131 (78%), Gaps = 5/131 (4%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            T++   PSP FGGSTGG LR A+ EE Y ITWT  KE+IFE+PTGGAAIMREG NLL LA
Sbjct  4    TINLQMPSPTFGGSTGGWLRAAETEEKYAITWTGKKEEIFEIPTGGAAIMREGDNLLYLA  63

Query  393  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KI +Y+ YR+FP GEVQYLHPKDGV+PEKVN GR G+    R+I
Sbjct  64   RKEQCLALGTQLRNSFKISDYKIYRIFPTGEVQYLHPKDGVFPEKVNEGRVGINNVSRNI  123

Query  570  GN----ISVRL  590
            G     ISV+ 
Sbjct  124  GKNPNPISVKF  134



>ref|YP_874394.1| photosystem I ferredoxin-binding protein [Phaeodactylum tricornutum]
 gb|ABK20617.1| photosystem I ferredoxin-binding protein [Phaeodactylum tricornutum]
Length=139

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMP GGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSPKEQIFEMPIGGAAIMRSGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62   RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTAVNNRDFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|WP_018400163.1| Photosystem I reaction center subunit II [filamentous cyanobacterium 
ESFC-1]
Length=142

 Score =   175 bits (444),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA+VEE Y ITWTSPKEQ+FEMPTGGAAIM EG N+L+LARKEQCLAL
Sbjct  10   PKFGGSTGGLLTKAKVEEKYAITWTSPKEQVFEMPTGGAAIMNEGENMLELARKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    +Y+ YR++PNGE+QYLHP DGV+PEKVN GR  VG+  R IG+
Sbjct  70   GTQLRTKFKPKMEDYKIYRIYPNGEIQYLHPADGVFPEKVNEGRPYVGKKDRKIGD  125



>ref|NP_053889.1| photosystem I subunit II [Porphyra purpurea]
 sp|P51279.1|PSAD_PORPU RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Porphyra purpurea]
 gb|AAC08165.1| Photosystem I reaction centre subunit II (chloroplast) [Porphyra 
purpurea]
Length=141

 Score =   175 bits (444),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +3

Query  207  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  386
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR+G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRDGENLLY  61

Query  387  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  563
            LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  +     
Sbjct  62   LAKKEQCLALGTQLKGKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASINSVDH  121

Query  564  SIG  572
            SIG
Sbjct  122  SIG  124



>ref|YP_536961.1| photosystem I subunit II [Pyropia yezoensis]
 sp|Q1XDK7.1|PSAD_PYRYE RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Pyropia yezoensis]
 dbj|BAE92404.1| Photosystem I reaction centre subunit II [Pyropia yezoensis]
 gb|AGH27605.1| photosystem I subunit II (chloroplast) [Pyropia yezoensis]
Length=141

 Score =   175 bits (443),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +3

Query  207  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  386
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  387  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  563
            LA+KEQCLALGT+L+SK+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVN GR  V     
Sbjct  62   LAKKEQCLALGTQLKSKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNTGRASVNSVDH  121

Query  564  SIG  572
            SIG
Sbjct  122  SIG  124



>ref|YP_009028878.1| photosystem I reaction center subunit II (chloroplast) [Coscinodiscus 
radiatus]
 gb|AGH28422.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Coscinodiscus radiatus]
Length=139

 Score =   175 bits (443),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR+ +     SI
Sbjct  62   RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRKAINSRNFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|YP_009092872.1| photosystem I subunit II (chloroplast) [Chaetoceros simplex]
 gb|AIR75263.1| photosystem I subunit II (chloroplast) [Chaetoceros simplex]
Length=139

 Score =   175 bits (443),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62   RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRDFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|YP_009093339.1| photosystem I subunit II (chloroplast) [Cerataulina daemon]
 gb|AIR76012.1| photosystem I subunit II (chloroplast) [Cerataulina daemon]
Length=139

 Score =   174 bits (442),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62   RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRDFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|YP_009059209.1| photosystem I reaction center subunit II (chloroplast) [Eunotia 
naegelii]
 gb|AHI51156.1| photosystem I reaction center subunit II (chloroplast) [Eunotia 
naegelii]
Length=139

 Score =   174 bits (442),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SIG
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRGFSIG  121



>ref|NP_043647.1| photosystem I subunit II [Odontella sinensis]
 sp|P49481.1|PSAD_ODOSI RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Odontella sinensis]
 emb|CAA91679.1| PSI, ferredoxin-binding protein II [Odontella sinensis]
Length=139

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 98/121 (81%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62   RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRGFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|WP_023068767.1| photosystem I reaction center subunit II [Lyngbya aestuarii]
 gb|ERT04980.1| photosystem I reaction center subunit II [Lyngbya aestuarii BL 
J]
Length=142

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 100/116 (86%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            PIFGGSTGGLL KA++EE Y ITWTSPKEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PIFGGSTGGLLSKAEIEEKYAITWTSPKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    +++ YR++PNGE++YLHPKDGV+PEKVN GR+  G+  R+IG+
Sbjct  70   GTQLRTKFKPKMEDFKIYRIYPNGEMEYLHPKDGVFPEKVNEGRDFYGKIERNIGS  125



>gb|AIA21307.1| photosystem I subunit II [Pyropia kanakaensis]
Length=141

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +3

Query  207  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  386
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   E  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKNESKFEMPTGGTATMRNGENLLY  61

Query  387  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  563
            LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  V     
Sbjct  62   LAKKEQCLALGTQLKIKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASVNSVDH  121

Query  564  SIG  572
            SIG
Sbjct  122  SIG  124



>ref|WP_009787700.1| photosystem I subunit II [Lyngbya sp. PCC 8106]
 gb|EAW33738.1| photosystem I subunit II [Lyngbya sp. PCC 8106]
Length=142

 Score =   174 bits (441),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 99/115 (86%), Gaps = 3/115 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            PIFGGSTGGLL KA++EE Y ITWTSPKEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PIFGGSTGGLLSKAEIEEKYAITWTSPKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            GT+LR+K+K    +++ YR++PNGE++YLHPKDGV+PEKVN GR+  G+  R+IG
Sbjct  70   GTQLRTKFKPKIEDFKIYRIYPNGEMEYLHPKDGVFPEKVNEGRDFYGKIERNIG  124



>ref|YP_003734986.1| photosystem I protein subunit II [Durinskia baltica]
 gb|ADI40201.1| photosystem I protein subunit II [Durinskia baltica]
Length=139

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  +     SIG
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRVAMNSRDFSIG  121



>ref|WP_006616635.1| MULTISPECIES: photosystem I protein PsaD [Arthrospira]
 gb|EDZ95101.1| photosystem I protein PsaD [Arthrospira maxima CS-328]
 dbj|BAI90809.1| photosystem I reaction center subunit II [Arthrospira platensis 
NIES-39]
 emb|CCE16228.1| Photosystem I reaction center subunit II (Photosystem I 16 kDa 
polypeptide) (PSI-D) [Arthrospira sp. PCC 8005]
 gb|EKD05964.1| photosystem I protein PsaD [Arthrospira platensis C1]
 emb|CDM94815.1| Photosystem I reaction center subunit II (Photosystem I 16 kDa 
polypeptide) (PSI-D) [Arthrospira sp. PCC 8005]
 gb|KDR56251.1| Photosystem I reaction center subunit II [Arthrospira platensis 
str. Paraca]
Length=142

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL KAQVEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLA
Sbjct  9    APKFGGSTGGLLTKAQVEEKYAITWTSTKEQVFEMPTGGAAIMNEGENLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LGT+LR+K+K    +++ YR+FPNGE++YLHPKDGV+PEKVN GRE  G+  R IG+
Sbjct  69   LGTQLRTKFKPKIEDFKIYRIFPNGEMEYLHPKDGVFPEKVNEGREFNGKIDRKIGD  125



>ref|YP_009029302.1| photosystem I reaction center subunit II (chloroplast) [Leptocylindrus 
danicus]
 gb|AGH28833.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Leptocylindrus danicus]
Length=139

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGGAA+MR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGAAVMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR  +KIN Y+ YR+FP+GEVQYLHPKDGV+PEK N GR  V     SI
Sbjct  62   RKEQCLALGTQLRG-FKINGYKIYRIFPSGEVQYLHPKDGVFPEKANPGRTSVNSRGFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|WP_026795097.1| MULTISPECIES: Photosystem I reaction center subunit II [Planktothrix]
Length=142

