BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN035J22

Length=363
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009627760.1|  PREDICTED: 60S ribosomal protein L37               179   3e-55   Nicotiana tomentosiformis
ref|XP_009785701.1|  PREDICTED: 60S ribosomal protein L37-like is...    178   7e-55   Nicotiana sylvestris
ref|XP_004245255.1|  PREDICTED: 60S ribosomal protein L37               177   2e-54   
ref|XP_006356643.1|  PREDICTED: 60S ribosomal protein L37-3-like        176   6e-54   Solanum tuberosum [potatoes]
ref|XP_006450619.1|  hypothetical protein CICLE_v10010027mg             173   6e-53   Citrus clementina [clementine]
gb|KHG25292.1|  60S ribosomal L37-1 -like protein                       174   7e-53   Gossypium arboreum [tree cotton]
gb|KDP34219.1|  hypothetical protein JCGZ_07790                         172   1e-52   Jatropha curcas
ref|XP_002516579.1|  60S ribosomal protein L37, putative                172   2e-52   Ricinus communis
ref|XP_007012041.1|  Zinc-binding ribosomal family protein isoform 2    172   2e-52   
ref|XP_011026574.1|  PREDICTED: 60S ribosomal protein L37-1-like        171   2e-52   Populus euphratica
ref|XP_004506845.1|  PREDICTED: 60S ribosomal protein L37-3-like ...    171   3e-52   Cicer arietinum [garbanzo]
ref|XP_002309570.1|  hypothetical protein POPTR_0006s25990g             171   4e-52   
ref|XP_004235660.1|  PREDICTED: 60S ribosomal protein L37-3             171   5e-52   Solanum lycopersicum
gb|KJB53450.1|  hypothetical protein B456_009G051900                    171   5e-52   Gossypium raimondii
gb|ACJ83830.1|  unknown                                                 170   9e-52   Medicago truncatula
ref|XP_004241731.1|  PREDICTED: 60S ribosomal protein L37-2             170   1e-51   Solanum lycopersicum
ref|XP_003531677.1|  PREDICTED: 60S ribosomal protein L37-3             170   1e-51   Glycine max [soybeans]
ref|XP_006833288.1|  hypothetical protein AMTR_s00109p00029660          170   1e-51   Amborella trichopoda
ref|XP_004304510.1|  PREDICTED: 60S ribosomal protein L37-3             169   1e-51   Fragaria vesca subsp. vesca
ref|XP_003597753.1|  Ribosomal protein L37                              170   1e-51   
ref|XP_004506844.1|  PREDICTED: 60S ribosomal protein L37-3-like ...    169   2e-51   
ref|XP_004486739.1|  PREDICTED: 60S ribosomal protein L37-3-like        169   2e-51   
ref|XP_002516050.1|  60S ribosomal protein L37, putative                169   2e-51   Ricinus communis
ref|NP_001173207.1|  Os02g0815001                                       169   2e-51   
gb|EYU21452.1|  hypothetical protein MIMGU_mgv1a017055mg                169   3e-51   Erythranthe guttata [common monkey flower]
ref|XP_010920294.1|  PREDICTED: 60S ribosomal protein L37-1-like        169   3e-51   Elaeis guineensis
ref|XP_002324820.2|  hypothetical protein POPTR_0018s00830g             169   3e-51   Populus trichocarpa [western balsam poplar]
ref|XP_003604481.1|  Ribosomal protein L37                              169   3e-51   
gb|EYU24699.1|  hypothetical protein MIMGU_mgv1a017069mg                168   3e-51   Erythranthe guttata [common monkey flower]
ref|XP_009397905.1|  PREDICTED: 60S ribosomal protein L37-3-like        168   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792349.1|  PREDICTED: 60S ribosomal protein L37-1             168   4e-51   Phoenix dactylifera
ref|XP_010916787.1|  PREDICTED: 60S ribosomal protein L37-1-like        168   4e-51   Elaeis guineensis
ref|XP_007012040.1|  Zinc-binding ribosomal protein family protei...    168   5e-51   Theobroma cacao [chocolate]
ref|XP_007215188.1|  hypothetical protein PRUPE_ppa013930mg             168   5e-51   Prunus persica
ref|XP_009611259.1|  PREDICTED: 60S ribosomal protein L37-3             167   6e-51   Nicotiana tomentosiformis
gb|KJB56585.1|  hypothetical protein B456_009G134200                    169   7e-51   Gossypium raimondii
emb|CBI20899.3|  unnamed protein product                                169   1e-50   Vitis vinifera
ref|XP_004954348.1|  PREDICTED: 60S ribosomal protein L37-1-like        167   1e-50   Setaria italica
gb|ACV50438.1|  ribosomal protein L37                                   167   1e-50   Jatropha curcas
emb|CDO98037.1|  unnamed protein product                                168   1e-50   Coffea canephora [robusta coffee]
ref|XP_009367923.1|  PREDICTED: 60S ribosomal protein L37-3-like        167   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_010496951.1|  PREDICTED: 60S ribosomal protein L37-1-like        167   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009611768.1|  PREDICTED: 60S ribosomal protein L37-3             167   1e-50   Nicotiana tomentosiformis
ref|XP_010476607.1|  PREDICTED: 60S ribosomal protein L37-1-like        167   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010667797.1|  PREDICTED: 60S ribosomal protein L37-3             166   2e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010667790.1|  PREDICTED: 60S ribosomal protein L37-3-like        166   2e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG10587.1|  60S ribosomal L37-3 -like protein                       166   2e-50   Gossypium arboreum [tree cotton]
ref|XP_007223787.1|  hypothetical protein PRUPE_ppa013927mg             166   2e-50   Prunus persica
ref|XP_006649162.1|  PREDICTED: 60S ribosomal protein L37-3-like        166   3e-50   Oryza brachyantha
ref|XP_003543640.1|  PREDICTED: 60S ribosomal protein L37-3             166   3e-50   Glycine max [soybeans]
ref|XP_006298872.1|  hypothetical protein CARUB_v10014992mg             166   3e-50   Capsella rubella
ref|XP_007163943.1|  hypothetical protein PHAVU_L003800g                166   3e-50   Phaseolus vulgaris [French bean]
ref|NP_001045655.1|  Os02g0111700                                       166   3e-50   
ref|NP_001237255.1|  ribosomal protein L37                              166   3e-50   Glycine max [soybeans]
emb|CDX97720.1|  BnaA05g23590D                                          166   4e-50   
emb|CDY30133.1|  BnaC05g37290D                                          166   4e-50   Brassica napus [oilseed rape]
gb|AFK48222.1|  unknown                                                 166   4e-50   Lotus japonicus
ref|XP_008362389.1|  PREDICTED: 60S ribosomal protein L37-3             166   4e-50   Malus domestica [apple tree]
ref|XP_008378115.1|  PREDICTED: 60S ribosomal protein L37-3             166   5e-50   
gb|KHG01859.1|  60S ribosomal L37-3 -like protein                       166   5e-50   Gossypium arboreum [tree cotton]
ref|XP_003570380.1|  PREDICTED: 60S ribosomal protein L37-3-like        166   5e-50   Brachypodium distachyon [annual false brome]
ref|XP_009353625.1|  PREDICTED: 60S ribosomal protein L37-3-like        165   6e-50   Pyrus x bretschneideri [bai li]
ref|XP_008393895.1|  PREDICTED: 60S ribosomal protein L37-1             165   6e-50   
ref|XP_007163458.1|  hypothetical protein PHAVU_001G235900g             165   6e-50   Phaseolus vulgaris [French bean]
ref|XP_004952168.1|  PREDICTED: 60S ribosomal protein L37-1-like        165   6e-50   Setaria italica
gb|AFK47939.1|  unknown                                                 165   6e-50   Lotus japonicus
ref|XP_008785156.1|  PREDICTED: 60S ribosomal protein L37-3-like        165   7e-50   Phoenix dactylifera
ref|XP_009388714.1|  PREDICTED: 60S ribosomal protein L37-1-like        165   7e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002299709.1|  ribosomal protein L37                              165   7e-50   Populus trichocarpa [western balsam poplar]
ref|XP_006303766.1|  hypothetical protein CARUB_v10011974mg             165   7e-50   Capsella rubella
ref|XP_002892856.1|  60S ribosomal protein L37                          165   9e-50   
gb|ABK20886.1|  unknown                                                 165   9e-50   Picea sitchensis
ref|XP_004141772.1|  PREDICTED: 60S ribosomal protein L37-2-like ...    165   9e-50   Cucumis sativus [cucumbers]
ref|NP_001235982.1|  uncharacterized protein LOC100306503               165   9e-50   
ref|XP_006426971.1|  hypothetical protein CICLE_v10026841mg             165   1e-49   Citrus clementina [clementine]
ref|NP_172977.1|  60S ribosomal protein L37-1                           165   1e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CBI36137.3|  unnamed protein product                                165   1e-49   Vitis vinifera
ref|XP_006305787.1|  hypothetical protein CARUB_v10010668mg             166   1e-49   
ref|NP_001060912.2|  Os08g0128500                                       164   1e-49   
ref|XP_007163942.1|  hypothetical protein PHAVU_L003700g                164   1e-49   Phaseolus vulgaris [French bean]
gb|EPS63391.1|  hypothetical protein M569_11398                         164   1e-49   Genlisea aurea
ref|XP_009146170.1|  PREDICTED: 60S ribosomal protein L37-2-like        164   1e-49   Brassica rapa
ref|XP_002284249.1|  PREDICTED: 60S ribosomal protein L37-3-like        164   1e-49   Vitis vinifera
ref|XP_002882976.1|  60S ribosomal protein L37                          164   2e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_009403524.1|  PREDICTED: 60S ribosomal protein L37-1             164   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008810031.1|  PREDICTED: 60S ribosomal protein L37-1-like        164   2e-49   Phoenix dactylifera
ref|XP_010459048.1|  PREDICTED: 60S ribosomal protein L37-1             164   2e-49   Camelina sativa [gold-of-pleasure]
gb|EEC82850.1|  hypothetical protein OsI_27679                          164   2e-49   Oryza sativa Indica Group [Indian rice]
gb|EPS70838.1|  hypothetical protein M569_03921                         164   3e-49   Genlisea aurea
ref|XP_010249733.1|  PREDICTED: 60S ribosomal protein L37-1             163   3e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002304203.1|  ribosomal protein L37                              163   4e-49   Populus trichocarpa [western balsam poplar]
ref|XP_009409055.1|  PREDICTED: 60S ribosomal protein L37-3-like        163   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB56584.1|  hypothetical protein B456_009G134200                    163   4e-49   Gossypium raimondii
ref|XP_006406883.1|  hypothetical protein EUTSA_v10021833mg             163   4e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010538027.1|  PREDICTED: 60S ribosomal protein L37-1             163   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_010521525.1|  PREDICTED: 60S ribosomal protein L37-1-like        163   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_010500828.1|  PREDICTED: 60S ribosomal protein L37-3-like        163   5e-49   Camelina sativa [gold-of-pleasure]
ref|NP_566535.1|  60S ribosomal protein L37-3                           163   5e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284575.1|  PREDICTED: 60S ribosomal protein L37-3-like        163   6e-49   Vitis vinifera
ref|XP_010098066.1|  60S ribosomal protein L37-3                        164   6e-49   
gb|KHG18360.1|  60S ribosomal L37-1 -like protein                       162   7e-49   Gossypium arboreum [tree cotton]
emb|CDY52979.1|  BnaA06g01640D                                          164   7e-49   Brassica napus [oilseed rape]
ref|XP_010545706.1|  PREDICTED: 60S ribosomal protein L37-3             162   7e-49   Tarenaya hassleriana [spider flower]
gb|KJB56586.1|  hypothetical protein B456_009G134200                    163   9e-49   Gossypium raimondii
ref|XP_008680029.1|  PREDICTED: 60S ribosomal protein L37-3             162   9e-49   
ref|XP_010254121.1|  PREDICTED: 60S ribosomal protein L37-1-like        162   9e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006392937.1|  hypothetical protein EUTSA_v10011894mg             162   1e-48   Eutrema salsugineum [saltwater cress]
ref|XP_010535163.1|  PREDICTED: 60S ribosomal protein L37-3             162   1e-48   Tarenaya hassleriana [spider flower]
emb|CDY70285.1|  BnaCnng67600D                                          163   1e-48   Brassica napus [oilseed rape]
dbj|BAJ94625.1|  predicted protein                                      163   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004150353.1|  PREDICTED: 60S ribosomal protein L37-3-like        162   1e-48   Cucumis sativus [cucumbers]
ref|NP_175640.1|  60S ribosomal protein L37-2                           162   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539494.1|  PREDICTED: 60S ribosomal protein L37-3-like        161   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_007140019.1|  hypothetical protein PHAVU_008G077400g             161   2e-48   Phaseolus vulgaris [French bean]
gb|KJB13168.1|  hypothetical protein B456_002G060000                    161   2e-48   Gossypium raimondii
gb|KFK38960.1|  hypothetical protein AALP_AA3G182300                    161   2e-48   Arabis alpina [alpine rockcress]
gb|KFK35793.1|  hypothetical protein AALP_AA4G037100                    161   2e-48   Arabis alpina [alpine rockcress]
ref|XP_009400928.1|  PREDICTED: 60S ribosomal protein L37-1-like        161   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009144855.1|  PREDICTED: 60S ribosomal protein L37-2             161   3e-48   Brassica rapa
gb|KHG29419.1|  60S ribosomal L37-3 -like protein                       162   3e-48   Gossypium arboreum [tree cotton]
emb|CDX75869.1|  BnaC03g39520D                                          163   4e-48   
emb|CDY02545.1|  BnaA08g01520D                                          160   4e-48   
ref|XP_007024165.1|  Zinc-binding ribosomal protein family protein      160   4e-48   
ref|XP_010542243.1|  PREDICTED: 60S ribosomal protein L37-3-like        160   5e-48   Tarenaya hassleriana [spider flower]
emb|CDY45631.1|  BnaA05g14980D                                          161   6e-48   Brassica napus [oilseed rape]
ref|XP_008801255.1|  PREDICTED: 60S ribosomal protein L37-1-like        160   7e-48   Phoenix dactylifera
emb|CDX87897.1|  BnaC06g09590D                                          164   8e-48   
ref|XP_009135475.1|  PREDICTED: 60S ribosomal protein L37-2-like        160   8e-48   Brassica rapa
ref|XP_004291214.1|  PREDICTED: 60S ribosomal protein L37-3-like        159   1e-47   Fragaria vesca subsp. vesca
gb|ACG38067.1|  60S ribosomal protein L37                               159   1e-47   Zea mays [maize]
ref|XP_009107138.1|  PREDICTED: 60S ribosomal protein L37-2-like        159   2e-47   Brassica rapa
emb|CDY70030.1|  BnaCnng66410D                                          159   2e-47   Brassica napus [oilseed rape]
ref|XP_010934237.1|  PREDICTED: 60S ribosomal protein L37-1             159   3e-47   Elaeis guineensis
ref|XP_011089195.1|  PREDICTED: 60S ribosomal protein L37-1-like        158   6e-47   Sesamum indicum [beniseed]
ref|XP_010033871.1|  PREDICTED: 60S ribosomal protein L37-3             157   6e-47   Eucalyptus grandis [rose gum]
emb|CDP16151.1|  unnamed protein product                                158   8e-47   Coffea canephora [robusta coffee]
ref|XP_001756851.1|  predicted protein                                  157   8e-47   
emb|CDX82413.1|  BnaA03g34080D                                          161   9e-47   
ref|XP_001766230.1|  predicted protein                                  157   1e-46   
gb|KJB39125.1|  hypothetical protein B456_007G172900                    157   2e-46   Gossypium raimondii
ref|XP_009115011.1|  PREDICTED: 60S ribosomal protein L37-2-like        156   3e-46   Brassica rapa
ref|XP_003572148.1|  PREDICTED: 60S ribosomal protein L37-2-like        155   4e-46   Brachypodium distachyon [annual false brome]
ref|XP_001772611.1|  predicted protein                                  154   8e-46   
ref|XP_011001601.1|  PREDICTED: 60S ribosomal protein L37-3-like        154   2e-45   Populus euphratica
ref|XP_001785497.1|  predicted protein                                  154   2e-45   
ref|XP_009785166.1|  PREDICTED: 60S ribosomal protein L37-3-like        153   3e-45   Nicotiana sylvestris
ref|XP_010910777.1|  PREDICTED: 60S ribosomal protein L37-3             152   6e-45   Elaeis guineensis
gb|KJB56587.1|  hypothetical protein B456_009G134200                    154   1e-44   Gossypium raimondii
ref|XP_011072354.1|  PREDICTED: 60S ribosomal protein L37-3             152   1e-44   Sesamum indicum [beniseed]
ref|XP_011080793.1|  PREDICTED: 60S ribosomal protein L37-3             151   2e-44   Sesamum indicum [beniseed]
gb|ACG30774.1|  60S ribosomal protein L37                               151   2e-44   Zea mays [maize]