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NL+ LARKEQCLAL
Sbjct  10   PKFGGSTGGLLTKALVEEKYAITWTSSKEQVFEMPTGGAAIMNEGDNLMYLARKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LRSK+K    NY+ YRVFPNGE +YLHPKDGV+PEKVN GR+ V     +IG+
Sbjct  70   GTQLRSKFKPKIDNYKIYRVFPNGETEYLHPKDGVFPEKVNEGRQSVNSVAHNIGS  125



>gb|AIA20054.1| photosystem I subunit II [Pyropia perforata]
Length=141

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +3

Query  207  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  386
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   +  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKSDSKFEMPTGGTATMRNGENLLY  61

Query  387  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  563
            LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  V     
Sbjct  62   LAKKEQCLALGTQLKIKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASVNSVNH  121

Query  564  SIG  572
            SIG
Sbjct  122  SIG  124



>ref|YP_003734548.1| ferredoxin-binding protein II [Kryptoperidinium foliaceum]
 gb|ADI40333.1| ferredoxin-binding protein II [Kryptoperidinium foliaceum]
Length=139

 Score =   173 bits (438),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR        SIG
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRVAANSRDFSIG  121



>ref|YP_009027562.1| photosystem I subunit II [Pyropia perforata]
 gb|AGQ17098.1| photosystem I subunit II [Pyropia perforata]
 gb|AHB35056.1| photosystem I subunit II (chloroplast) [Pyropia perforata]
 gb|AHB35265.1| photosystem I subunit II (chloroplast) [Pyropia perforata]
 gb|AIA19427.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA19636.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA19845.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20263.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20472.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20681.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA20890.1| photosystem I subunit II [Pyropia perforata]
 gb|AIA21099.1| photosystem I subunit II [Pyropia perforata]
Length=141

 Score =   173 bits (438),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +3

Query  207  PPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLK  386
            P T++ N PSP FGGSTGG LR A+VEE Y ITWT   +  FEMPTGG A MR G NLL 
Sbjct  2    PDTINLNMPSPTFGGSTGGWLRAAEVEEKYAITWTGKSDSKFEMPTGGTATMRNGENLLY  61

Query  387  LARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMR  563
            LA+KEQCLALGT+L+ K+KI +Y+ YRVFPNGEVQYLHPKDGV+PEKVNAGR  V     
Sbjct  62   LAKKEQCLALGTQLKIKFKISDYKIYRVFPNGEVQYLHPKDGVFPEKVNAGRASVNSVNH  121

Query  564  SIG  572
            SIG
Sbjct  122  SIG  124



>gb|AHY04349.1| photosystem I reaction center subunit II (chloroplast) [Chrysochromulina 
sp. CCMP291]
Length=141

 Score =   173 bits (438),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = +3

Query  216  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  395
            L+   PSP FGGSTGG LR A+ EE Y ITWTS KEQIFEMPT GAAIM+ G NLL LA+
Sbjct  5    LNLQIPSPTFGGSTGGWLRSAETEEKYAITWTSKKEQIFEMPTSGAAIMKSGENLLYLAK  64

Query  396  KEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            KEQCLALGT+LR+ +KI +Y+ YR+FPN EVQYLHPKDG++PEK+N GR GVG    SIG
Sbjct  65   KEQCLALGTQLRTLFKISDYKIYRIFPNSEVQYLHPKDGIFPEKLNQGRVGVGNVGHSIG  124



>ref|YP_874547.1| photosystem I ferredoxin-binding protein [Thalassiosira pseudonana]
 ref|XP_002297531.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|ABK20770.1| photosystem I ferredoxin-binding protein [Thalassiosira pseudonana]
 gb|EED86171.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=139

 Score =   172 bits (436),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSTKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62   RKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRGFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|YP_009029445.1| photosystem I reaction center subunit II (chloroplast) [Lithodesmium 
undulatum]
 gb|AGH28976.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Lithodesmium undulatum]
Length=139

 Score =   172 bits (436),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWTSNKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV PEKVN GR  V     SI
Sbjct  62   RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVSPEKVNPGRTAVNSRGFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|WP_017715328.1| Photosystem I reaction center subunit II [Oscillatoria sp. PCC 
10802]
Length=142

 Score =   172 bits (436),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (83%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KA+VEE Y ITWTS KEQ+FEMPTGGAAIM +G NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAEVEEKYAITWTSSKEQVFEMPTGGAAIMHQGQNLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LG +LR+K+K    +Y+ YR++ NGE+QYLHP DGV+PEKVN GR  VG+  R+IG+
Sbjct  69   LGAQLRTKFKPKIEDYKIYRIYANGEIQYLHPNDGVFPEKVNEGRASVGKKDRNIGS  125



>ref|YP_009093464.1| photosystem I subunit II (chloroplast) [Thalassiosira weissflogii]
 gb|AIR76137.1| photosystem I subunit II (chloroplast) [Thalassiosira weissflogii]
Length=139

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  +     SI
Sbjct  62   RKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSINSRGFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|YP_009093018.1| photosystem I subunit II (chloroplast) [Rhizosolenia imbricata]
 gb|AIR75691.1| photosystem I subunit II (chloroplast) [Rhizosolenia imbricata]
Length=139

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSKKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SIG
Sbjct  62   RKEQCLALGTQLRTFKLNNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRIPVNSRPFSIG  121



>ref|YP_009093191.1| photosystem I subunit II (chloroplast) [Roundia cardiophora]
 gb|AIR75864.1| photosystem I subunit II (chloroplast) [Roundia cardiophora]
Length=139

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGAAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62   RKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRVSVNSRGFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|WP_008189408.1| PsaD [Moorea producens]
 gb|EGJ29445.1| PsaD [Moorea producens 3L]
Length=142

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 98/117 (84%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KA+VEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAEVEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LGT+LR+K+K    +Y+ YRV+PNGE+Q+LHP DGV+PEKVN GR   G+  R+IG+
Sbjct  69   LGTQLRTKFKPKIEDYKIYRVYPNGEIQFLHPADGVFPEKVNEGRPYAGKIDRNIGS  125



>sp|O96800.1|PSAD_SKECO RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D (chloroplast) 
[Skeletonema costatum]
 emb|CAA10621.1| PSI ferredoxin-binding protein II [Skeletonema costatum]
Length=139

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 97/121 (80%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGG+AIMR G NLL LA
Sbjct  2    TLNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSAKEQIFEMPTGGSAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SI
Sbjct  62   RKEQCLALSTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTSVNSRGFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>gb|EHC11738.1| photosystem I protein PsaD [Fischerella sp. JSC-11]
Length=159

 Score =   172 bits (435),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 4/125 (3%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
            F   TL   TP  IFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NL
Sbjct  17   FMAETLSGQTP--IFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGQNL  74

Query  381  LKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  557
            L LARKEQC+ALG +LR K+KI +Y+ YR++PNGE  Y+HP DGV+PEKVN GRE V  N
Sbjct  75   LYLARKEQCIALGGQLR-KFKITDYKIYRIYPNGETVYIHPADGVFPEKVNQGREKVRYN  133

Query  558  MRSIG  572
             R IG
Sbjct  134  DRRIG  138



>ref|WP_016872271.1| MULTISPECIES: Photosystem I reaction center subunit II [Fischerella]
Length=142

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 2/114 (2%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LARKEQC+A
Sbjct  9    TPIFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGQNLLYLARKEQCIA  68

Query  414  LGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LG +LR K+KI +Y+ YR++PNGE  Y+HP DGV+PEKVN GRE V  N R IG
Sbjct  69   LGGQLR-KFKITDYKIYRIYPNGETVYIHPADGVFPEKVNQGREKVRYNDRRIG  121



>ref|YP_277398.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AAU81920.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AAX13897.1| photosystem I subunit II [Emiliania huxleyi]
 gb|AEI29557.1| photosystem I subunit II [Emiliania huxleyi]
Length=142

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = +3

Query  201  FTPPTLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANL  380
             T   L+   P+P FGGSTGG LR A++EE Y ITWTS KEQIFEMPT GAAIM++G NL
Sbjct  1    MTSDVLNLQIPTPTFGGSTGGWLRAAEIEEKYAITWTSKKEQIFEMPTSGAAIMQKGENL  60