ref|NP_001278489.1|  60S ribosomal protein L37                          151   2e-44   Zea mays [maize]
ref|XP_002465171.1|  hypothetical protein SORBIDRAFT_01g033340          150   3e-44   Sorghum bicolor [broomcorn]
gb|EPS74476.1|  hypothetical protein M569_00287                         150   7e-44   Genlisea aurea
dbj|BAJ92534.1|  predicted protein                                      148   4e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009397445.1|  PREDICTED: 60S ribosomal protein L37-1-like        147   5e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007202799.1|  hypothetical protein PRUPE_ppa013845mg             147   6e-43   Prunus persica
tpg|DAA45686.1|  TPA: hypothetical protein ZEAMMB73_173562              149   7e-43   
ref|XP_008645154.1|  PREDICTED: 60S ribosomal protein L37-3-like        147   1e-42   
ref|XP_001777517.1|  predicted protein                                  145   3e-42   
gb|KCW69608.1|  hypothetical protein EUGRSUZ_F03027                     146   5e-42   Eucalyptus grandis [rose gum]
ref|XP_008242650.1|  PREDICTED: 60S ribosomal protein L37-3-like        146   5e-42   Prunus mume [ume]
ref|XP_005648609.1|  ribosomal protein L37 component of cytosolic...    145   6e-42   Coccomyxa subellipsoidea C-169
ref|XP_009381841.1|  PREDICTED: 60S ribosomal protein L37-3-like        145   8e-42   
ref|XP_010062467.1|  PREDICTED: 60S ribosomal protein L37-3             144   2e-41   Eucalyptus grandis [rose gum]
gb|EMT05334.1|  60S ribosomal protein L37-2                             144   4e-41   
ref|XP_002964514.1|  hypothetical protein SELMODRAFT_81515              141   1e-40   
gb|ACG34589.1|  60S ribosomal protein L37                               139   1e-39   Zea mays [maize]
ref|XP_010047730.1|  PREDICTED: 60S ribosomal protein L37-2-like        139   2e-39   Eucalyptus grandis [rose gum]
gb|KJB09390.1|  hypothetical protein B456_001G1385002                   137   5e-39   Gossypium raimondii
ref|XP_003080511.1|  ribosomal protein L37 (ISS)                        137   9e-39   Ostreococcus tauri
ref|XP_001418774.1|  Ribosomal protein L37, component of cytosoli...    135   3e-38   Ostreococcus lucimarinus CCE9901
ref|XP_002499547.1|  ribosomal protein L37e                             135   6e-38   Micromonas commoda
gb|KFM65885.1|  putative 60S ribosomal protein L37-A                    132   4e-37   Stegodyphus mimosarum
gb|ABX75388.1|  60S ribosomal protein L37A                              132   5e-37   Lycosa singoriensis
ref|XP_007513881.1|  60S ribosomal protein L37                          132   6e-37   Bathycoccus prasinos
ref|XP_002067427.1|  GK16414                                            132   7e-37   
ref|XP_008344788.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    131   2e-36   
ref|XP_009374074.1|  PREDICTED: 60S ribosomal protein L37-3-like        130   2e-36   
ref|XP_009828152.1|  60S ribosomal protein L37                          130   3e-36   Aphanomyces astaci
ref|XP_005177543.1|  PREDICTED: probable 60S ribosomal protein L37-A    130   4e-36   Musca domestica
gb|ABW23234.1|  ribosomal protein rpl37                                 130   5e-36   Eurythoe complanata
ref|XP_001978118.1|  GG19417                                            130   5e-36   Drosophila erecta
ref|XP_001963823.1|  GF21054                                            130   5e-36   
ref|NP_573005.1|  ribosomal protein L37a, isoform A                     129   6e-36   Drosophila melanogaster
gb|ACO12718.1|  Probable 60S ribosomal protein L37-A                    129   8e-36   Lepeophtheirus salmonis
gb|ADD24054.1|  Probable 60S ribosomal protein L37-A                    129   8e-36   Lepeophtheirus salmonis
gb|AAR09756.1|  similar to Drosophila melanogaster CG9091               129   9e-36   Drosophila yakuba
ref|XP_008614900.1|  60S ribosomal protein L37-A                        129   1e-35   Saprolegnia diclina VS20
ref|XP_002606048.1|  hypothetical protein BRAFLDRAFT_269803             128   2e-35   Branchiostoma floridae
emb|CAJ17427.1|  ribosomal protein L37e                                 128   2e-35   Biphyllus lunatus
gb|AGN29663.1|  60S ribosomal protein L37                               128   3e-35   Acartia pacifica
ref|XP_011191715.1|  PREDICTED: probable 60S ribosomal protein L37-A    127   4e-35   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011198860.1|  PREDICTED: probable 60S ribosomal protein L37-A    127   4e-35   Bactrocera dorsalis [papaya fruit fly]
ref|XP_004524980.1|  PREDICTED: probable 60S ribosomal protein L3...    127   4e-35   Ceratitis capitata [medfly]
ref|XP_001992243.1|  GH24309                                            127   5e-35   Drosophila grimshawi
ref|XP_796231.2|  PREDICTED: probable 60S ribosomal protein L37-A...    127   6e-35   Strongylocentrotus purpuratus [purple urchin]
ref|XP_004524979.1|  PREDICTED: probable 60S ribosomal protein L3...    128   7e-35   
gb|ABM55635.1|  ribosomal protein L37-like protein                      126   8e-35   Maconellicoccus hirsutus [pink hibiscus mealybug]
gb|AEE63535.1|  unknown                                                 126   8e-35   Dendroctonus ponderosae
ref|XP_002058058.1|  GJ15698                                            127   8e-35   
ref|NP_001037247.1|  ribosomal protein L37                              126   9e-35   Bombyx mori [silk moth]
ref|XP_011493218.1|  AAEL017198-PA                                      126   1e-34   Aedes aegypti
ref|XP_011163999.1|  PREDICTED: 60S ribosomal protein L37               126   2e-34   Solenopsis invicta [imported red fire ant]
gb|ACY71284.1|  ribosomal protein L37                                   125   2e-34   Chrysomela tremula
ref|XP_001630296.1|  predicted protein                                  126   2e-34   Nematostella vectensis
ref|XP_009533584.1|  hypothetical protein PHYSODRAFT_355302             125   2e-34   Phytophthora sojae
ref|NP_001129424.1|  ribosomal protein L37                              125   2e-34   Acyrthosiphon pisum
ref|XP_005851841.1|  hypothetical protein CHLNCDRAFT_133342             128   2e-34   Chlorella variabilis
ref|XP_969650.2|  PREDICTED: 60S ribosomal protein L37                  125   2e-34   Tribolium castaneum [rust-red flour beetle]
ref|XP_011055673.1|  PREDICTED: 60S ribosomal protein L37               125   3e-34   Acromyrmex echinatior
gb|ACL37990.1|  cytosolic large ribosomal subunit L37                   125   3e-34   Ochlerotatus taeniorhynchus
ref|XP_003058272.1|  predicted protein                                  125   3e-34   Micromonas pusilla CCMP1545
emb|CBV76072.1|  60S ribosomal protein L37                              125   3e-34   Polytomella sp. Pringsheim 198.80
gb|ETN60779.1|  60S ribosomal protein L37                               125   3e-34   Anopheles darlingi [American malaria mosquito]
ref|XP_001851080.1|  60S ribosomal protein L37                          125   3e-34   Culex quinquefasciatus
ref|XP_002010714.1|  GI21554                                            125   4e-34   
gb|ADP21472.1|  ribosomal protein L37                                   125   4e-34   Antheraea yamamai [Japanese oak silk moth]
ref|XP_009996478.1|  PREDICTED: 60S ribosomal protein L37               125   4e-34   Chaetura pelagica
sp|Q962S7.3|RL37_SPOFR  RecName: Full=60S ribosomal protein L37         125   4e-34   Spodoptera frugiperda
ref|XP_002902894.1|  ribosomal protein L37e, putative                   125   4e-34   Phytophthora infestans T30-4
dbj|BAD26666.1|  Ribosomal protein L37                                  125   4e-34   Plutella xylostella [cabbage moth]
ref|XP_008867284.1|  60S ribosomal protein L37                          126   4e-34   Aphanomyces invadans
gb|EHJ72003.1|  60S ribosomal protein L37                               124   5e-34   
gb|AGN29583.1|  ribosomal protein L37                                   124   5e-34   Acartia pacifica
gb|ADT80678.1|  ribosomal protein L37                                   124   5e-34   Euphydryas aurinia [marsh fritillary]
gb|ABM55421.1|  ribosomal protein L37                                   124   6e-34   Xenopsylla cheopis
gb|AAX62386.1|  ribosomal protein L37                                   124   7e-34   Lysiphlebus testaceipes
ref|XP_005703880.1|  60S ribosomal protein L37e                         124   7e-34   Galdieria sulphuraria
ref|XP_008557106.1|  PREDICTED: 60S ribosomal protein L37               124   9e-34   Microplitis demolitor
ref|XP_002954149.1|  component of cytosolic 80S ribosome and 60S ...    124   9e-34   Volvox carteri f. nagariensis
dbj|BAN20136.1|  ribosomal protein L37a                                 124   9e-34   Riptortus pedestris
gb|ACO10534.1|  Probable 60S ribosomal protein L37-A                    124   1e-33   Caligus rogercresseyi
gb|EGI64662.1|  60S ribosomal protein L37                               124   1e-33   Acromyrmex echinatior
ref|XP_011264945.1|  PREDICTED: 60S ribosomal protein L37               124   1e-33   Camponotus floridanus
gb|ERG78989.1|  putative 60s ribosomal protein l37-a                    124   2e-33   
gb|EJW79669.1|  ribosomal protein L37                                   123   2e-33   Wuchereria bancrofti [agent of lymphatic filariasis]
emb|CAJ17428.1|  ribosomal protein L37e                                 123   2e-33   Sphaerius sp. APV-2005
gb|EFA10173.1|  hypothetical protein TcasGA2_TC012363                   124   2e-33   
gb|KFU90030.1|  60S ribosomal protein L37                               123   2e-33   Chaetura pelagica
gb|AAX48871.1|  L37                                                     123   2e-33   Suberites domuncula
ref|XP_001702514.1|  ribosomal protein L37, component of cytosoli...    123   2e-33   Chlamydomonas reinhardtii
ref|XP_004276717.1|  PREDICTED: 60S ribosomal protein L37-like          123   2e-33   
gb|KHJ30462.1|  putative 60s ribosomal protein l37                      123   2e-33   Erysiphe necator
ref|NP_001279695.1|  ribosomal protein L37                              123   2e-33   Callorhinchus milii [Australian ghost shark]
emb|CAJ17429.1|  ribosomal protein L37e                                 122   3e-33   Timarcha balearica
ref|XP_001894606.1|  60S ribosomal protein L37-A                        122   3e-33   Brugia malayi [agent of lymphatic filariasis]
ref|XP_002423268.1|  60S ribosomal protein L37, putative                122   3e-33   Pediculus humanus corporis [human body lice]
gb|EIE90927.1|  60S ribosomal protein L37                               129   4e-33   Rhizopus delemar RA 99-880
gb|EFN73831.1|  60S ribosomal protein L37                               122   4e-33   Camponotus floridanus
emb|CCX32530.1|  Similar to 60S ribosomal protein L37; acc. no. Q...    122   4e-33   Pyronema omphalodes CBS 100304
ref|XP_309142.3|  AGAP000952-PA                                         122   5e-33   Anopheles gambiae str. PEST
ref|XP_007437283.1|  PREDICTED: 60S ribosomal protein L37               122   5e-33   Python bivittatus
ref|XP_002366573.1|  60s ribosomal protein l37, putative                122   6e-33   Toxoplasma gondii ME49
ref|XP_003137771.1|  60S ribosomal protein L37-A                        122   6e-33   Loa loa
ref|XP_007261310.1|  hypothetical protein FOMMEDRAFT_16058              122   7e-33   Fomitiporia mediterranea MF3/22
ref|XP_001585941.1|  60S ribosomal protein L37                          121   8e-33   Sclerotinia sclerotiorum 1980 UF-70
ref|NP_986236.1|  60S ribosomal protein L37                             121   1e-32   Eremothecium gossypii ATCC 10895
ref|XP_008840320.1|  PREDICTED: 60S ribosomal protein L37               121   1e-32   Nannospalax galili
ref|XP_002383966.1|  60S ribosomal protein L37                          121   1e-32   Aspergillus flavus NRRL3357
ref|XP_011122299.1|  hypothetical protein AOL_s00079g122                121   1e-32   Arthrobotrys oligospora ATCC 24927
ref|XP_005713171.1|  60S ribosomal protein L37                          121   1e-32   Chondrus crispus [carageen]
ref|XP_004312886.1|  PREDICTED: 60S ribosomal protein L37-like          121   1e-32   
gb|ABR27899.1|  60S ribosomal protein L37                               120   1e-32   Triatoma infestans
ref|NP_001085977.1|  ribosomal protein L37                              121   1e-32   Xenopus laevis [clawed frog]
ref|XP_011495861.1|  PREDICTED: 60S ribosomal protein L37               120   2e-32   Ceratosolen solmsi marchali
gb|KEZ42811.1|  hypothetical protein SAPIO_CDS5228                      120   2e-32   Scedosporium apiospermum
gb|AAY66940.1|  60S ribosomal protein L37                               120   2e-32   Ixodes scapularis [blacklegged tick]
gb|AAT92160.1|  60S ribosomal protein L37                               120   2e-32   Ixodes pacificus [California black legged tick]
emb|CDX90534.1|  BnaA03g42470D                                          120   2e-32   
gb|AGH70181.1|  60S ribosomal protein L37                               120   2e-32   Placozoa sp. H4
emb|CCI45708.1|  unnamed protein product                                120   3e-32   Albugo candida
ref|NP_001107325.1|  ribosomal protein L37                              120   3e-32   Xenopus tropicalis [western clawed frog]
gb|KDR20172.1|  60S ribosomal protein L37                               120   3e-32   Zootermopsis nevadensis
ref|XP_003644142.1|  hypothetical protein Ecym_1067                     120   4e-32   Eremothecium cymbalariae DBVPG#7215
ref|XP_011338214.1|  PREDICTED: 60S ribosomal protein L37               120   4e-32   Ooceraea biroi
gb|KHN79345.1|  putative 60S ribosomal protein L37-A                    120   4e-32   Toxocara canis
ref|XP_003881840.1|  hypothetical protein NCLIV_015990                  120   4e-32   Neospora caninum Liverpool
ref|XP_002731353.1|  PREDICTED: 60S ribosomal protein L37-like          120   4e-32   Saccoglossus kowalevskii
gb|KFD59035.1|  hypothetical protein M513_00198                         119   4e-32   
emb|CAF95579.1|  unnamed protein product                                119   5e-32   
ref|XP_009888077.1|  PREDICTED: 60S ribosomal protein L37               119   5e-32   
ref|XP_624871.1|  PREDICTED: 60S ribosomal protein L37                  119   6e-32   
ref|XP_001547251.1|  60S ribosomal protein L37                          119   6e-32   
dbj|GAN05964.1|  60S ribosomal protein Rpl37ap                          119   6e-32   
ref|XP_005282200.1|  PREDICTED: 60S ribosomal protein L37               119   7e-32   
gb|KDD74070.1|  hypothetical protein H632_c1600p0                       119   7e-32   
tpe|CAL69086.1|  TPA: putative 60S ribosomal protein L37 isoform 1      119   7e-32   
ref|XP_002152457.1|  60S ribosomal protein L37                          119   8e-32   
gb|ACN09993.1|  60S ribosomal protein L37                               119   8e-32   
ref|XP_011137727.1|  PREDICTED: 60S ribosomal protein L37               119   8e-32   
ref|XP_002801758.1|  PREDICTED: 60S ribosomal protein L37-like          119   8e-32   
ref|XP_003216249.1|  PREDICTED: 60S ribosomal protein L37               119   1e-31   
ref|XP_001646973.1|  hypothetical protein Kpol_2000p83                  119   1e-31   
ref|XP_003489329.1|  PREDICTED: 60S ribosomal protein L37-like          119   1e-31   
ref|XP_001371660.2|  PREDICTED: 60S ribosomal protein L37               119   1e-31   
ref|XP_005508098.1|  PREDICTED: 60S ribosomal protein L37               119   1e-31   
gb|AAO25606.1|  ribosomal protein L37A                                  118   1e-31   
ref|NP_001070167.1|  60S ribosomal protein L37                          119   1e-31   
emb|CEP20147.1|  hypothetical protein                                   119   1e-31   
emb|CDS07710.1|  Putative 60S ribosomal protein L37                     118   1e-31   
ref|XP_002841698.1|  60S ribosomal protein L37                          118   1e-31   
gb|KFY79948.1|  hypothetical protein V499_01145                         119   1e-31   
ref|XP_011115174.1|  hypothetical protein H072_9616                     118   1e-31   
gb|ABX44841.1|  putative 60S ribosomal protein RPL37                    118   1e-31   
ref|XP_010189150.1|  PREDICTED: 60S ribosomal protein L37-like          118   1e-31   
gb|ESA20967.1|  hypothetical protein GLOINDRAFT_343364                  118   1e-31   
ref|XP_011428348.1|  PREDICTED: probable 60S ribosomal protein L37-A    119   1e-31   
ref|XP_003680740.1|  60S ribosomal protein L37                          118   1e-31   
ref|XP_006080949.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    119   2e-31   