Query  381  LKLARKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQN  557
            L LA+KEQCLAL T+LR+ +KI +Y+ YR+FPN EVQYLHPKDGV+PEK+N GR GVG  
Sbjct  61   LYLAKKEQCLALSTQLRTLFKISDYKIYRIFPNSEVQYLHPKDGVFPEKLNEGRIGVGNV  120

Query  558  MRSIG  572
              SIG
Sbjct  121  GYSIG  125



>ref|WP_015195039.1| photosystem I protein PsaD [Stanieria cyanosphaera]
 gb|AFZ37380.1| photosystem I protein PsaD [Stanieria cyanosphaera PCC 7437]
Length=142

 Score =   171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 96/117 (82%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL KAQVEE Y ITWTSPKEQ+FEMPTGGAA M EG N+L LARKEQC+A
Sbjct  9    APQFGGSTGGLLYKAQVEEKYAITWTSPKEQVFEMPTGGAATMNEGDNILYLARKEQCIA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            +G +LR+K+K    NY+ YR++PNGEVQYLHP DGV+PEKVN GRE  G+  R IG+
Sbjct  69   MGAQLRTKFKPKIENYKIYRIYPNGEVQYLHPADGVFPEKVNEGREYNGKIDRKIGD  125



>ref|WP_036530202.1| Photosystem I reaction center subunit II [Neosynechococcus sphagnicola]
 gb|KGF74025.1| Photosystem I reaction center subunit II [Neosynechococcus sphagnicola 
sy1]
Length=139

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 96/113 (85%), Gaps = 2/113 (2%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P+FGGSTGGLL  A VEE Y ITWTSPK Q+FEMPTGGAA M+EG NLL LARKEQCLAL
Sbjct  10   PLFGGSTGGLLTNADVEEKYAITWTSPKAQVFEMPTGGAATMQEGENLLPLARKEQCLAL  69

Query  417  GTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            GT+LR K+KI +Y+ YR+FP G+V+YLHPKDGV+PEKVNAGRE  G+  R+IG
Sbjct  70   GTQLR-KFKITDYKIYRIFPGGDVEYLHPKDGVFPEKVNAGREFAGKKDRNIG  121



>ref|YP_007878240.1| photosystem I subunit II (chloroplast) [Calliarthron tuberculosum]
 gb|AGA63851.1| photosystem I subunit II (chloroplast) [Calliarthron tuberculosum]
Length=141

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            T++   PSP FGGSTGG LR A+VEE Y ITW S KEQIFEMPTGGAAIMRE  NLL L+
Sbjct  4    TINFQMPSPTFGGSTGGWLRSAEVEEKYAITWNSKKEQIFEMPTGGAAIMREDDNLLYLS  63

Query  393  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLAL ++L SK+KI + + YR+FP+GEVQYLHPKDGV PEKVN+GR GVG    SI
Sbjct  64   RKEQCLALSSQLLSKFKIRDCKIYRIFPSGEVQYLHPKDGVVPEKVNSGRIGVGNIDHSI  123

Query  570  G  572
            G
Sbjct  124  G  124



>ref|WP_026788324.1| MULTISPECIES: Photosystem I reaction center subunit II [Planktothrix]
Length=142

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NL+ LA KEQCLAL
Sbjct  10   PKFGGSTGGLLTKALVEEKYAITWTSSKEQVFEMPTGGAAIMNEGDNLMYLALKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LRSK+K    NY+ YRVFPNGE +YLHPKDGV+PEKVN GR+ V     +IG+
Sbjct  70   GTQLRSKFKPKIDNYKIYRVFPNGETEYLHPKDGVFPEKVNEGRQSVNSVAHNIGS  125



>ref|WP_028824843.1| Photosystem I reaction center subunit II [Proteobacteria bacterium 
JGI 0000113-P07]
Length=139

 Score =   170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TLD    +PIFGGSTGG LR AQ+EE Y ITW+S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLDSQIQTPIFGGSTGGWLRAAQIEEKYAITWSSAKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEK N GR        SI
Sbjct  62   RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKSNEGRVQANNRQFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|YP_009051089.1| photosystem I subunit II [Galdieria sulphuraria]
 ref|XP_005705023.1| [pt] photosystem I subunit II [Galdieria sulphuraria]
 gb|ADO32968.1| photosystem I 20kDa subunit [Galdieria sulphuraria]
 gb|EME28503.1| [pt] photosystem I subunit II [Galdieria sulphuraria]
 gb|AIG92532.1| photosystem I subunit II [Galdieria sulphuraria]
Length=141

 Score =   170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+   PSP FGGSTGG LR A+ EE Y ITW S  E++FEMPT GAA+MR G NLL  A
Sbjct  4    TLNLKMPSPSFGGSTGGWLRSAENEEKYAITWISKNEEVFEMPTAGAALMRSGENLLYFA  63

Query  393  RKEQCLALGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCL+LGT+L++++KI NY+ YRVFPNGE+QYLHPKDGV+PEKVN GR+ +    RSI
Sbjct  64   RKEQCLSLGTQLKTQFKIDNYKIYRVFPNGEIQYLHPKDGVFPEKVNEGRKAINTLTRSI  123

Query  570  G  572
            G
Sbjct  124  G  124



>gb|AFR24825.1| photosystem I reaction center subunit II [uncultured Pelagomonas]
Length=139

 Score =   170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TLD    +PIFGGSTGG LR AQ+EE Y ITW+S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLDSQIQTPIFGGSTGGWLRAAQIEEKYAITWSSAKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLALGT+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEK N GR        SI
Sbjct  62   RKEQCLALGTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKSNEGRVQANNRQFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|YP_009028619.1| photosystem I reaction center subunit II (chloroplast) [Asterionella 
formosa]
 gb|AGH28170.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Asterionella formosa]
Length=139

 Score =   170 bits (431),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPT GAAIMR G NLL L+
Sbjct  2    TLNLQTPFPTFGGSTGGWLRSAEVEEKYAITWTSNKEQIFEMPTAGAAIMRNGENLLYLS  61

Query  393  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            RKEQCLALGT+LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN GR  V     SIG
Sbjct  62   RKEQCLALGTQLRTFKINNYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRTPVNTRDFSIG  121



>ref|WP_019505782.1| Photosystem I reaction center subunit II [Pleurocapsa sp. PCC 
7319]
Length=142

 Score =   170 bits (431),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA+VEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PQFGGSTGGLLTKAEVEEKYAITWTSKKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            G +LR+K+K    +Y+ YRVFP+GE QYLHP DGV+PEKVN GRE  G+  RSIG 
Sbjct  70   GAQLRTKFKPRIQDYKIYRVFPSGETQYLHPADGVFPEKVNEGREFNGKKDRSIGQ  125



>ref|WP_044204978.1| Photosystem I reaction center subunit II [Coleofasciculus chthonoplastes]
Length=150

 Score =   170 bits (431),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P+FGGSTGGLL KAQVEE Y ITWTS K+Q+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  18   PLFGGSTGGLLTKAQVEEKYAITWTSSKKQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  77

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+++K    +Y+ YR++P+GE+QYLHP DGV+PEKVN GR  VG+  R IGN
Sbjct  78   GTQLRTQFKPKMEDYKIYRIYPSGEIQYLHPADGVFPEKVNEGRPFVGKIDRKIGN  133



>ref|WP_017300022.1| Photosystem I reaction center subunit II [Nodosilinea nodulosa]
Length=142

 Score =   170 bits (430),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 95/116 (82%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KAQVEE Y ITWTSPK+Q+FEMPTGGAA M EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAQVEEKYAITWTSPKKQVFEMPTGGAAFMNEGENLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LGT+LR+K+K    +Y+ YRV+P+GE QYLHP DGV+PEKVN GR  V    R+IG
Sbjct  69   LGTQLRTKFKPRIDDYKVYRVYPSGETQYLHPADGVFPEKVNEGRGPVNSVARNIG  124



>ref|WP_035996822.1| Photosystem I reaction center subunit II [Leptolyngbya sp. JSC-1]
Length=142

 Score =   170 bits (430),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 94/117 (80%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KA  EE Y ITWTS KEQ+FEMPTGGAA+MR+G NLL LARKEQC+A
Sbjct  9    TPIFGGSTGGLLSKADEEEKYAITWTSSKEQVFEMPTGGAAVMRQGENLLYLARKEQCIA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LG +LRSK+K    +Y+ YRVFP+GE+QYLHP DGV+PEKVN GR  V    RSIG 
Sbjct  69   LGAQLRSKFKPKIEDYKIYRVFPSGEIQYLHPADGVFPEKVNEGRAAVNSVPRSIGQ  125



>ref|WP_015182846.1| PsaD [Microcoleus sp. PCC 7113]
 gb|AFZ18697.1| PsaD [Microcoleus sp. PCC 7113]
Length=141

 Score =   170 bits (430),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KAQVEE Y ITWTSPK+Q+FEMPTGGAA+M EG NLL L+RKE C+A
Sbjct  9    APIFGGSTGGLLTKAQVEEKYAITWTSPKQQVFEMPTGGAAVMNEGDNLLYLSRKEYCIA  68

Query  414  L-GTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            L G +LR+K+KI NY+ YR+FPNGE+QYLHP DGV+PEKVN GR  VG+  R+IG
Sbjct  69   LGGQQLRAKFKINNYKIYRIFPNGEIQYLHPADGVFPEKVNKGRPYVGKVDRNIG  123



>gb|AJH65942.1| photosystem I reaction center subunit II [Vertebrata lanosa]
Length=143

 Score =   170 bits (430),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            T++   PSP FGGSTGG LR A+VEE Y ITW S  + IFEMPTGG+AIM EG NLL LA
Sbjct  4    TINFKIPSPTFGGSTGGWLRSAEVEEKYAITWNSKNKDIFEMPTGGSAIMAEGDNLLYLA  63

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            +KEQCLAL  +L+SK+KIN ++ YR+FPNGEVQYLHPKDGV+PEKVN GR G+G    +I
Sbjct  64   KKEQCLALSNQLKSKFKINDFKIYRIFPNGEVQYLHPKDGVFPEKVNEGRVGIGYIEHNI  123

Query  570  G  572
            G
Sbjct  124  G  124



>gb|EDX77926.1| photosystem I reaction center subunit II [Coleofasciculus chthonoplastes 
PCC 7420]
Length=156

 Score =   170 bits (431),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 97/116 (84%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P+FGGSTGGLL KAQVEE Y ITWTS K+Q+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  24   PLFGGSTGGLLTKAQVEEKYAITWTSSKKQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  83

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+++K    +Y+ YR++P+GE+QYLHP DGV+PEKVN GR  VG+  R IGN
Sbjct  84   GTQLRTQFKPKMEDYKIYRIYPSGEIQYLHPADGVFPEKVNEGRPFVGKIDRKIGN  139



>ref|YP_003002181.1| photosystem I reaction center subunit II (chloroplast) [Aureoumbra 
lagunensis]
 gb|ACS36893.1| photosystem I reaction center subunit II (chloroplast) [Aureoumbra 
lagunensis]
Length=139

 Score =   169 bits (429),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TLD    +PIF GSTGG LR AQVEE Y ITW S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLDSQIQTPIFEGSTGGWLRAAQVEEKYAITWGSSKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  393  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            RKEQCLALGT+LR+    +Y+ YR+FP+GEVQYLHPKDGV+PEK N GR  VG+   SIG
Sbjct  62   RKEQCLALGTQLRTFKITDYKIYRIFPSGEVQYLHPKDGVFPEKSNEGRIQVGKRDFSIG  121



>ref|YP_003002042.1| photosystem I reaction center subunit II [Aureococcus anophagefferens]
 gb|ACS36806.1| photosystem I reaction center subunit II [Aureococcus anophagefferens]
Length=139

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TLD    +P+FGGSTGG LR AQ+EE Y ITW+S K QIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLDSQIQTPLFGGSTGGWLRAAQIEEKYAITWSSSKSQIFEMPTGGAAIMRTGQNLLYLA  61

Query  393  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            RKEQCLALGT+LR+    +Y+ YR+FP+GEVQYLHPKDGV+PEK N GR        SIG
Sbjct  62   RKEQCLALGTQLRTFKITDYKIYRIFPSGEVQYLHPKDGVFPEKSNEGRVQANNRQFSIG  121



>gb|AIR75448.1| photosystem I subunit II (chloroplast) [Cyclotella sp. L04_2]
 gb|AIR75589.1| photosystem I subunit II (chloroplast) [Cyclotella sp. WC03_2]
Length=138

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +3

Query  216  LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLAR  395
            L+  TP P FGGSTGG LR A+VEE Y ITWTSPKEQIFEMPTGG+AIMR G NLL LAR
Sbjct  3    LNLKTPFPTFGGSTGGWLRAAEVEEKYAITWTSPKEQIFEMPTGGSAIMRSGENLLYLAR  62

Query  396  KEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            KEQCLAL T+LR+ +KIN Y+ YR+FP+GEVQYLHPKDGV+PEKVN GR  +     SIG
Sbjct  63   KEQCLALMTQLRT-FKINDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRIAMNSRGFSIG  121



>ref|WP_039725494.1| MULTISPECIES: Photosystem I reaction center subunit II [Oscillatoriophycideae]
 gb|KIF13826.1| Photosystem I reaction center subunit II [Aphanocapsa montana 
BDHKU210001]
 gb|KIF38764.1| Photosystem I reaction center subunit II [Lyngbya confervoides 
BDU141951]
Length=142

 Score =   169 bits (428),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL  A VEE Y ITWTS KEQ+FEMPTGG+AIM EG NLL LARKEQCLA
Sbjct  9    TPKFGGSTGGLLTAAAVEEKYAITWTSSKEQVFEMPTGGSAIMNEGENLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LG +LR+K+K    +Y+ YR++P+GE QYLHP DGV+PEKVN GRE V +N RSIG
Sbjct  69   LGAQLRTKFKPRIQDYKIYRIYPSGETQYLHPADGVFPEKVNEGRESVNRNDRSIG  124



>ref|WP_017304392.1| Photosystem I reaction center subunit II [Spirulina subsalsa]
Length=142

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PKFGGSTGGLLTKADVEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    +Y+ YR++PNGE QYLHP DGV+PEKVN GR   G+  R+IG+
Sbjct  70   GTQLRTKFKPKIEDYKIYRIYPNGETQYLHPADGVFPEKVNEGRPFAGKKDRNIGS  125



>ref|WP_016876091.1| Photosystem I reaction center subunit II [Chlorogloeopsis fritschii]
Length=142

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAA MR+G NLL LARKEQC+A
Sbjct  9    TPIFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAKMRQGQNLLYLARKEQCIA  68

Query  414  LGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LG++LR     +Y+ YR++PNGE  Y+HP DGV+PEKVN GR+ V  N R IG
Sbjct  69   LGSQLRRFKITDYKIYRIYPNGETAYIHPADGVFPEKVNQGRQKVRYNDRRIG  121



>ref|WP_013323038.1| photosystem I protein PsaD [Cyanothece sp. PCC 7822]
 gb|ADN14945.1| photosystem I protein PsaD [Cyanothece sp. PCC 7822]
Length=141

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 93/115 (81%), Gaps = 3/115 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA +EE Y ITWTSPKEQ+FE+PTGGAAIM EG NLL LARKEQC+AL
Sbjct  9    PKFGGSTGGLLSKANLEEKYAITWTSPKEQVFELPTGGAAIMNEGDNLLYLARKEQCIAL  68

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            G + RSK+K    NY+ YR+FPNGE++YLHP DGV+PEKVN GR   G+  RSIG
Sbjct  69   GGQFRSKFKPKIDNYKIYRIFPNGEIEYLHPADGVFPEKVNEGRAYNGKKDRSIG  123



>ref|WP_017321535.1| Photosystem I reaction center subunit II [cyanobacterium PCC 
7702]
 sp|O07115.1|PSAD_MASLA RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D [Mastigocladus 
laminosus]
 gb|AAC64637.1| photosystem I protein PsaD [Fischerella sp. PCC 7605]
Length=142

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAA MR+G NLL LARKEQC+A
Sbjct  9    TPIFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAKMRQGQNLLYLARKEQCIA  68