ref|XP_003403132.1|  PREDICTED: 60S ribosomal protein L37-like          118   2e-31   
gb|ABR23454.1|  60S ribosomal protein L37                               118   2e-31   
ref|XP_001263775.1|  60S ribosomal protein L37                          118   2e-31   
emb|CEP64329.1|  LALA0S11e01640g1_1                                     118   2e-31   
gb|ETO60162.1|  60S ribosomal protein L37                               117   2e-31   
ref|XP_007872774.1|  hypothetical protein PNEG_00864                    118   2e-31   
ref|XP_009220308.1|  60S ribosomal protein L37                          118   2e-31   
ref|NP_001002069.1|  60S ribosomal protein L37                          118   2e-31   
emb|CBK20514.2|  Ribosomal protein L37e                                 118   2e-31   
gb|KFQ71203.1|  60S ribosomal protein L37                               118   2e-31   
tpg|DAA26388.1|  TPA: ribosomal protein L37-like                        118   2e-31   
ref|XP_005709486.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    118   2e-31   
gb|EPB82499.1|  60S ribosomal protein L37-A                             118   2e-31   
ref|NP_000988.1|  60S ribosomal protein L37                             118   2e-31   
emb|CDJ67677.1|  60S ribosomal protein L37, putative                    118   2e-31   
gb|AAD14319.1|S79980_1  ribosomal protein L37                           118   2e-31   
gb|AFA34383.1|  ribosomal protein L37                                   118   2e-31   
ref|XP_001601062.1|  PREDICTED: 60S ribosomal protein L37               117   2e-31   
ref|XP_004921473.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    118   2e-31   
gb|KGL97077.1|  60S ribosomal protein L37                               118   2e-31   
ref|XP_005241246.1|  PREDICTED: 60S ribosomal protein L37               119   2e-31   
gb|ETN68715.1|  ribosomal protein L37e                                  117   3e-31   
ref|XP_010280291.1|  PREDICTED: 60S ribosomal protein L37-like          118   3e-31   
ref|XP_005596043.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    118   3e-31   
ref|XP_001246626.1|  60S ribosomal protein L37                          117   3e-31   
emb|CCQ18623.1|  60S ribosomal protein L37                              118   3e-31   
gb|EFN89755.1|  60S ribosomal protein L37                               117   3e-31   
gb|EPB87756.1|  60S ribosomal protein L37-A                             117   3e-31   
gb|EMP30263.1|  60S ribosomal protein L37                               117   3e-31   
ref|XP_008280995.1|  PREDICTED: 60S ribosomal protein L37               117   3e-31   
dbj|BAF98689.1|  ribosomal protein L37                                  117   3e-31   
emb|CCT70817.1|  probable ribosomal protein L37.e.A, cytosolic          117   3e-31   
ref|XP_005415326.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    118   3e-31   
gb|KIN07732.1|  hypothetical protein OIDMADRAFT_16295                   117   3e-31   
ref|XP_004652556.1|  PREDICTED: 60S ribosomal protein L37               117   3e-31   
dbj|GAN01449.1|  conserved hypothetical protein                         117   4e-31   
ref|XP_005426148.1|  PREDICTED: 60S ribosomal protein L37               117   4e-31   
emb|CDS12880.1|  Putative Ribosomal protein L37                         117   4e-31   
ref|XP_007799191.1|  putative 60s ribosomal protein l37 protein         117   4e-31   
ref|XP_010212562.1|  PREDICTED: 60S ribosomal protein L37               117   4e-31   
dbj|GAM43850.1|  hypothetical protein TCE0_060f19000                    122   4e-31   
ref|XP_003705141.1|  PREDICTED: 60S ribosomal protein L37-like          118   4e-31   
ref|XP_005488898.1|  PREDICTED: 60S ribosomal protein L37               118   4e-31   
ref|XP_009037703.1|  hypothetical protein AURANDRAFT_27266              117   4e-31   
emb|CEP15959.1|  hypothetical protein                                   117   4e-31   
ref|XP_010874400.1|  PREDICTED: 60S ribosomal protein L37-like          117   4e-31   
gb|EFX70638.1|  hypothetical protein DAPPUDRAFT_309347                  117   4e-31   
ref|XP_001101641.1|  PREDICTED: 60S ribosomal protein L37-like is...    117   4e-31   
ref|XP_006627233.1|  PREDICTED: 60S ribosomal protein L37-like          117   4e-31   
ref|XP_009322840.1|  PREDICTED: 60S ribosomal protein L37               117   4e-31   
ref|XP_003965282.1|  PREDICTED: 60S ribosomal protein L37-like          117   4e-31   
ref|XP_001270696.1|  60S ribosomal protein L37                          117   4e-31   
ref|XP_008628874.1|  PREDICTED: 60S ribosomal protein L37               117   4e-31   
ref|XP_005798716.1|  PREDICTED: 60S ribosomal protein L37-like          117   4e-31   
ref|NP_001191497.1|  60S ribosomal protein L37                          117   4e-31   
ref|XP_009559668.1|  PREDICTED: 60S ribosomal protein L37               117   5e-31   
ref|XP_010393723.1|  PREDICTED: 60S ribosomal protein L37               117   5e-31   
ref|XP_005086139.1|  PREDICTED: 60S ribosomal protein L37-like          117   5e-31   
gb|EHK43028.1|  hypothetical protein TRIATDRAFT_258333                  117   5e-31   
ref|XP_007065816.1|  PREDICTED: 60S ribosomal protein L37               118   5e-31   
ref|XP_007531846.1|  PREDICTED: 60S ribosomal protein L37               117   5e-31   
ref|XP_009075025.1|  PREDICTED: 60S ribosomal protein L37               117   5e-31   
gb|ABM47311.1|  ribosomal protein L37                                   117   5e-31   
ref|XP_005432983.1|  PREDICTED: 60S ribosomal protein L37               119   5e-31   
ref|XP_009467301.1|  PREDICTED: 60S ribosomal protein L37               117   5e-31   
gb|EFX02905.1|  60S ribosomal protein l37                               117   5e-31   
ref|XP_007256651.1|  PREDICTED: 60S ribosomal protein L37-like          117   5e-31   
ref|XP_010173013.1|  PREDICTED: 60S ribosomal protein L37               117   5e-31   
ref|XP_005060626.1|  PREDICTED: 60S ribosomal protein L37               118   5e-31   
gb|KFQ39868.1|  60S ribosomal protein L37                               117   5e-31   
ref|XP_005026056.1|  PREDICTED: 60S ribosomal protein L37               117   5e-31   
gb|ETL78484.1|  60S ribosomal protein L37                               117   6e-31   
ref|XP_009942048.1|  PREDICTED: 60S ribosomal protein L37               117   6e-31   
ref|XP_001394915.2|  60S ribosomal protein L37                          117   6e-31   
emb|CBK20328.2|  unnamed protein product                                117   6e-31   
ref|XP_008324516.1|  PREDICTED: 60S ribosomal protein L37               117   6e-31   
ref|XP_004074614.1|  PREDICTED: 60S ribosomal protein L37               117   6e-31   
ref|XP_009893008.1|  PREDICTED: 60S ribosomal protein L37               117   6e-31   
ref|XP_009898169.1|  PREDICTED: 60S ribosomal protein L37               119   6e-31   
ref|XP_009679002.1|  PREDICTED: 60S ribosomal protein L37               117   6e-31   
gb|AAP20208.1|  ribosomal protein L37                                   117   7e-31   
gb|ETI31432.1|  60S ribosomal protein L37                               118   7e-31   
ref|XP_008491711.1|  PREDICTED: 60S ribosomal protein L37               117   7e-31   
gb|KFP56198.1|  60S ribosomal protein L37                               116   7e-31   
emb|CDJ44838.1|  hypothetical protein ETH_00037330                      117   8e-31   
gb|KFY22278.1|  hypothetical protein V493_06694                         117   8e-31   
ref|NP_001232493.1|  putative ribosomal protein L37 variant 1           116   8e-31   
gb|AAV91383.1|  ribosomal protein 12                                    117   8e-31   
ref|XP_007948730.1|  PREDICTED: 60S ribosomal protein L37               116   9e-31   
ref|XP_007829677.1|  60S ribosomal protein L37                          116   9e-31   
ref|XP_011227444.1|  PREDICTED: 60S ribosomal protein L37 isoform X1    116   9e-31   
gb|ELV11405.1|  60S ribosomal protein L37                               116   9e-31   
emb|CDR97171.1|  60S ribosomal protein L37e, putative                   116   9e-31   
ref|XP_010209620.1|  PREDICTED: 60S ribosomal protein L37               117   9e-31   
ref|XP_007662420.1|  PREDICTED: 60S ribosomal protein L37               119   9e-31   
emb|CDF91801.1|  ZYBA0S14-01420g1_1                                     116   9e-31   
ref|XP_009077332.1|  PREDICTED: 60S ribosomal protein L37               116   1e-30   
ref|XP_002141883.1|  60S ribosomal protein L37                          116   1e-30   
ref|XP_004422828.1|  PREDICTED: 60S ribosomal protein L37 isoform 1     117   1e-30   
ref|XP_003451514.1|  PREDICTED: 60S ribosomal protein L37-like          116   1e-30   
ref|XP_754930.1|  60S ribosomal protein L37                             118   1e-30   
ref|NP_001230532.1|  ribosomal protein L37                              116   1e-30   
gb|ELK06088.1|  60S ribosomal protein L37                               116   1e-30   
gb|AFR93677.1|  large subunit ribosomal protein L37-A                   116   1e-30   
gb|EHH25880.1|  hypothetical protein EGK_15735                          116   1e-30   
ref|XP_009645695.1|  PREDICTED: 60S ribosomal protein L37               117   1e-30   
gb|AAB47039.2|  ribosomal protein L37                                   116   1e-30   
ref|XP_010007048.1|  PREDICTED: 60S ribosomal protein L37               118   1e-30   
ref|XP_005080401.1|  PREDICTED: 60S ribosomal protein L37-like          115   2e-30   
emb|CCI45709.1|  unnamed protein product                                120   2e-30   
ref|XP_011320071.1|  hypothetical protein FGSG_08670                    115   2e-30   
ref|NP_013286.1|  ribosomal 60S subunit protein L37A                    115   2e-30   
gb|ERE84603.1|  60S ribosomal protein L37-like protein                  116   2e-30   
ref|XP_003721174.1|  60S ribosomal protein L37                          115   2e-30   
ref|XP_002629525.1|  60S ribosomal protein L37                          115   2e-30   
emb|CDS26601.1|  ribosomal protein L37a                                 115   2e-30   
ref|XP_010759040.1|  60S ribosomal protein L37                          117   2e-30   
dbj|BAB25746.1|  unnamed protein product                                115   2e-30   
dbj|GAM27882.1|  hypothetical protein SAMD00019534_110580               115   2e-30   
emb|CDO92738.1|  unnamed protein product                                115   2e-30   
gb|AAX81534.1|  60S ribosomal protein L37-like protein                  115   2e-30   
ref|XP_007913420.1|  putative 60s ribosomal protein l37 protein         115   2e-30   
emb|CCF34887.1|  60S ribosomal protein L37                              115   3e-30   
emb|CCF75862.1|  unnamed protein product                                115   3e-30   
ref|XP_002174480.1|  60S ribosomal protein L37                          115   3e-30   
ref|XP_004392143.1|  PREDICTED: 60S ribosomal protein L37-like          115   3e-30   
ref|XP_006879694.1|  PREDICTED: 60S ribosomal protein L37-like          116   3e-30   
gb|KFY49217.1|  hypothetical protein V496_10194                         116   3e-30   
gb|EHH18435.1|  hypothetical protein EGK_15024                          115   3e-30   
gb|KFY95429.1|  hypothetical protein V498_03347                         115   3e-30   
gb|ACN09979.1|  60S ribosomal protein L37                               115   3e-30   
gb|KFY84719.1|  hypothetical protein V500_09067                         115   3e-30   
gb|ACN10081.1|  60S ribosomal protein L37                               115   3e-30   
emb|CCU77676.1|  ribosomal protein L37                                  115   3e-30   
sp|Q9C0T1.1|RL37_EMENI  RecName: Full=60S ribosomal protein L37         115   3e-30   
ref|XP_003053190.1|  60S ribosomal protein L37                          115   3e-30   
gb|EFQ29586.1|  ribosomal protein L37e                                  115   3e-30   
ref|XP_005535668.1|  60S ribosomal protein L37                          115   3e-30   
ref|XP_007517697.1|  PREDICTED: 60S ribosomal protein L37               115   4e-30   
ref|XP_003684569.1|  60S ribosomal protein L37                          114   4e-30   
ref|XP_005347613.1|  PREDICTED: 60S ribosomal protein L37-like          116   4e-30   
gb|AHA44490.1|  60S ribosomal-like protein                              114   4e-30   
gb|EGE05849.1|  ribosomal protein L37                                   114   4e-30   
emb|CEP11441.1|  hypothetical protein                                   114   4e-30   
ref|XP_006691703.1|  ribosomal protein L37-like protein                 114   4e-30   
gb|KFH43572.1|  60S ribosomal protein-like protein                      114   4e-30   
ref|XP_004399697.1|  PREDICTED: 60S ribosomal protein L37-like          114   5e-30   
ref|XP_001790925.1|  hypothetical protein SNOG_00234                    114   5e-30   
gb|EER45691.1|  conserved hypothetical protein                          114   5e-30   
ref|XP_008628966.1|  PREDICTED: 60S ribosomal protein L37-like          114   5e-30   
gb|KFP56626.1|  60S ribosomal protein L37                               114   5e-30   
ref|XP_005852553.1|  large subunit ribosomal protein L37e               114   5e-30   
ref|XP_007322692.1|  hypothetical protein SERLADRAFT_477171             114   5e-30   
ref|XP_005878590.1|  PREDICTED: 60S ribosomal protein L37-like          114   5e-30   
ref|XP_952482.1|  60S ribosomal protein l37                             114   5e-30   
ref|XP_005557967.1|  PREDICTED: 60S ribosomal protein L37-like          114   5e-30   
gb|ENH77612.1|  60s ribosomal protein l37                               114   5e-30   
ref|XP_004623608.1|  PREDICTED: 60S ribosomal protein L37-like          114   5e-30   
ref|XP_002842977.1|  60S ribosomal protein L37                          114   5e-30   
ref|XP_003377850.1|  60S ribosomal protein L37                          114   6e-30   
gb|KFX87546.1|  hypothetical protein V490_08182                         115   6e-30   
ref|XP_004642006.1|  PREDICTED: 60S ribosomal protein L37-like          114   6e-30   
ref|XP_006771967.1|  PREDICTED: 60S ribosomal protein L37-like          114   6e-30   
ref|XP_004828764.1|  60S ribosomal protein L37, putative                114   6e-30   
pdb|4W20|JJ  Chain j, Structure Of The Mammalian 60s Ribosomal Su...    114   6e-30   
ref|XP_003193138.1|  protein component of the large (60S) ribosom...    114   6e-30   
ref|NP_001143498.1|  uncharacterized protein LOC100276177               117   7e-30   
ref|XP_003956842.1|  hypothetical protein KAFR_0D00600                  114   7e-30   
ref|XP_005368427.1|  PREDICTED: 60S ribosomal protein L37-like          114   7e-30   
ref|XP_764801.1|  60S ribosomal protein L37                             114   7e-30   
ref|XP_003326774.1|  60S ribosomal protein L37                          114   7e-30   
gb|KEY68657.1|  hypothetical protein S7711_00535                        114   8e-30   
emb|CEG73918.1|  Putative 60S ribosomal protein L37                     114   8e-30   
ref|XP_445022.1|  60S ribosomal protein L37                             114   8e-30   
emb|CCK69181.1|  hypothetical protein KNAG_0C00680                      114   8e-30   
ref|XP_452279.1|  60S ribosomal protein L37                             114   9e-30   
ref|XP_006962284.1|  ribosomal protein L37e                             114   9e-30   
emb|CDH56284.1|  60s ribosomal protein l37                              114   9e-30   
ref|XP_003255259.1|  PREDICTED: 60S ribosomal protein L37-like          114   9e-30   
emb|CCK70706.1|  hypothetical protein KNAG_0F00340                      113   1e-29   
ref|XP_005552781.1|  PREDICTED: 60S ribosomal protein L37-like          114   1e-29   
emb|CEJ02365.1|  Putative 60S ribosomal protein L37                     114   1e-29   
gb|ELT96777.1|  hypothetical protein CAPTEDRAFT_158783                  114   1e-29   
emb|CDI98016.1|  ribosomal protein L37a                                 113   1e-29   
ref|NP_001135350.1|  60S ribosomal protein L37                          114   1e-29   
ref|XP_007588498.1|  putative 60s ribosomal protein l37 protein         113   1e-29   
gb|KGO75274.1|  Ribosomal protein L37e                                  113   1e-29   
emb|CDQ62069.1|  unnamed protein product                                114   1e-29   
ref|XP_003672998.1|  hypothetical protein NCAS_0A00470                  113   1e-29   
gb|EPQ65378.1|  Protein component of the large (60S) ribosomal su...    113   1e-29   