Query  414  LGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LG++LR     +Y+ YR++PNGE  Y+HP DGV+PEKVN GR+ V  N R IG
Sbjct  69   LGSQLRRLKITDYKIYRIYPNGETAYIHPADGVFPEKVNPGRQKVRYNDRRIG  121



>ref|WP_016866973.1| Photosystem I reaction center subunit II [Fischerella muscicola]
Length=140

 Score =   167 bits (424),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL LARKEQ +A
Sbjct  9    TPIFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAIMRQGQNLLYLARKEQGIA  68

Query  414  LGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LG +LR K+KI +Y+ YR++PNGE  Y+HP DGV+PEKVN GRE V  N R IG 
Sbjct  69   LGGQLR-KFKITDYKIYRIYPNGETAYIHPADGVFPEKVNQGREKVRYNDRRIGQ  122



>ref|WP_002738785.1| photosystem I reaction center subunit II [Microcystis aeruginosa]
 emb|CCH94447.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9432]
 emb|CCH96336.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9717]
 gb|ELP52789.1| photosystem I reaction center subunit II [Microcystis aeruginosa 
TAIHU98]
 gb|EPF19444.1| Photosystem I 16 kDa polypeptide [Microcystis aeruginosa SPC777]
 gb|EPF19589.1| Photosystem I 16 kDa polypeptide [Microcystis aeruginosa SPC777]
Length=141

 Score =   167 bits (424),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 95/116 (82%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL KA +EE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQ LA
Sbjct  8    APKFGGSTGGLLAKADLEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEQALA  67

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LGT+ R+K+K    +Y+ YR++P+GEVQYLHP DGV+PEKVNAGRE  G+  R+IG
Sbjct  68   LGTQFRTKFKPKIEDYKIYRIYPSGEVQYLHPADGVFPEKVNAGREFFGKKDRNIG  123



>dbj|GAL93034.1| photosystem I subunit II (PsaD) [Microcystis aeruginosa NIES-44]
Length=141

 Score =   167 bits (423),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 95/116 (82%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL KA +EE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKE  LA
Sbjct  8    APKFGGSTGGLLAKADLEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEHALA  67

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LGT+LR+K+K    +Y+ YR++P+GEVQYLHP DGV+PEKVNAGRE  G+  R+IG
Sbjct  68   LGTQLRTKFKPKIEDYKIYRIYPSGEVQYLHPADGVFPEKVNAGREFFGKKDRNIG  123



>ref|WP_002796771.1| Photosystem I reaction center subunit II [Microcystis aeruginosa]
 dbj|BAG02152.1| photosystem I subunit II [Microcystis aeruginosa NIES-843]
 emb|CCI24167.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9809]
Length=141

 Score =   167 bits (423),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 95/116 (82%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL KA +EE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKE  LA
Sbjct  8    APKFGGSTGGLLTKADLEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEHALA  67

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LGT+LR+K+K    +Y+ YR++P+GEVQYLHP DGV+PEKVNAGRE  G+  R+IG
Sbjct  68   LGTQLRTKFKPKIEDYKIYRIYPSGEVQYLHPADGVFPEKVNAGREFFGKKDRNIG  123



>ref|WP_026733629.1| Photosystem I reaction center subunit II [Fischerella sp. PCC 
9605]
Length=142

 Score =   167 bits (423),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P+FGGSTGGLL+KA+VEE Y ITWTSPK+Q+FEMPTGG+AIMR+G NLL LARKEQC+A
Sbjct  9    TPVFGGSTGGLLKKAEVEEKYAITWTSPKQQVFEMPTGGSAIMRQGENLLYLARKEQCIA  68

Query  414  LGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LG +LR K+KI +Y+ YR++PNGE  Y+HP DGV+PEKVN GRE V    RSIG 
Sbjct  69   LGGQLR-KFKITDYKIYRIYPNGETAYIHPADGVFPEKVNQGREKVRYVDRSIGE  122



>ref|WP_011613167.1| photosystem I protein PsaD [Trichodesmium erythraeum]
 gb|ABG52837.1| photosystem I protein PsaD [Trichodesmium erythraeum IMS101]
Length=142

 Score =   167 bits (423),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            PIFGGSTGGLL KA+VEE Y ITWTS KEQ+FEMPTGGAAIM +G NLL LARKEQCLAL
Sbjct  10   PIFGGSTGGLLTKAEVEEKYAITWTSSKEQVFEMPTGGAAIMNQGENLLYLARKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    N++ YRVFP+G  +YLHPKDGV+PEKVN GR   G+  R+IG+
Sbjct  70   GTQLRTKFKPKIDNFKIYRVFPDGSNEYLHPKDGVFPEKVNEGRPYAGKINRNIGS  125



>ref|WP_007305646.1| Photosystem I protein PsaD [Crocosphaera watsonii]
 gb|EAM50690.1| Photosystem I protein PsaD [Crocosphaera watsonii WH 8501]
 emb|CCQ60541.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 0401]
 emb|CCQ48941.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 8502]
 emb|CCQ56533.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 0005]
 emb|CCQ65642.1| photosystem I subunit II (PsaD) [Crocosphaera watsonii WH 0402]
Length=142

 Score =   167 bits (422),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 95/116 (82%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA+ EE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  10   PKFGGSTGGLLSKAEREEKYAITWTSKKEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    +Y+ YRV+P+GE+QYLHP DGV+PEKVN GRE  G+  R IG+
Sbjct  70   GTQLRTKFKPRIQDYKIYRVYPSGEIQYLHPADGVFPEKVNEGREYNGKIDRKIGD  125



>ref|WP_017662216.1| Photosystem I reaction center subunit II [Geitlerinema sp. PCC 
7105]
Length=142

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 96/116 (83%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KA VEE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKADVEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LGT+LR+K+K    +++ YR++PNGE++YLHPKDGV+PEKVN GR    +  R+IG
Sbjct  69   LGTQLRTKFKPKIEDFKIYRIYPNGEMEYLHPKDGVFPEKVNEGRPFNNKVDRNIG  124



>ref|YP_009028747.1| photosystem I reaction center subunit II (chloroplast) [Asterionellopsis 
glacialis]
 gb|AGH28296.1| photosystem I reaction center subunit II (chloroplast) (chloroplast) 
[Asterionellopsis glacialis]
Length=139

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            TL+  TP P FGGSTGG LR A+VEE Y ITW S KEQIFEMPTGGAAIMR G NLL LA
Sbjct  2    TLNLQTPFPTFGGSTGGWLRAAEVEEKYAITWGSNKEQIFEMPTGGAAIMRNGDNLLYLA  61

Query  393  RKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            RKEQCLALG +LR+    NY+ YR+FP+GEVQYLHPKDGV+PEKVN  R        SIG
Sbjct  62   RKEQCLALGMQLRTFKIDNYKIYRIFPSGEVQYLHPKDGVFPEKVNESRTAKNSRDFSIG  121



>ref|WP_007356552.1| MULTISPECIES: photosystem I protein PsaD [Kamptonema]
 emb|CBN57352.1| photosystem I protein PsaD [ [[Oscillatoria] sp. PCC 6506]
Length=141

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            PIFGGSTGGLL KA VEE Y ITW+SPKEQ+FEMPTGGAAIMR+G NLL L RKEQC+AL
Sbjct  10   PIFGGSTGGLLTKALVEEKYAITWSSPKEQVFEMPTGGAAIMRQGDNLLYLPRKEQCIAL  69

Query  417  -GTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
             G +LR+K+KI NY+ YR+FP+G  +YLHPKDGV+PEKVN GR  VG   R+IG+
Sbjct  70   GGQQLRAKFKITNYKIYRIFPDGSTEYLHPKDGVFPEKVNEGRPKVGSVERNIGS  124



>ref|WP_010871317.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 ref|NP_440008.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 sp|P19569.2|PSAD_SYNY3 RecName: Full=Photosystem I reaction center subunit II; AltName: 
Full=Photosystem I 16 kDa polypeptide; Short=PSI-D [Synechocystis 
sp. PCC 6803 substr. Kazusa]
 pdb|4KT0|D Chain D, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|D Chain D, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|DD Chain d, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 pdb|4L6V|4 Chain 4, Crystal Structure Of A Virus Like Photosystem I From 
The Cyanobacterium Synechocystis Pcc 6803
 gb|AAA88625.1| photosystem I subunit II [Synechocystis sp.]
 dbj|BAA16688.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 dbj|BAK48859.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 dbj|BAL27858.1| photosystem I subunit II [Synechocystis sp. PCC 6803 substr. 
GT-I]
 dbj|BAL31028.1| photosystem I subunit II [Synechocystis sp. PCC 6803 substr. 
PCC-N]
 dbj|BAL34197.1| photosystem I subunit II [Synechocystis sp. PCC 6803 substr. 
PCC-P]
 dbj|BAM50390.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
 gb|AGF50377.1| photosystem I subunit II [Synechocystis sp. PCC 6803]
Length=141

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 91/116 (78%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA  EE Y ITWTS  EQ+FEMPTGGAAIM EG NLL LARKEQCLAL
Sbjct  9    PKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLAL  68

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    +Y+ YRV+P+GEVQYLHP DGV+PEKVN GRE  G   R IG 
Sbjct  69   GTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQ  124



>ref|WP_015956499.1| photosystem I protein PsaD [Cyanothece sp. PCC 7424]
 gb|ACK72916.1| photosystem I protein PsaD [Cyanothece sp. PCC 7424]
Length=141

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA++EE Y ITWTSPKEQ+FEMPTGGAAIM EG N+L L+RKEQCLAL
Sbjct  9    PKFGGSTGGLLSKAKLEEKYAITWTSPKEQVFEMPTGGAAIMNEGDNILYLSRKEQCLAL  68

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            G + R+++K    N++ YR+FPNGEV+YLHP DGV+PEKVN GR   G+  R IGN
Sbjct  69   GGQFRTQFKPKIENFKIYRIFPNGEVEYLHPADGVFPEKVNEGRSYFGKKDRKIGN  124



>ref|WP_035986603.1| Photosystem I reaction center subunit II [Leptolyngbya sp. KIOST-1]
Length=142

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KAQVEE Y ITWTSPK+Q+FEMPTGGAA M EG NLL LARKEQCLA
Sbjct  9    TPIFGGSTGGLLTKAQVEEKYAITWTSPKKQVFEMPTGGAAFMNEGENLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LG +LR+K+K    NY+ YRV+ +GE QYLHP DGV+PEKVN GR  V    R+IG
Sbjct  69   LGRQLRAKFKPRIENYKIYRVYASGETQYLHPADGVFPEKVNEGRGAVNSIGRNIG  124



>ref|WP_017288063.1| Photosystem I reaction center subunit II [Leptolyngbya boryana]
Length=140

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P+FGGSTGGLL KA VEE Y ITW+SPKEQ+FEMP  GAA MR+G NLL LARKE CLA
Sbjct  9    APLFGGSTGGLLTKALVEEKYAITWSSPKEQVFEMPMCGAAKMRQGDNLLYLARKEHCLA  68

Query  414  LGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LG +LR+K+KI NY+ YRVFPNGE+QYLHP DGV+PEKVN GR  V    R+IG+
Sbjct  69   LGGQLRTKFKITNYKIYRVFPNGEIQYLHPADGVFPEKVNEGRVAVNSVPRNIGS  123



>ref|WP_002740397.1| MULTISPECIES: photosystem I reaction center subunit II [Microcystis]
 emb|CAO86874.1| psaD [Microcystis aeruginosa PCC 7806]
 emb|CCI02930.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9443]
 emb|CCI08583.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 7941]
 emb|CCI12799.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9806]
 emb|CCI19084.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9807]
 emb|CCI27714.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9808]
 emb|CCI32613.1| Photosystem I reaction center subunit II [Microcystis sp. T1-4]
 emb|CCI38817.1| Photosystem I reaction center subunit II [Microcystis aeruginosa 
PCC 9701]
 gb|ELS50104.1| photosystem I reaction center subunit II [Microcystis aeruginosa 
DIANCHI905]
Length=141

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL KA +EE Y ITWTS KEQ+FEMPTGGAAIM EG NLL LARKE  LA
Sbjct  8    APKFGGSTGGLLAKADLEEKYAITWTSSKEQVFEMPTGGAAIMNEGENLLYLARKEHALA  67

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LGT+ R+K+K    +Y+ YR++P+GEVQYLHP DGV+PEKVNAGRE  G+  R+IG
Sbjct  68   LGTQFRTKFKPKIEDYKIYRIYPSGEVQYLHPADGVFPEKVNAGREFFGKKDRNIG  123



>ref|WP_026721381.1| Photosystem I reaction center subunit II [Fischerella sp. PCC 
9431]
Length=140

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL+KA+VEE Y ITWTS KEQ+FEMPTGGAA+M +G NLL LARKEQC+A
Sbjct  9    TPKFGGSTGGLLKKAEVEEKYAITWTSSKEQVFEMPTGGAAVMSQGENLLYLARKEQCIA  68

Query  414  LGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LG +LR K+KI +Y+ YR++PNGE  Y+HP DGV+PEKVNAGRE V  N R IG
Sbjct  69   LGGQLR-KFKITDYKIYRIYPNGETVYIHPADGVFPEKVNAGREKVRYNDRRIG  121



>ref|WP_006530712.1| PsaD [Gloeocapsa sp. PCC 73106]
 gb|ELR96477.1| PsaD [Gloeocapsa sp. PCC 73106]
Length=142

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 93/116 (80%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL  A  EE Y ITWTS KEQ+FEMPTGGAAIM EG N+L LARKEQCLA
Sbjct  9    TPKFGGSTGGLLSAADREEKYAITWTSSKEQVFEMPTGGAAIMNEGDNILYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LG +LR+K+K    N++ YRVFPNGEVQYLHP DGV+PEKVN GRE  G+  RSIG
Sbjct  69   LGGQLRTKFKPKIENFKIYRVFPNGEVQYLHPADGVFPEKVNPGREYNGKIDRSIG  124



>ref|WP_017309650.1| Photosystem I reaction center subunit II [Fischerella sp. PCC 
9339]
Length=140

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL+KA+VEE Y ITWTS KEQ+FEMPTGGAA+M +G NLL LARKEQC+A
Sbjct  9    TPKFGGSTGGLLKKAEVEEKYAITWTSAKEQVFEMPTGGAAVMSQGQNLLYLARKEQCIA  68

Query  414  LGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LG +LR K+KI +Y+ YR++PNGE  Y+HP DGV+PEKVNAGRE V  N R IG 
Sbjct  69   LGGQLR-KFKITDYKIYRIYPNGETVYIHPADGVFPEKVNAGREKVRYNDRRIGQ  122



>ref|WP_028947468.1| Photosystem I reaction center subunit II [Synechocystis sp. PCC 
6714]
 gb|AIE75111.1| photosystem I subunit II (PsaD) [Synechocystis sp. PCC 6714]
Length=141

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 91/116 (78%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA  EE Y ITWTS  EQ+FEMPTGGAAIM +G NLL LARKEQCLAL
Sbjct  9    PKFGGSTGGLLSKADREEKYAITWTSASEQVFEMPTGGAAIMNQGENLLYLARKEQCLAL  68

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    +Y+ YRV+P+GEVQYLHP DGV+PEKVN GRE  G   R IG 
Sbjct  69   GTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKSRRIGQ  124



>ref|WP_006509381.1| PsaD [Xenococcus sp. PCC 7305]
 gb|ELS03529.1| PsaD [Xenococcus sp. PCC 7305]
Length=142

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 92/116 (79%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL  A+VEE Y ITWTS KEQ+FEMPTGGAAIM  G NLL LARKEQCLAL
Sbjct  10   PKFGGSTGGLLTAAEVEEKYAITWTSSKEQVFEMPTGGAAIMNSGENLLYLARKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    +Y+ YRVFPNGE +YLHP DGV+PEKVN GR   G+  R IG+
Sbjct  70   GTQLRTKFKPRIQDYKVYRVFPNGETEYLHPADGVFPEKVNEGRPFAGKIDRKIGD  125



>ref|WP_006632802.1| photosystem I protein PsaD [Microcoleus vaginatus]
 gb|EGK88021.1| photosystem I protein PsaD [Microcoleus vaginatus FGP-2]
Length=141