>ref|XP_009627760.1| PREDICTED: 60S ribosomal protein L37 [Nicotiana tomentosiformis]
 ref|XP_009604482.1| PREDICTED: 60S ribosomal protein L37 [Nicotiana tomentosiformis]
 ref|XP_009783742.1| PREDICTED: 60S ribosomal protein L37 [Nicotiana sylvestris]
Length=95

 Score =   179 bits (453),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAAR+ KYNWSVKA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARLRKYNWSVKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKTNFRE TEATPRKKGAA AS
Sbjct  61   TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAVAS  95



>ref|XP_009785701.1| PREDICTED: 60S ribosomal protein L37-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009785702.1| PREDICTED: 60S ribosomal protein L37-like isoform X2 [Nicotiana 
sylvestris]
Length=95

 Score =   178 bits (451),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAAR+ KYNWSVKA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARLRKYNWSVKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKTNFRE TEATPRKKGAA +S
Sbjct  61   TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAVSS  95



>ref|XP_004245255.1| PREDICTED: 60S ribosomal protein L37 [Solanum lycopersicum]
Length=95

 Score =   177 bits (448),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAAR+ KYNWSVKA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARLRKYNWSVKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKTNFRE TEA PRKKG AAAS
Sbjct  61   TGRMRYLRNVPRRFKTNFREGTEAAPRKKGTAAAS  95



>ref|XP_006356643.1| PREDICTED: 60S ribosomal protein L37-3-like [Solanum tuberosum]
Length=95

 Score =   176 bits (445),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 86/95 (91%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAAR+ KYNWSVKA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARLRKYNWSVKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKTNFRE TEA PRKKG AAA+
Sbjct  61   TGRMRYLRNVPRRFKTNFREGTEAAPRKKGTAAAA  95



>ref|XP_006450619.1| hypothetical protein CICLE_v10010027mg [Citrus clementina]
 ref|XP_006476146.1| PREDICTED: 60S ribosomal protein L37-1-like [Citrus sinensis]
 gb|ESR63859.1| hypothetical protein CICLE_v10010027mg [Citrus clementina]
 gb|KDO79707.1| hypothetical protein CISIN_1g034411mg [Citrus sinensis]
Length=95

 Score =   173 bits (438),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAAR+ KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARVRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+NFRE TEA PRKK  AA+S
Sbjct  61   TGRMRYLRHVPRRFKSNFREGTEAAPRKKNVAASS  95



>gb|KHG25292.1| 60S ribosomal L37-1 -like protein [Gossypium arboreum]
Length=120

 Score =   174 bits (440),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  17   QMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTT  196
            +MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YPA+RI KYNWSVKAIRRKTT
Sbjct  25   KMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPASRIRKYNWSVKAIRRKTT  84