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            PIFGGSTGGLL KA VEE Y ITWTSPKEQ+FEMPTGGAAIMR+G NLL L RKEQC+AL
Sbjct  10   PIFGGSTGGLLTKALVEEKYAITWTSPKEQVFEMPTGGAAIMRQGDNLLYLPRKEQCIAL  69

Query  417  -GTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
             G +LR+K+KI NY+ YRVFP+G  +YLHPKDGV+PEKVN GR   G+  R+IG+
Sbjct  70   GGQQLRAKFKITNYKIYRVFPDGNTEYLHPKDGVFPEKVNEGRPYNGKIERNIGS  124



>ref|WP_016924991.1| Photosystem I reaction center subunit II [Prochlorothrix hollandica]
Length=142

 Score =   165 bits (417),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 91/117 (78%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL+KA +EE Y ITWTS  EQ+FEMPTGGAA M  G NLL LARKEQCLA
Sbjct  9    TPAFGGSTGGLLKKADLEEKYAITWTSSTEQVFEMPTGGAATMNAGENLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LG +LR+K+K    +Y+ YRVFP G+V+YLHPKDGV+PEKVN GR  V     SIG+
Sbjct  69   LGRQLRTKFKPKMADYKIYRVFPTGDVEYLHPKDGVFPEKVNEGRSAVNSVAHSIGH  125



>ref|WP_012593753.1| MULTISPECIES: photosystem I protein PsaD [Cyanothece]
 gb|ACK64476.1| photosystem I protein PsaD [Cyanothece sp. PCC 8801]
 gb|ACU99346.1| photosystem I protein PsaD [Cyanothece sp. PCC 8802]
Length=142

 Score =   164 bits (416),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 93/117 (79%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            SP FGGSTGGLL KA  EE Y ITWTS  EQ+FEMPTGGAAIM +G NLL LARKEQCLA
Sbjct  9    SPKFGGSTGGLLSKADREEKYAITWTSTTEQVFEMPTGGAAIMNKGENLLYLARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LGT+LR+K+K    +Y+ YR++P+GE QYLHP DGV+PEKVN GRE  G+  R IG+
Sbjct  69   LGTQLRTKFKPKIQDYKIYRIYPSGETQYLHPADGVFPEKVNEGREFNGKKDRKIGD  125



>ref|WP_015157762.1| PsaD [Chamaesiphon minutus]
 gb|AFY91567.1| PsaD [Chamaesiphon minutus PCC 6605]
Length=138

 Score =   164 bits (415),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KA VEE Y ITW SPKEQ+FEMPTGGAA M  G NLL  ARKEQCLA
Sbjct  9    TPIFGGSTGGLLSKADVEEKYAITWNSPKEQVFEMPTGGAATMVSGDNLLNFARKEQCLA  68

Query  414  LGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LG +LR KYKIN Y+ YR+ P GE+  LHPKDGV+PEKVNAGRE  G+  R+IG
Sbjct  69   LGGQLR-KYKINNYKVYRILPKGEITLLHPKDGVFPEKVNAGREFNGKVDRNIG  121



>ref|WP_015222401.1| photosystem I protein PsaD [Cyanobacterium stanieri]
 gb|AFZ47083.1| photosystem I protein PsaD [Cyanobacterium stanieri PCC 7202]
Length=144

 Score =   164 bits (416),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 91/115 (79%), Gaps = 3/115 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL  A  EE Y ITWTS KEQ+FEMPTGGAAIM EG NL   ARKEQCLAL
Sbjct  12   PKFGGSTGGLLSAADREEKYAITWTSSKEQVFEMPTGGAAIMNEGENLYYFARKEQCLAL  71

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            GT+LR+K+K    +Y+ YRV+PNGEVQYLHP DGV+PEKVN GRE  G+  R+IG
Sbjct  72   GTQLRTKFKPKMEDYKIYRVYPNGEVQYLHPADGVFPEKVNEGREFHGKKDRNIG  126



>ref|YP_004072560.1| photosystem I reaction center subunit II [Thalassiosira oceanica 
CCMP1005]
 gb|ADB27514.1| photosystem I reaction center subunit II [Thalassiosira oceanica 
CCMP1005]
 gb|EJK52341.1| hypothetical protein THAOC_28388 [Thalassiosira oceanica]
 gb|EJK54217.1| hypothetical protein THAOC_26187 [Thalassiosira oceanica]
 gb|EJK55845.1| hypothetical protein THAOC_24369 [Thalassiosira oceanica]
Length=139

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = +3

Query  213  TLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLA  392
            T++  T  P FGGSTGG LR A+VEE Y ITWTS KEQIFEMPTGG+AIMR G NLL LA
Sbjct  2    TVNLKTSFPTFGGSTGGWLRAAEVEEKYAITWTSSKEQIFEMPTGGSAIMRNGENLLYLA  61

Query  393  RKEQCLALGTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSI  569
            RKEQCLAL T+L++ +K+N Y+ YR+FP+GEVQYLHPKDGV PEKVN GR        SI
Sbjct  62   RKEQCLALSTQLKT-FKVNDYKIYRIFPSGEVQYLHPKDGVAPEKVNPGRTAANSRSFSI  120

Query  570  G  572
            G
Sbjct  121  G  121



>ref|YP_002327575.1| PSI reaction center subunit II [Vaucheria litorea]
 gb|ACF70992.1| PSI reaction center subunit II [Vaucheria litorea]
Length=139

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 95/123 (77%), Gaps = 6/123 (5%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGG LR A+VEE Y ITWTS KEQ FEMPTGGAA+M    NLL LARKEQCLAL
Sbjct  10   PKFGGSTGGWLRAAEVEEKYAITWTSSKEQTFEMPTGGAAVMLNDQNLLYLARKEQCLAL  69

Query  417  GTRLRSKYKIN-YQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN----IS  581
            GT+L+ K+KIN Y+ YR+FPNGEVQ+LHPKDGV+PEKVN GR  VG    SIG     IS
Sbjct  70   GTQLK-KFKINDYKIYRIFPNGEVQFLHPKDGVFPEKVNVGRLAVGSRNFSIGKNPNPIS  128

Query  582  VRL  590
            V+ 
Sbjct  129  VKF  131



>ref|WP_016859046.1| Photosystem I reaction center subunit II [Fischerella muscicola]
Length=140

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 2/114 (2%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P FGGSTGGLL+KA+VEE Y ITWTSPKEQ+FEMPTGGAA+M +G NLL LARKEQ +A
Sbjct  9    TPKFGGSTGGLLKKAEVEEKYAITWTSPKEQVFEMPTGGAAVMSQGQNLLYLARKEQGIA  68

Query  414  LGTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LG +LR K+KI +Y+ YR++PNGE  Y+HP DGV+PEKVNAGRE V  N R IG
Sbjct  69   LGGQLR-KFKITDYKIYRIYPNGETVYIHPADGVFPEKVNAGREKVRYNDRRIG  121



>ref|WP_041622790.1| Photosystem I reaction center subunit II [Oscillatoria nigro-viridis]
Length=141

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P+FGGSTGGLL KA VEE Y ITWTSPKEQ+FEMP+GGAAIMR+G NLL L RKEQC+AL
Sbjct  10   PLFGGSTGGLLTKALVEEKYAITWTSPKEQVFEMPSGGAAIMRQGDNLLHLPRKEQCIAL  69

Query  417  -GTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
             G +LR+K+KI NY+ YRVFP+G  +YLHPKDGV+PEKVN GR   G+  R+IG+
Sbjct  70   GGQQLRAKFKITNYKIYRVFPDGSTEYLHPKDGVFPEKVNEGRPYNGKIDRNIGS  124



>gb|AFZ10051.1| photosystem I protein PsaD [Oscillatoria nigro-viridis PCC 7112]
Length=154

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P+FGGSTGGLL KA VEE Y ITWTSPKEQ+FEMP+GGAAIMR+G NLL L RKEQC+AL
Sbjct  23   PLFGGSTGGLLTKALVEEKYAITWTSPKEQVFEMPSGGAAIMRQGDNLLHLPRKEQCIAL  82

Query  417  -GTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
             G +LR+K+KI NY+ YRVFP+G  +YLHPKDGV+PEKVN GR   G+  R+IG+
Sbjct  83   GGQQLRAKFKITNYKIYRVFPDGSTEYLHPKDGVFPEKVNEGRPYNGKIDRNIGS  137



>ref|WP_011377824.1| MULTISPECIES: photosystem I reaction center subunit II [Synechococcus]
 gb|ABB57032.1| photosystem I reaction center subunit II [Synechococcus elongatus 
PCC 7942]
 gb|AJD58447.1| Photosystem I reaction center subunit II [Synechococcus sp. UTEX 
2973]
Length=142

 Score =   162 bits (411),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 93/117 (79%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P+FGGSTGGLL+ A+ EE Y ITWTS KEQ+FE+PTGGAA+M EG NLL  ARKEQ LA
Sbjct  9    TPVFGGSTGGLLKSAETEEKYAITWTSTKEQVFELPTGGAAVMHEGDNLLYFARKEQALA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LGT+LR+K+K    +Y+ YRVFP G+V+YLHPKDGV+PEKVN GR   G+  R IG 
Sbjct  69   LGTQLRTKFKPKIESYKIYRVFPGGDVEYLHPKDGVFPEKVNEGRSFAGKVDRRIGQ  125



>prf||1510177A photosystem II
Length=146

 Score =   162 bits (411),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 92/117 (79%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +P+FGG+TGGLL+ AQ EE Y ITWTS KEQ+FE+PTGGAA+M EG NLL  ARKEQ LA
Sbjct  9    TPVFGGTTGGLLKSAQTEEKYAITWTSTKEQVFELPTGGAAVMHEGPNLLYFARKEQALA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LGT +R+K+K    +Y+ YRVFP G+VQYLHPKDGV+PEKVN GR   G+  R IG 
Sbjct  69   LGTHVRTKFKPKIQSYKIYRVFPGGDVQYLHPKDGVFPEKVNEGRSFAGKVDRRIGQ  125



>ref|WP_009544162.1| MULTISPECIES: photosystem I protein PsaD [Cyanothece]
Length=142

 Score =   162 bits (410),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA+ EE Y ITWTS  EQ+FEMPTGGAAIM EG NLL L+RKEQCLAL
Sbjct  10   PKFGGSTGGLLSKAEREEKYAITWTSKTEQVFEMPTGGAAIMNEGENLLYLSRKEQCLAL  69

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    +Y+ YR++P+GE+QYLHP DGV+PEKVN GR+  G+  R IG+
Sbjct  70   GTQLRTKFKPKIQDYKIYRIYPSGEIQYLHPADGVFPEKVNEGRDYNGKIDRKIGD  125



>ref|WP_015124443.1| PsaD [Synechococcus sp. PCC 6312]
 gb|AFY60899.1| PsaD [Synechococcus sp. PCC 6312]
Length=140

 Score =   162 bits (410),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P++ GSTGGLL KA+VEE Y ITWTSPKEQ+FEMPT GAA+MREG NL+ LARKEQCLAL
Sbjct  10   PLYAGSTGGLLTKAEVEEKYAITWTSPKEQVFEMPTAGAAVMREGENLVYLARKEQCLAL  69

Query  417  GT-RLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
               +LR +   NYQ YR+FP+GE   LHPKDGV+PEKVNAGRE V    RSIG 
Sbjct  70   AAQQLRPRKINNYQIYRIFPDGESVLLHPKDGVFPEKVNAGREAVNSVPRSIGE  123



>ref|WP_041918842.1| Photosystem I reaction center subunit II, partial [Gloeocapsa 
sp. PCC 7428]
Length=142

 Score =   162 bits (409),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KA  EE YVITWTSPK+Q+FEMPTGG AIM++G N L+LARKE C+A
Sbjct  9    TPIFGGSTGGLLTKAFREEKYVITWTSPKQQVFEMPTGGTAIMQQGPNKLELARKEYCIA  68

Query  414  L-GTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            L G +LR+K++I +Y+ YRV+PNGEVQYLHP DGV+PEKVN GR+ VG   R+IG
Sbjct  69   LGGQQLRTKFRITDYKIYRVYPNGEVQYLHPSDGVFPEKVNEGRQKVGYVDRNIG  123



>ref|WP_017292752.1| Photosystem I reaction center subunit II [Geminocystis herdmanii]
Length=144

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 89/116 (77%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL  A  EE Y ITWTS  EQ+FEMPTGGAAIM EG NL   ARKEQCLAL
Sbjct  12   PKFGGSTGGLLSAADREEKYAITWTSKSEQVFEMPTGGAAIMNEGENLFYFARKEQCLAL  71

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    +Y+ YRV+P GE+QYLHP DGV+PEKVN GRE  G+  RSIG 
Sbjct  72   GTQLRTKFKPKIEDYKVYRVYPTGEIQYLHPADGVFPEKVNEGREFHGKKDRSIGK  127



>gb|AFZ29137.1| photosystem I protein PsaD [Gloeocapsa sp. PCC 7428]
Length=168

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL KA  EE YVITWTSPK+Q+FEMPTGG AIM++G N L+LARKE C+A
Sbjct  9    TPIFGGSTGGLLTKAFREEKYVITWTSPKQQVFEMPTGGTAIMQQGPNKLELARKEYCIA  68

Query  414  L-GTRLRSKYKI-NYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            L G +LR+K++I +Y+ YRV+PNGEVQYLHP DGV+PEKVN GR+ VG   R+IG
Sbjct  69   LGGQQLRTKFRITDYKIYRVYPNGEVQYLHPSDGVFPEKVNEGRQKVGYVDRNIG  123



>gb|ACB50691.1| photosystem I reaction center subunit II [Cyanothece sp. ATCC 
51142]
Length=158

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  237  PIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLAL  416
            P FGGSTGGLL KA+ EE Y ITWTS  EQ+FEMPTGGAAIM EG NLL L+RKEQCLAL
Sbjct  26   PKFGGSTGGLLSKAEREEKYAITWTSKTEQVFEMPTGGAAIMNEGENLLYLSRKEQCLAL  85

Query  417  GTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            GT+LR+K+K    +Y+ YR++P+GE+QYLHP DGV+PEKVN GR+  G+  R IG+
Sbjct  86   GTQLRTKFKPKIQDYKIYRIYPSGEIQYLHPADGVFPEKVNEGRDYNGKIDRKIGD  141



>ref|WP_015231048.1| PsaD [Dactylococcopsis salina]
 gb|AFZ52074.1| PsaD [Dactylococcopsis salina PCC 8305]
Length=142

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 95/117 (81%), Gaps = 3/117 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL  A+ EE Y ITWTS +EQ+FEMPTGGAAIMREG N+   ARKEQCLA
Sbjct  9    TPIFGGSTGGLLTAAETEEKYGITWTSSQEQVFEMPTGGAAIMREGENVFYFARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIGN  575
            LGT+LR+K+K    +++ YR++PNGE++YLHPKDGV+PE VN GR  +G+  R IG+
Sbjct  69   LGTQLRTKFKPKIEDFKIYRIYPNGELEYLHPKDGVFPENVNEGRPYMGKIDRKIGS  125



>ref|WP_015224168.1| photosystem I protein PsaD [Halothece sp. PCC 7418]
 gb|AFZ42290.1| photosystem I protein PsaD [Halothece sp. PCC 7418]
Length=142

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 94/116 (81%), Gaps = 3/116 (3%)
 Frame = +3

Query  234  SPIFGGSTGGLLRKAQVEEFYVITWTSPKEQIFEMPTGGAAIMREGANLLKLARKEQCLA  413
            +PIFGGSTGGLL  A+ EE Y ITWTS +EQ+FEMPTGGAAIMREG N+   ARKEQCLA
Sbjct  9    TPIFGGSTGGLLTAAETEEKYGITWTSSQEQVFEMPTGGAAIMREGENVFYFARKEQCLA  68

Query  414  LGTRLRSKYK---INYQFYRVFPNGEVQYLHPKDGVYPEKVNAGREGVGQNMRSIG  572
            LGT+LR+K+K    +++ YR++PNGE++YLHPKDGV+PE VN GR  +G+  R IG
Sbjct  69   LGTQLRTKFKPKIEDFKIYRIYPNGELEYLHPKDGVFPENVNEGRPYMGKIDRKIG  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160