Query  197  GTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            GTGRMR+LR VPRRFKT FRE T+ATPRKKGA AAS
Sbjct  85   GTGRMRYLRRVPRRFKTGFREGTQATPRKKGAVAAS  120



>gb|KDP34219.1| hypothetical protein JCGZ_07790 [Jatropha curcas]
Length=96

 Score =   172 bits (436),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC ACAYPA+R+ KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACAYPASRLRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKTNFRE T+ATPR KGAAA S
Sbjct  61   TGRMRYLRHVPRRFKTNFREGTQATPRNKGAAAVS  95



>ref|XP_002516579.1| 60S ribosomal protein L37, putative [Ricinus communis]
 gb|EEF45920.1| 60S ribosomal protein L37, putative [Ricinus communis]
Length=96

 Score =   172 bits (435),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPA+R+ KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPASRLRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKTNFRE T+A PR KGAAAA+
Sbjct  61   TGRMRYLRHVPRRFKTNFREGTQAPPRNKGAAAAT  95



>ref|XP_007012041.1| Zinc-binding ribosomal family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY29660.1| Zinc-binding ribosomal family protein isoform 2, partial [Theobroma 
cacao]
Length=112

 Score =   172 bits (436),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +2

Query  5    ASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIR  184
            AS  +MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YPA+RI KYNWSVKAIR
Sbjct  13   ASTEEMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPASRIRKYNWSVKAIR  72

Query  185  RKTTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            RKTTGTGRMR+LR VPRRFKT FRE T+ATPRKK A AAS
Sbjct  73   RKTTGTGRMRYLRHVPRRFKTGFREGTQATPRKKAAVAAS  112



>ref|XP_011026574.1| PREDICTED: 60S ribosomal protein L37-1-like [Populus euphratica]
Length=96

 Score =   171 bits (434),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR+ KYNWS KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARVRKYNWSEKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR +PRRFKTNFRE T+ATPR KGAAAAS
Sbjct  61   TGRMRYLRHLPRRFKTNFREGTQATPRNKGAAAAS  95



>ref|XP_004506845.1| PREDICTED: 60S ribosomal protein L37-3-like isoform X2 [Cicer 
arietinum]
Length=95

 Score =   171 bits (434),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKSRCSACAYPAAR+ KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSRCSACAYPAARVRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PRKKGAAA++
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTEAAPRKKGAAASA  95



>ref|XP_002309570.1| hypothetical protein POPTR_0006s25990g [Populus trichocarpa]
 ref|XP_011019669.1| PREDICTED: 60S ribosomal protein L37-1 [Populus euphratica]
 ref|XP_011013239.1| PREDICTED: 60S ribosomal protein L37-1 [Populus euphratica]
 gb|ABK93027.1| unknown [Populus trichocarpa]
 gb|EEE93093.1| hypothetical protein POPTR_0006s25990g [Populus trichocarpa]
Length=94

 Score =   171 bits (433),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR+ KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARVRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRM++LR +PRRFKTNFRE T+ATPR KGAAAA
Sbjct  61   TGRMKYLRHLPRRFKTNFREGTQATPRNKGAAAA  94



>ref|XP_004235660.1| PREDICTED: 60S ribosomal protein L37-3 [Solanum lycopersicum]
 ref|XP_006343062.1| PREDICTED: 60S ribosomal protein L37-3-like [Solanum tuberosum]
Length=95

 Score =   171 bits (432),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRSYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKTNFRE TEA PRKKG AA++
Sbjct  61   TGRMRYLRNVPRRFKTNFREGTEAAPRKKGTAASA  95



>gb|KJB53450.1| hypothetical protein B456_009G051900 [Gossypium raimondii]
Length=95

 Score =   171 bits (432),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YPA+RI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPASRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE T+ATPRKKGA AAS
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTQATPRKKGAVAAS  95



>gb|ACJ83830.1| unknown [Medicago truncatula]
 gb|AFK44128.1| unknown [Medicago truncatula]
 gb|AES68004.2| 60S ribosomal protein L37-1 [Medicago truncatula]
Length=94

 Score =   170 bits (430),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWS KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARVRKYNWSEKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRFK+ FRE TEA PRKKGAA+A
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRKKGAASA  94



>ref|XP_004241731.1| PREDICTED: 60S ribosomal protein L37-2 [Solanum lycopersicum]
 ref|XP_006356156.1| PREDICTED: 60S ribosomal protein L37-2-like [Solanum tuberosum]
Length=94

 Score =   170 bits (430),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRFKTNFRE TEA PRKKG A+A
Sbjct  61   TGRMRYLRNVPRRFKTNFREGTEAAPRKKGVASA  94



>ref|XP_003531677.1| PREDICTED: 60S ribosomal protein L37-3 [Glycine max]
 gb|KHN47819.1| 60S ribosomal protein L37-3 [Glycine soja]
Length=95

 Score =   170 bits (430),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARTRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PRK+GAAA++
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRKRGAAASA  95



>ref|XP_006833288.1| hypothetical protein AMTR_s00109p00029660 [Amborella trichopoda]
 gb|ERM98566.1| hypothetical protein AMTR_s00109p00029660 [Amborella trichopoda]
Length=95

 Score =   170 bits (430),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR +PRRFK+NFRE TEA PRKK AAA+
Sbjct  61   TGRMRYLRHMPRRFKSNFREGTEAAPRKKIAAAS  94



>ref|XP_004304510.1| PREDICTED: 60S ribosomal protein L37-3 [Fragaria vesca subsp. 
vesca]
Length=95

 Score =   169 bits (429),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR  K+NWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARTRKFNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PRKKGAAA++
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRKKGAAASA  95



>ref|XP_003597753.1| Ribosomal protein L37 [Medicago truncatula]
Length=102

 Score =   170 bits (430),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = +2

Query  2    FASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAI  181
            F    + GKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWS KAI
Sbjct  3    FTRVLESGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARVRKYNWSEKAI  62

Query  182  RRKTTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            RRKTTGTGRMR+LR VPRRFK+ FRE TEA PRKKGAA+A
Sbjct  63   RRKTTGTGRMRYLRNVPRRFKSGFREGTEAAPRKKGAASA  102



>ref|XP_004506844.1| PREDICTED: 60S ribosomal protein L37-3-like isoform X1 [Cicer 
arietinum]
Length=96

 Score =   169 bits (429),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +2

Query  17   QMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTT  196
              GKGTGSFGKRRNKTHTLC+RCGRRSFH+QKSRCSACAYPAAR+ KYNWSVKAIRRKTT
Sbjct  1    MQGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSRCSACAYPAARVRKYNWSVKAIRRKTT  60

Query  197  GTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            GTGRMR+LR VPRRFK+ FRE TEA PRKKGAAA++
Sbjct  61   GTGRMRYLRHVPRRFKSGFREGTEAAPRKKGAAASA  96



>ref|XP_004486739.1| PREDICTED: 60S ribosomal protein L37-3-like [Cicer arietinum]
Length=95

 Score =   169 bits (428),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKSRCSACAYPAAR+ KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSRCSACAYPAARVRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PRKKG AA +
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTEAAPRKKGGAATA  95



>ref|XP_002516050.1| 60S ribosomal protein L37, putative [Ricinus communis]
 gb|EEF46470.1| 60S ribosomal protein L37, putative [Ricinus communis]
Length=96

 Score =   169 bits (428),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRSYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR +PRRFK+ FRE TEA PRKKGAAAAS
Sbjct  61   TGRMRYLRHLPRRFKSGFREGTEAAPRKKGAAAAS  95



>ref|NP_001173207.1| Os02g0815001 [Oryza sativa Japonica Group]
 dbj|BAD21671.1| putative ribosomal protein L37 [Oryza sativa Japonica Group]
 gb|EAY87998.1| hypothetical protein OsI_09420 [Oryza sativa Indica Group]
 gb|EEE58035.1| hypothetical protein OsJ_08855 [Oryza sativa Japonica Group]
 dbj|BAH91936.1| Os02g0815001 [Oryza sativa Japonica Group]
Length=95

 Score =   169 bits (428),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VP+RFK+NFRE TEA PRKKGAAA++
Sbjct  61   TGRMRYLRHVPKRFKSNFREGTEAAPRKKGAAASN  95



>gb|EYU21452.1| hypothetical protein MIMGU_mgv1a017055mg [Erythranthe guttata]
Length=95

 Score =   169 bits (427),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKTNFRE TEA PRKK AAA++
Sbjct  61   TGRMRYLRNVPRRFKTNFREGTEAAPRKKVAAASA  95



>ref|XP_010920294.1| PREDICTED: 60S ribosomal protein L37-1-like [Elaeis guineensis]
Length=96

 Score =   169 bits (427),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC++C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCASCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR +PRRFK+NFRE T+ATPRKK AAAA+
Sbjct  61   TGRMRYLRHLPRRFKSNFREGTQATPRKKTAAAAA  95



>ref|XP_002324820.2| hypothetical protein POPTR_0018s00830g [Populus trichocarpa]
 gb|ABK93790.1| unknown [Populus trichocarpa]
 gb|ABK94875.1| unknown [Populus trichocarpa]
 gb|EEF03385.2| hypothetical protein POPTR_0018s00830g [Populus trichocarpa]
Length=96

 Score =   169 bits (427),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR+ KYNWS KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARVRKYNWSEKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRM++LR +PRRFKTNFRE T+A PR KGAAAAS
Sbjct  61   TGRMKYLRHLPRRFKTNFREGTQAAPRNKGAAAAS  95



>ref|XP_003604481.1| Ribosomal protein L37 [Medicago truncatula]
 gb|AFK43631.1| unknown [Medicago truncatula]
 gb|KEH16566.1| 60S ribosomal protein L37-1 [Medicago truncatula]
Length=95

 Score =   169 bits (427),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWS KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARVRKYNWSEKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PR KGAAA++
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRNKGAAAST  95



>gb|EYU24699.1| hypothetical protein MIMGU_mgv1a017069mg [Erythranthe guttata]
Length=95

 Score =   168 bits (426),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKTNFRE TEA PRKK A A++
Sbjct  61   TGRMRYLRNVPRRFKTNFREGTEAAPRKKAAVASA  95



>ref|XP_009397905.1| PREDICTED: 60S ribosomal protein L37-3-like [Musa acuminata subsp. 
malaccensis]
Length=95

 Score =   168 bits (426),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC +C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRF++NFRE TEATPRKK A+AA
Sbjct  61   TGRMRYLRHVPRRFRSNFREGTEATPRKKSASAA  94



>ref|XP_008792349.1| PREDICTED: 60S ribosomal protein L37-1 [Phoenix dactylifera]
Length=96

 Score =   168 bits (426),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+AC YP+ARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACGYPSARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKTNFRE T+A PRKK A +AS
Sbjct  61   TGRMRYLRHVPRRFKTNFREGTQAAPRKKAADSAS  95



>ref|XP_010916787.1| PREDICTED: 60S ribosomal protein L37-1-like [Elaeis guineensis]
Length=96

 Score =   168 bits (426),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+AC YP+ARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACGYPSARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+NFRE T+ATPRK+  A+AS
Sbjct  61   TGRMRYLRHVPRRFKSNFREGTQATPRKRAVASAS  95



>ref|XP_007012040.1| Zinc-binding ribosomal protein family protein isoform 1 [Theobroma 
cacao]
 gb|EOY29659.1| Zinc-binding ribosomal protein family protein isoform 1 [Theobroma 
cacao]
 gb|KJB65702.1| hypothetical protein B456_010G109500 [Gossypium raimondii]
Length=95

 Score =   168 bits (426),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YPA+RI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPASRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE T+ATPRKK A AAS
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTQATPRKKAAVAAS  95



>ref|XP_007215188.1| hypothetical protein PRUPE_ppa013930mg [Prunus persica]
 ref|XP_008228534.1| PREDICTED: 60S ribosomal protein L37-3 [Prunus mume]
 gb|EMJ16387.1| hypothetical protein PRUPE_ppa013930mg [Prunus persica]
Length=95

 Score =   168 bits (425),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PRKKGAAA +
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRKKGAAATA  95



>ref|XP_009611259.1| PREDICTED: 60S ribosomal protein L37-3 [Nicotiana tomentosiformis]
 ref|XP_009777906.1| PREDICTED: 60S ribosomal protein L37-3 [Nicotiana sylvestris]
Length=94

 Score =   167 bits (424),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRFKTNFRE TEA PRKK A +A
Sbjct  61   TGRMRYLRNVPRRFKTNFREGTEAAPRKKAAVSA  94



>gb|KJB56585.1| hypothetical protein B456_009G134200, partial [Gossypium raimondii]
Length=122

 Score =   169 bits (427),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    FASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAI  181
            F ++A MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR   YNWSVKAI
Sbjct  22   FPASAPMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRTYNWSVKAI  81

Query  182  RRKTTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            RRKTTGTGRMR+LR VPRRFKT FRE TEA PRKK AAA++
Sbjct  82   RRKTTGTGRMRYLRHVPRRFKTGFREGTEAAPRKKVAAASA  122



>emb|CBI20899.3| unnamed protein product [Vitis vinifera]
Length=156

 Score =   169 bits (428),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  5    ASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIR  184
            ++  QMGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+AC +P++RI KYNWSVKAIR
Sbjct  58   SATPQMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACGFPSSRIRKYNWSVKAIR  117

Query  185  RKTTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            RKTTGTGRMR+LR VP RFK+NFRE TEA PRKKGAAA+
Sbjct  118  RKTTGTGRMRYLRHVPCRFKSNFREGTEAAPRKKGAAAS  156



>ref|XP_004954348.1| PREDICTED: 60S ribosomal protein L37-1-like [Setaria italica]
Length=96

 Score =   167 bits (423),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+NFRE TEA  RKKGAAA +
Sbjct  61   TGRMRYLRHVPRRFKSNFREGTEAVSRKKGAAAGT  95



>gb|ACV50438.1| ribosomal protein L37 [Jatropha curcas]
 gb|KDP37230.1| hypothetical protein JCGZ_06286 [Jatropha curcas]
Length=96

 Score =   167 bits (423),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE T+A PRKKGAAA S
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTQAAPRKKGAAATS  95



>emb|CDO98037.1| unnamed protein product [Coffea canephora]
Length=119

 Score =   168 bits (425),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    FASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAI  181
             +S+  MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACAYPAAR   YNWSVKAI
Sbjct  19   ISSSPAMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAI  78

Query  182  RRKTTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            RRKTTGTGRMR+LR VPRRFKTNFRE T+A PRKK AAA++
Sbjct  79   RRKTTGTGRMRYLRHVPRRFKTNFREGTQAAPRKKVAAASA  119



>ref|XP_009367923.1| PREDICTED: 60S ribosomal protein L37-3-like [Pyrus x bretschneideri]
Length=96

 Score =   167 bits (423),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWS KA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARLRKYNWSEKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ F E T+A PR+KGAAAAS
Sbjct  61   TGRMRYLRNVPRRFKSGFLEGTQAAPRRKGAAAAS  95



>ref|XP_010496951.1| PREDICTED: 60S ribosomal protein L37-1-like [Camelina sativa]
Length=95

 Score =   167 bits (422),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE T+ATPR K AAA+S
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTQATPRNKAAAASS  95



>ref|XP_009611768.1| PREDICTED: 60S ribosomal protein L37-3 [Nicotiana tomentosiformis]
Length=95

 Score =   167 bits (422),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWS KA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARLRKYNWSEKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PRKK AA ++
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAAPRKKAAAVSA  95



>ref|XP_010476607.1| PREDICTED: 60S ribosomal protein L37-1-like [Camelina sativa]
Length=96

 Score =   167 bits (422),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE T+ATPR K AAA+S
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTQATPRNKAAAASS  95



>ref|XP_010667797.1| PREDICTED: 60S ribosomal protein L37-3 [Beta vulgaris subsp. 
vulgaris]
Length=94

 Score =   166 bits (421),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARVRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRFKT FRE T+A PRK  AA++
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTQAAPRKHAAASS  94



>ref|XP_010667790.1| PREDICTED: 60S ribosomal protein L37-3-like [Beta vulgaris subsp. 
vulgaris]
Length=94

 Score =   166 bits (421),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARVRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRFKT FRE T+A PRK  AAA+
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTQAAPRKHVAAAS  94



>gb|KHG10587.1| 60S ribosomal L37-3 -like protein [Gossypium arboreum]
 gb|KJB07539.1| hypothetical protein B456_001G028800 [Gossypium raimondii]
Length=95

 Score =   166 bits (421),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YPA+RI KYNWS+KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPASRIRKYNWSMKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PRKK A AAS
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTEAAPRKKAAVAAS  95



>ref|XP_007223787.1| hypothetical protein PRUPE_ppa013927mg [Prunus persica]
 ref|XP_008220022.1| PREDICTED: 60S ribosomal protein L37 [Prunus mume]
 gb|EMJ24986.1| hypothetical protein PRUPE_ppa013927mg [Prunus persica]
Length=96

 Score =   166 bits (421),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWS KA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARLRKYNWSEKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+NF E T+A PR+KG AAA+
Sbjct  61   TGRMRYLRNVPRRFKSNFTEGTQAAPRRKGTAAAA  95



>ref|XP_006649162.1| PREDICTED: 60S ribosomal protein L37-3-like, partial [Oryza brachyantha]
Length=105

 Score =   166 bits (421),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
             GKGTGSFGKRRNKTHTLCVRCGRRSFH+QKS CS+C YPAARI KYNWS+KAIRRKTTG
Sbjct  11   QGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSMKAIRRKTTG  70

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR +PRRFK+NFRE TEA PRKKGAAA++
Sbjct  71   TGRMRYLRHLPRRFKSNFREGTEAAPRKKGAAASN  105



>ref|XP_003543640.1| PREDICTED: 60S ribosomal protein L37-3 [Glycine max]
 gb|KHM98754.1| 60S ribosomal protein L37-3 [Glycine soja]
 gb|KHN32618.1| 60S ribosomal protein L37-3 [Glycine soja]
Length=95

 Score =   166 bits (420),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARTRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAA  295
            TGRMR+LR VPRRFK+ FRE TEA PRKKGAA
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRKKGAA  92



>ref|XP_006298872.1| hypothetical protein CARUB_v10014992mg [Capsella rubella]
 gb|EOA31770.1| hypothetical protein CARUB_v10014992mg [Capsella rubella]
Length=95

 Score =   166 bits (420),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR KGAA+++
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRNKGAASSA  95



>ref|XP_007163943.1| hypothetical protein PHAVU_L003800g [Phaseolus vulgaris]
 gb|ESW35937.1| hypothetical protein PHAVU_L003800g [Phaseolus vulgaris]
Length=95

 Score =   166 bits (420),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARTRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMR+LR VPRRFK+ FRE TEA PRK+GAAA
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTEAAPRKRGAAA  93



>ref|NP_001045655.1| Os02g0111700 [Oryza sativa Japonica Group]
 ref|XP_006646776.1| PREDICTED: 60S ribosomal protein L37-1-like [Oryza brachyantha]
 pdb|3J61|JJ Chain j, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD07846.1| putative 60S ribosomal protein L37 [Oryza sativa Japonica Group]
 dbj|BAF07569.1| Os02g0111700 [Oryza sativa Japonica Group]
 gb|EAY84169.1| hypothetical protein OsI_05548 [Oryza sativa Indica Group]
 gb|EAZ21468.1| hypothetical protein OsJ_05070 [Oryza sativa Japonica Group]
 dbj|BAG86645.1| unnamed protein product [Oryza sativa Japonica Group]
Length=94

 Score =   166 bits (420),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMR++R VPRRFK+NFRE TEATPRK+ AAA
Sbjct  61   TGRMRYMRHVPRRFKSNFREGTEATPRKRAAAA  93



>ref|NP_001237255.1| ribosomal protein L37 [Glycine max]
 gb|AAS47512.1| ribosomal protein L37 [Glycine max]
 gb|ACU17032.1| unknown [Glycine max]
Length=95

 Score =   166 bits (420),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARTRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FR+ TEA PRK+GAAA++
Sbjct  61   TGRMRYLRNVPRRFKSGFRDGTEAAPRKRGAAAST  95



>emb|CDX97720.1| BnaA05g23590D [Brassica napus]
Length=115

 Score =   166 bits (421),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
            A M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKT
Sbjct  18   ATMTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKT  77

Query  194  TGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGTGRMR+L+ VPRRFKT FRE TEA PR KGAAA+S
Sbjct  78   TGTGRMRYLKNVPRRFKTGFREGTEAKPRNKGAAASS  114



>emb|CDY30133.1| BnaC05g37290D [Brassica napus]
Length=115

 Score =   166 bits (421),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
            A M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKT
Sbjct  18   ATMTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKT  77

Query  194  TGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGTGRMR+L+ VPRRFKT FRE TEA PR KGAAA+S
Sbjct  78   TGTGRMRYLKNVPRRFKTGFREGTEAKPRNKGAAASS  114



>gb|AFK48222.1| unknown [Lotus japonicus]
Length=95

 Score =   166 bits (419),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARKRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PR KGAAA++
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRNKGAAAST  95



>ref|XP_008362389.1| PREDICTED: 60S ribosomal protein L37-3 [Malus domestica]
 ref|XP_009346004.1| PREDICTED: 60S ribosomal protein L37-3 [Pyrus x bretschneideri]
Length=95

 Score =   166 bits (419),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR  KYNWS KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRKYNWSEKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PRKKGAAA +
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRKKGAAATA  95



>ref|XP_008378115.1| PREDICTED: 60S ribosomal protein L37-3 [Malus domestica]
 ref|XP_008357421.1| PREDICTED: 60S ribosomal protein L37-3-like [Malus domestica]
Length=96

 Score =   166 bits (419),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWS KA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARLRKYNWSEKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ F E T+A PR KG+AAAS
Sbjct  61   TGRMRYLRNVPRRFKSGFLEGTQAAPRSKGSAAAS  95



>gb|KHG01859.1| 60S ribosomal L37-3 -like protein [Gossypium arboreum]
 gb|KJB70475.1| hypothetical protein B456_011G074900 [Gossypium raimondii]
Length=95

 Score =   166 bits (419),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PRKK AAA++
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTEAAPRKKVAAASA  95



>ref|XP_003570380.1| PREDICTED: 60S ribosomal protein L37-3-like [Brachypodium distachyon]
Length=95

 Score =   166 bits (419),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR++R VPRRFK+NFRE TEA PR KGA+A +
Sbjct  61   TGRMRYMRHVPRRFKSNFREGTEAAPRNKGASAGN  95



>ref|XP_009353625.1| PREDICTED: 60S ribosomal protein L37-3-like [Pyrus x bretschneideri]
Length=95

 Score =   165 bits (418),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR  KYNWS KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRKYNWSEKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMR+LR VPRRFK+ FRE TEA PRKKGAAA
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRKKGAAA  93



>ref|XP_008393895.1| PREDICTED: 60S ribosomal protein L37-1 [Malus domestica]
Length=96

 Score =   165 bits (418),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWS KA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARLRKYNWSEKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ F E T+A PR+KGAA AS
Sbjct  61   TGRMRYLRNVPRRFKSGFLEGTQAAPRRKGAAXAS  95



>ref|XP_007163458.1| hypothetical protein PHAVU_001G235900g [Phaseolus vulgaris]
 gb|ESW35452.1| hypothetical protein PHAVU_001G235900g [Phaseolus vulgaris]
Length=95

 Score =   165 bits (418),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARTRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PRK+GAA+ +
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTEAAPRKRGAASTA  95



>ref|XP_004952168.1| PREDICTED: 60S ribosomal protein L37-1-like [Setaria italica]
Length=94

 Score =   165 bits (418),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMR+LR VPRRFK+NFRE TEATP+K  AAA
Sbjct  61   TGRMRYLRHVPRRFKSNFREGTEATPKKSAAAA  93



>gb|AFK47939.1| unknown [Lotus japonicus]
Length=95

 Score =   165 bits (418),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARKRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PR KGAAA +
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRNKGAAATA  95



>ref|XP_008785156.1| PREDICTED: 60S ribosomal protein L37-3-like [Phoenix dactylifera]
Length=96

 Score =   165 bits (418),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC++C YP+ARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCASCGYPSARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR +PRRFK+NFRE TEATPR++  AA S
Sbjct  61   TGRMRYLRHLPRRFKSNFREGTEATPRRRATAATS  95



>ref|XP_009388714.1| PREDICTED: 60S ribosomal protein L37-1-like [Musa acuminata subsp. 
malaccensis]
Length=94

 Score =   165 bits (418),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YP++RI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPSSRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRFK+NFRE T+A PRKK  AAA
Sbjct  61   TGRMRYLRHVPRRFKSNFREGTQAAPRKKAVAAA  94



>ref|XP_002299709.1| ribosomal protein L37 [Populus trichocarpa]
 ref|XP_011010168.1| PREDICTED: 60S ribosomal protein L37-3 [Populus euphratica]
 gb|ABK95278.1| unknown [Populus trichocarpa]
 gb|EEE84514.1| ribosomal protein L37 [Populus trichocarpa]
Length=95

 Score =   165 bits (418),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR  KYNWS KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRKYNWSEKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE T+A PRKKGAAA++
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTQAEPRKKGAAASA  95



>ref|XP_006303766.1| hypothetical protein CARUB_v10011974mg [Capsella rubella]
 gb|EOA36664.1| hypothetical protein CARUB_v10011974mg [Capsella rubella]
Length=95

 Score =   165 bits (418),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWS+KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSIKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE T+ATPR K AAA+S
Sbjct  61   TGRMRYLRNVPRRFKTCFREGTQATPRNKSAAASS  95



>ref|XP_002892856.1| 60S ribosomal protein L37 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69115.1| 60S ribosomal protein L37 [Arabidopsis lyrata subsp. lyrata]
Length=96

 Score =   165 bits (417),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE T+ATPR+  AAAAS
Sbjct  61   TGRMRYLRNVPRRFKTCFREGTQATPRRNKAAAAS  95



>gb|ABK20886.1| unknown [Picea sitchensis]
 gb|ABK21439.1| unknown [Picea sitchensis]
Length=95

 Score =   165 bits (417),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFHIQKSRCSACAYP+ RI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHIQKSRCSACAYPSKRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAA  295
            TGRMR+LR +PRRFK NFRE T+ATP+KK AA
Sbjct  61   TGRMRYLRHMPRRFKNNFREGTQATPKKKAAA  92



>ref|XP_004141772.1| PREDICTED: 60S ribosomal protein L37-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004141773.1| PREDICTED: 60S ribosomal protein L37-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004158987.1| PREDICTED: 60S ribosomal protein L37-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004158988.1| PREDICTED: 60S ribosomal protein L37-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_008462159.1| PREDICTED: 60S ribosomal protein L37-3-like [Cucumis melo]
 gb|KGN45374.1| hypothetical protein Csa_7G446890 [Cucumis sativus]
Length=95

 Score =   165 bits (417),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARKRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PR KGAAA++
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTEAAPRNKGAAASA  95



>ref|NP_001235982.1| uncharacterized protein LOC100306503 [Glycine max]
 gb|ACU14707.1| unknown [Glycine max]
Length=95

 Score =   165 bits (417),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRR+KTHTLCVRCGRRSFH+QKSRC+ACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRDKTHTLCVRCGRRSFHLQKSRCAACAFPAARTRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAA  295
            TGRMR+LR VPRRFK+ FRE TEA PRKKGAA
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRKKGAA  92



>ref|XP_006426971.1| hypothetical protein CICLE_v10026841mg [Citrus clementina]
 ref|XP_006465606.1| PREDICTED: 60S ribosomal protein L37-3-like [Citrus sinensis]
 gb|ESR40211.1| hypothetical protein CICLE_v10026841mg [Citrus clementina]
 gb|KDO56887.1| hypothetical protein CISIN_1g034400mg [Citrus sinensis]
Length=95

 Score =   165 bits (417),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE T+A PRKKGAAA++
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTQAAPRKKGAAASA  95



>ref|NP_172977.1| 60S ribosomal protein L37-1 [Arabidopsis thaliana]
 sp|Q8LFH7.1|RL371_ARATH RecName: Full=60S ribosomal protein L37-1 [Arabidopsis thaliana]
 gb|AAM61401.1| putative 60s ribosomal protein L37 [Arabidopsis thaliana]
 dbj|BAC43354.1| putative 60s ribosomal protein L37 [Arabidopsis thaliana]
 gb|AAO50496.1| putative 60s ribosomal protein L37 [Arabidopsis thaliana]
 gb|AEE29295.1| 60S ribosomal protein L37-1 [Arabidopsis thaliana]
Length=95

 Score =   165 bits (417),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE T+ATPR K AA++S
Sbjct  61   TGRMRYLRNVPRRFKTCFREGTQATPRNKAAASSS  95



>emb|CBI36137.3| unnamed protein product [Vitis vinifera]
Length=115

 Score =   165 bits (418),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    FASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAI  181
            F  +A MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+AC +PAARI KYNWSVKAI
Sbjct  15   FFLSATMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACGFPAARIRKYNWSVKAI  74

Query  182  RRKTTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            RRKTTGTGRMR+LR V  RFK+NFRE T+A PRKKGAAA++
Sbjct  75   RRKTTGTGRMRYLRHVACRFKSNFREGTQAAPRKKGAAASA  115



>ref|XP_006305787.1| hypothetical protein CARUB_v10010668mg, partial [Capsella rubella]
 gb|EOA38685.1| hypothetical protein CARUB_v10010668mg, partial [Capsella rubella]
Length=120

 Score =   166 bits (419),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
            A MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKT
Sbjct  24   ASMGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKT  83

Query  194  TGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGTGRMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  84   TGTGRMRYLRNVPRRFKTGFREGTEAKPRIKAAASSA  120



>ref|NP_001060912.2| Os08g0128500 [Oryza sativa Japonica Group]
 gb|EEE67984.1| hypothetical protein OsJ_25910 [Oryza sativa Japonica Group]
 dbj|BAF22826.2| Os08g0128500 [Oryza sativa Japonica Group]
Length=94

 Score =   164 bits (416),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMR++R VPRRFK+NFRE TEATPRK+ A A
Sbjct  61   TGRMRYMRHVPRRFKSNFREGTEATPRKRAAVA  93



>ref|XP_007163942.1| hypothetical protein PHAVU_L003700g [Phaseolus vulgaris]
 gb|ESW35936.1| hypothetical protein PHAVU_L003700g [Phaseolus vulgaris]
Length=95

 Score =   164 bits (416),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARTRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAA  295
            TGRMR+LR VPRRFK+ FRE TEA PRK+GAA
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTEAAPRKRGAA  92



>gb|EPS63391.1| hypothetical protein M569_11398, partial [Genlisea aurea]
Length=94

 Score =   164 bits (416),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  23   GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGT  202
            GKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR   YNWSVKAIRRKTTGT
Sbjct  1    GKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTYNWSVKAIRRKTTGT  60

Query  203  GRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            GRMR+LR VPRRFKTNFRE TEA PRKK AA ++
Sbjct  61   GRMRYLRHVPRRFKTNFREGTEAAPRKKSAATSA  94



>ref|XP_009146170.1| PREDICTED: 60S ribosomal protein L37-2-like [Brassica rapa]
Length=96

 Score =   164 bits (416),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+L+ VPRRFKT FRE TEA PR KGAAA+S
Sbjct  61   TGRMRYLKNVPRRFKTGFREGTEAKPRNKGAAASS  95



>ref|XP_002284249.1| PREDICTED: 60S ribosomal protein L37-3-like [Vitis vinifera]
Length=94

 Score =   164 bits (415),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+AC +P++RI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACGFPSSRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VP RFK+NFRE TEA PRKKGAAA+
Sbjct  61   TGRMRYLRHVPCRFKSNFREGTEAAPRKKGAAAS  94



>ref|XP_002882976.1| 60S ribosomal protein L37 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002894372.1| 60S ribosomal protein L37 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010503766.1| PREDICTED: 60S ribosomal protein L37-3 [Camelina sativa]
 ref|XP_010465613.1| PREDICTED: 60S ribosomal protein L37-3 [Camelina sativa]
 ref|XP_010487453.1| PREDICTED: 60S ribosomal protein L37-3 [Camelina sativa]
 gb|EFH59235.1| 60S ribosomal protein L37 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70631.1| 60S ribosomal protein L37 [Arabidopsis lyrata subsp. lyrata]
Length=95

 Score =   164 bits (415),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRNKAAASSA  95



>ref|XP_009403524.1| PREDICTED: 60S ribosomal protein L37-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009403525.1| PREDICTED: 60S ribosomal protein L37-1 [Musa acuminata subsp. 
malaccensis]
Length=94

 Score =   164 bits (414),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YP++RI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPSSRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRFK+NFRE T+A PRKK  A A
Sbjct  61   TGRMRYLRHVPRRFKSNFREGTQAVPRKKAVADA  94



>ref|XP_008810031.1| PREDICTED: 60S ribosomal protein L37-1-like [Phoenix dactylifera]
Length=96

 Score =   164 bits (414),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+AC YP+ARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACGYPSARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR +PRRFK+NF E T+ATPRK  AA+ S
Sbjct  61   TGRMRYLRHLPRRFKSNFLEGTQATPRKAAAASIS  95



>ref|XP_010459048.1| PREDICTED: 60S ribosomal protein L37-1 [Camelina sativa]
Length=95

 Score =   164 bits (414),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VP RFKT FRE T+ATPR K AAA+S
Sbjct  61   TGRMRYLRNVPSRFKTCFREGTQATPRNKAAAASS  95



>gb|EEC82850.1| hypothetical protein OsI_27679 [Oryza sativa Indica Group]
Length=94

 Score =   164 bits (414),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMR++R VP+RFK+NFRE TEATPRK+ A A
Sbjct  61   TGRMRYMRHVPKRFKSNFREGTEATPRKRAAVA  93



>gb|EPS70838.1| hypothetical protein M569_03921, partial [Genlisea aurea]
Length=93

 Score =   164 bits (414),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +2

Query  23   GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGT  202
            GKGTGSFGKRRNKTHTLC+RCGRRSFH+QKSRCSACAYPAAR   YNWSVKAIRRKTTGT
Sbjct  1    GKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSRCSACAYPAARKRTYNWSVKAIRRKTTGT  60

Query  203  GRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            GRMR+LR VPRRFKTNFRE T+A PRKK AAA+
Sbjct  61   GRMRYLRHVPRRFKTNFREGTQAAPRKKSAAAS  93



>ref|XP_010249733.1| PREDICTED: 60S ribosomal protein L37-1 [Nelumbo nucifera]
Length=94

 Score =   163 bits (413),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKS C+AC +P++RI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCAACGFPSSRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR +PRRFK+NFRE T+A PRKKGAAA+
Sbjct  61   TGRMRYLRHLPRRFKSNFREGTQAAPRKKGAAAS  94



>ref|XP_002304203.1| ribosomal protein L37 [Populus trichocarpa]
 gb|ABK93758.1| unknown [Populus trichocarpa]
 gb|EEE79182.1| ribosomal protein L37 [Populus trichocarpa]
Length=95

 Score =   163 bits (413),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR  KYNWS KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRKYNWSEKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE T+A PRKKG AA++
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTQAEPRKKGTAASA  95



>ref|XP_009409055.1| PREDICTED: 60S ribosomal protein L37-3-like [Musa acuminata subsp. 
malaccensis]
Length=94

 Score =   163 bits (413),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YP++RI KYNWSVKAIRR TTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPSSRIRKYNWSVKAIRRNTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRFK NFRE T+A PRKK  AAA
Sbjct  61   TGRMRYLRHVPRRFKNNFREGTQAAPRKKSVAAA  94



>gb|KJB56584.1| hypothetical protein B456_009G134200 [Gossypium raimondii]
Length=95

 Score =   163 bits (413),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PRKK AAA++
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTEAAPRKKVAAASA  95



>ref|XP_006406883.1| hypothetical protein EUTSA_v10021833mg [Eutrema salsugineum]
 gb|ESQ48336.1| hypothetical protein EUTSA_v10021833mg [Eutrema salsugineum]
Length=95

 Score =   163 bits (413),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRNKTAASSA  95



>ref|XP_010538027.1| PREDICTED: 60S ribosomal protein L37-1 [Tarenaya hassleriana]
Length=95

 Score =   163 bits (412),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACA+PAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAFPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE T+ATPR K AA+++
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTQATPRNKAAASSA  95



>ref|XP_010521525.1| PREDICTED: 60S ribosomal protein L37-1-like [Tarenaya hassleriana]
Length=95

 Score =   163 bits (412),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACA+PAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAFPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE T+ATPR K A+A++
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTQATPRNKAASASA  95



>ref|XP_010500828.1| PREDICTED: 60S ribosomal protein L37-3-like [Camelina sativa]
 ref|XP_010462067.1| PREDICTED: 60S ribosomal protein L37-3-like [Camelina sativa]
 ref|XP_010479735.1| PREDICTED: 60S ribosomal protein L37-3-like [Camelina sativa]
Length=93

 Score =   163 bits (412),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMR+LR VPRRFKT FRE TEA PR K AAA
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRVKAAAA  93



>ref|NP_566535.1| 60S ribosomal protein L37-3 [Arabidopsis thaliana]
 sp|Q8LEM8.1|RL373_ARATH RecName: Full=60S ribosomal protein L37-3 [Arabidopsis thaliana]
 gb|AAM62574.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|ABF58989.1| At3g16080 [Arabidopsis thaliana]
 dbj|BAE98619.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75769.1| 60S ribosomal protein L37-3 [Arabidopsis thaliana]
Length=95

 Score =   163 bits (412),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR K +A+++
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRSKASASSA  95



>ref|XP_002284575.1| PREDICTED: 60S ribosomal protein L37-3-like [Vitis vinifera]
Length=95

 Score =   163 bits (412),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+AC +PAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACGFPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR V  RFK+NFRE T+A PRKKGAAA++
Sbjct  61   TGRMRYLRHVACRFKSNFREGTQAAPRKKGAAASA  95



>ref|XP_010098066.1| 60S ribosomal protein L37-3 [Morus notabilis]
 gb|EXB74503.1| 60S ribosomal protein L37-3 [Morus notabilis]
Length=121

 Score =   164 bits (414),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            +GKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACA+PAAR  KYNWSVKAIRRKTTG
Sbjct  27   LGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARKRKYNWSVKAIRRKTTG  86

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR +PRRFK+ FRE T+ATPR KGAAA +
Sbjct  87   TGRMRYLRHLPRRFKSGFREGTQATPRSKGAAATA  121



>gb|KHG18360.1| 60S ribosomal L37-1 -like protein [Gossypium arboreum]
Length=95

 Score =   162 bits (411),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YPA+RI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPASRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+L  +PR+FKT FRE T+ATPRKK A AAS
Sbjct  61   TGRMRYLCHLPRKFKTGFREGTQATPRKKAAVAAS  95



>emb|CDY52979.1| BnaA06g01640D [Brassica napus]
 emb|CDY37583.1| BnaA02g19870D [Brassica napus]
 emb|CDX97048.1| BnaC09g45770D [Brassica napus]
Length=138

 Score =   164 bits (415),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  11   AAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRK  190
            +A M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRK
Sbjct  41   SASMTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRK  100

Query  191  TTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TTGTGRMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  101  TTGTGRMRYLRNVPRRFKTGFREGTEAKPRNKAAASSA  138



>ref|XP_010545706.1| PREDICTED: 60S ribosomal protein L37-3 [Tarenaya hassleriana]
Length=94

 Score =   162 bits (411),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 85/94 (90%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACA+PAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAFPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRFKT FRE TEA PR K AA+A
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTEAKPRNKAAASA  94



>gb|KJB56586.1| hypothetical protein B456_009G134200, partial [Gossypium raimondii]
Length=126

 Score =   163 bits (413),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/94 (86%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  23   GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGT  202
            GKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR   YNWSVKAIRRKTTGT
Sbjct  33   GKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRTYNWSVKAIRRKTTGT  92

Query  203  GRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            GRMR+LR VPRRFKT FRE TEA PRKK AAA++
Sbjct  93   GRMRYLRHVPRRFKTGFREGTEAAPRKKVAAASA  126



>ref|XP_008680029.1| PREDICTED: 60S ribosomal protein L37-3 [Zea mays]
 gb|ACG31965.1| 60S ribosomal protein L37 [Zea mays]
 gb|ACG45152.1| 60S ribosomal protein L37 [Zea mays]
 gb|ACG47368.1| 60S ribosomal protein L37 [Zea mays]
 gb|ACG47945.1| 60S ribosomal protein L37 [Zea mays]
Length=94

 Score =   162 bits (410),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 1/95 (1%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR++R VPRRFK+NFRE TEA P KKG AAA+
Sbjct  61   TGRMRYMRHVPRRFKSNFREGTEAAP-KKGVAAAN  94



>ref|XP_010254121.1| PREDICTED: 60S ribosomal protein L37-1-like [Nelumbo nucifera]
Length=94

 Score =   162 bits (410),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKS C+AC +P++RI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCAACGFPSSRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR +PRRFK+NFRE T+A PRKKGAA++
Sbjct  61   TGRMRYLRHLPRRFKSNFREGTQAAPRKKGAASS  94



>ref|XP_006392937.1| hypothetical protein EUTSA_v10011894mg [Eutrema salsugineum]
 gb|ESQ30223.1| hypothetical protein EUTSA_v10011894mg [Eutrema salsugineum]
Length=95

 Score =   162 bits (410),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR K AA++S
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRNKAAASSS  95



>ref|XP_010535163.1| PREDICTED: 60S ribosomal protein L37-3 [Tarenaya hassleriana]
Length=95

 Score =   162 bits (410),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACA+PAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAFPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTEAKPRNKAAASSA  95



>emb|CDY70285.1| BnaCnng67600D, partial [Brassica napus]
Length=115

 Score =   163 bits (412),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = +2

Query  11   AAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRK  190
            +A M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRK
Sbjct  18   SASMTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRK  77

Query  191  TTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TTGTGRMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  78   TTGTGRMRYLRNVPRRFKTGFREGTEAKPRNKAAASSA  115



>dbj|BAJ94625.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=121

 Score =   163 bits (412),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 86/94 (91%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  26   MTKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  85

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR++R VPRRFK+NFRE TEA PR KGA+++
Sbjct  86   TGRMRYMRHVPRRFKSNFREGTEAAPRSKGASSS  119



>ref|XP_004150353.1| PREDICTED: 60S ribosomal protein L37-3-like [Cucumis sativus]
 ref|XP_004165117.1| PREDICTED: 60S ribosomal protein L37-3-like [Cucumis sativus]
 ref|XP_008447511.1| PREDICTED: 60S ribosomal protein L37-3 [Cucumis melo]
 gb|KGN58070.1| hypothetical protein Csa_3G483790 [Cucumis sativus]
Length=95

 Score =   162 bits (409),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PR KGA++++
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTEAAPRSKGASSSA  95



>ref|NP_175640.1| 60S ribosomal protein L37-2 [Arabidopsis thaliana]
 sp|Q43292.2|RL372_ARATH RecName: Full=60S ribosomal protein L37-2 [Arabidopsis thaliana]
 gb|AAG51542.1|AC037424_7 60S ribosomal protein L37, putative; 56921-57860 [Arabidopsis 
thaliana]
 gb|AAK44031.1|AF370216_1 putative 60S ribosomal protein L37 [Arabidopsis thaliana]
 gb|AAM44969.1| putative 60S ribosomal protein L37 [Arabidopsis thaliana]
 dbj|BAH19761.1| AT1G52300 [Arabidopsis thaliana]
 gb|AEE32779.1| 60S ribosomal protein L37-2 [Arabidopsis thaliana]
Length=95

 Score =   162 bits (409),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR KG A+++
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRNKGVASSA  95



>ref|XP_010539494.1| PREDICTED: 60S ribosomal protein L37-3-like [Tarenaya hassleriana]
Length=95

 Score =   161 bits (408),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACA+PAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAFPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE T+ATPR K  +A++
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTQATPRSKAVSASA  95



>ref|XP_007140019.1| hypothetical protein PHAVU_008G077400g [Phaseolus vulgaris]
 gb|ESW12013.1| hypothetical protein PHAVU_008G077400g [Phaseolus vulgaris]
Length=95

 Score =   161 bits (408),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCG RSFH+QKSRCSACA+PAAR  KYNWS KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGHRSFHLQKSRCSACAFPAARTRKYNWSAKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMR+LR VPRRFK+ FRE TEA PRK+GAA+
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTEAAPRKRGAAS  93



>gb|KJB13168.1| hypothetical protein B456_002G060000 [Gossypium raimondii]
Length=95

 Score =   161 bits (408),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PRKK A A++
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTEAAPRKKVATASA  95



>gb|KFK38960.1| hypothetical protein AALP_AA3G182300 [Arabis alpina]
Length=95

 Score =   161 bits (408),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRSYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRNKAAASSA  95



>gb|KFK35793.1| hypothetical protein AALP_AA4G037100 [Arabis alpina]
Length=95

 Score =   161 bits (408),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRSYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRNKSAASSA  95



>ref|XP_009400928.1| PREDICTED: 60S ribosomal protein L37-1-like [Musa acuminata subsp. 
malaccensis]
Length=95

 Score =   161 bits (407),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKSRC +C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCLRCGRRSFHLQKSRCGSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAA  295
            TGRMR+LR VPRRFK+NFRE T+AT RKK A+
Sbjct  61   TGRMRYLRHVPRRFKSNFREGTQATSRKKAAS  92



>ref|XP_009144855.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica rapa]
 ref|XP_009147697.1| PREDICTED: 60S ribosomal protein L37-2 [Brassica rapa]
Length=95

 Score =   161 bits (407),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRNKAAASSA  95



>gb|KHG29419.1| 60S ribosomal L37-3 -like protein [Gossypium arboreum]
Length=115

 Score =   162 bits (409),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 4/101 (4%)
 Frame = +2

Query  2    FASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAI  181
            F ++A MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAA    +NWSVKAI
Sbjct  19   FPASAPMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAA----HNWSVKAI  74

Query  182  RRKTTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            RRKTTGTGRMR+LR VPRRFKT FRE TEA PRKK AAA++
Sbjct  75   RRKTTGTGRMRYLRHVPRRFKTGFREGTEAAPRKKVAAASA  115



>emb|CDX75869.1| BnaC03g39520D [Brassica napus]
Length=159

 Score =   163 bits (412),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTGTG
Sbjct  66   KGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTG  125

Query  206  RMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            RMR+L++VPRRFKT FRE TEA PR K AAA+S
Sbjct  126  RMRYLKSVPRRFKTGFREGTEAKPRNKAAAASS  158



>emb|CDY02545.1| BnaA08g01520D [Brassica napus]
Length=102

 Score =   160 bits (406),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTGTG
Sbjct  10   KGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTG  69

Query  206  RMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            RMR+LR VPRRFKT FRE TEA PR K AA++S
Sbjct  70   RMRYLRNVPRRFKTGFREGTEAKPRNKSAASSS  102



>ref|XP_007024165.1| Zinc-binding ribosomal protein family protein [Theobroma cacao]
 gb|EOY26787.1| Zinc-binding ribosomal protein family protein [Theobroma cacao]
Length=95

 Score =   160 bits (406),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+AC +PAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACGFPAARKRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE T+A PRKK AAA++
Sbjct  61   TGRMRYLRHVPRRFKSGFREGTQAAPRKKVAAASA  95



>ref|XP_010542243.1| PREDICTED: 60S ribosomal protein L37-3-like [Tarenaya hassleriana]
Length=95

 Score =   160 bits (405),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACA+PAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAFPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR K A +++
Sbjct  61   TGRMRYLRHVPRRFKTGFREGTEAKPRNKSATSSA  95



>emb|CDY45631.1| BnaA05g14980D [Brassica napus]
Length=114

 Score =   161 bits (407),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTGTG
Sbjct  22   KGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTG  81

Query  206  RMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            RMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  82   RMRYLRNVPRRFKTGFREGTEAKPRNKAAASSA  114



>ref|XP_008801255.1| PREDICTED: 60S ribosomal protein L37-1-like [Phoenix dactylifera]
Length=96

 Score =   160 bits (405),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKSRC++C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSRCASCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGRMR+LR +PRRFK+NFRE T+ATPR++
Sbjct  61   TGRMRYLRHLPRRFKSNFREGTQATPRRQ  89



>emb|CDX87897.1| BnaC06g09590D [Brassica napus]
Length=232

 Score =   164 bits (416),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
            A M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKT
Sbjct  136  AAMTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKT  195

Query  194  TGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGTGRMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  196  TGTGRMRYLRNVPRRFKTGFREGTEAKPRNKAAASSA  232



>ref|XP_009135475.1| PREDICTED: 60S ribosomal protein L37-2-like [Brassica rapa]
Length=95

 Score =   160 bits (404),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+L+ VPRRFKT FRE TEA PR K A+A++
Sbjct  61   TGRMRYLKNVPRRFKTGFREGTEAKPRNKAASASA  95



>ref|XP_004291214.1| PREDICTED: 60S ribosomal protein L37-3-like [Fragaria vesca subsp. 
vesca]
Length=94

 Score =   159 bits (403),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWS KA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARLRKYNWSEKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR VPRRFK+ F E T+A PR KG A A
Sbjct  61   TGRMRYLRHVPRRFKSGFLEGTQAKPRSKGTATA  94



>gb|ACG38067.1| 60S ribosomal protein L37 [Zea mays]
Length=99

 Score =   159 bits (403),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 85/94 (90%), Gaps = 1/94 (1%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR++R VPRRFK+NFRE TEA P KKG A +
Sbjct  61   TGRMRYMRHVPRRFKSNFREGTEAAP-KKGVAGS  93



>ref|XP_009107138.1| PREDICTED: 60S ribosomal protein L37-2-like [Brassica rapa]
Length=95

 Score =   159 bits (402),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 84/95 (88%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACA PAAR   YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACASPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFKT FRE TEA PR K AA++S
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTEAKPRNKAAASSS  95



>emb|CDY70030.1| BnaCnng66410D [Brassica napus]
Length=112

 Score =   159 bits (403),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTGTG
Sbjct  20   KGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTG  79

Query  206  RMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            RMR+LR VPRRFKT FRE TEA PR K AA+++
Sbjct  80   RMRYLRNVPRRFKTGFREGTEAKPRNKAAASSA  112



>ref|XP_010934237.1| PREDICTED: 60S ribosomal protein L37-1 [Elaeis guineensis]
Length=96

 Score =   159 bits (401),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC++C YP+ARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCASCGYPSARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGRMR+LR +PRRFK+NFRE T+ATPR +
Sbjct  61   TGRMRYLRHLPRRFKSNFREGTQATPRNR  89



>ref|XP_011089195.1| PREDICTED: 60S ribosomal protein L37-1-like [Sesamum indicum]
Length=97

 Score =   158 bits (399),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 86/96 (90%), Gaps = 1/96 (1%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRC+ACAYPAAR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCAACAYPAARTRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPR-KKGAAAAS  304
            TGRMR+LR V  RFK+ FRE T A PR KKGAAAAS
Sbjct  61   TGRMRYLRHVAVRFKSCFREGTIANPRKKKGAAAAS  96



>ref|XP_010033871.1| PREDICTED: 60S ribosomal protein L37-3 [Eucalyptus grandis]
 gb|KCW53718.1| hypothetical protein EUGRSUZ_J02975 [Eucalyptus grandis]
Length=95

 Score =   157 bits (398),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC +P+AR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGFPSARKRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMR+LR VPRRFK+ FRE TEA PRK   AA +
Sbjct  61   TGRMRYLRNVPRRFKSGFREGTEAAPRKHAGAATA  95



>emb|CDP16151.1| unnamed protein product [Coffea canephora]
Length=112

 Score =   158 bits (399),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = +2

Query  17   QMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTT  196
             MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC++C YPAAR+ KYNWS+KAIRRKTT
Sbjct  16   SMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCASCGYPAARLRKYNWSIKAIRRKTT  75

Query  197  GTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            GTGRMR+LR V  RFK+NFRE T A PRKK AA A+
Sbjct  76   GTGRMRYLRHVAVRFKSNFREGTVAAPRKKVAADAA  111



>ref|XP_001756851.1| predicted protein [Physcomitrella patens]
 gb|EDQ78448.1| predicted protein [Physcomitrella patens]
Length=93

 Score =   157 bits (397),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLC RCGRRSFHIQKSRCSACAYPAAR+  YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCRRCGRRSFHIQKSRCSACAYPAARVRSYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHLR +PRRF  NFRE  +A PRK+ AAA
Sbjct  61   TGRMRHLRHLPRRFSNNFREGAQAAPRKQVAAA  93



>emb|CDX82413.1| BnaA03g34080D [Brassica napus]
Length=225

 Score =   161 bits (408),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTGTG
Sbjct  135  KGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTG  194

Query  206  RMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            RMR+L+ VPRRFKT FRE TEA PR K A+A
Sbjct  195  RMRYLKNVPRRFKTGFREGTEAKPRNKAASA  225



>ref|XP_001766230.1| predicted protein [Physcomitrella patens]
 gb|EDQ68862.1| predicted protein [Physcomitrella patens]
Length=93

 Score =   157 bits (397),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLC RCGRRSFHIQKSRCSACAYPAAR+  YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCRRCGRRSFHIQKSRCSACAYPAARVRSYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAA  295
            TGRMRHLR +PRRF  NFRE T+A PRK+ AA
Sbjct  61   TGRMRHLRHLPRRFSNNFREGTQAAPRKQVAA  92



>gb|KJB39125.1| hypothetical protein B456_007G172900 [Gossypium raimondii]
Length=99

 Score =   157 bits (396),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +2

Query  23   GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGT  202
            GKG GSFGKRRNKTHTLCVRCGRRSFH QKSRC ACA+PAAR   YNWSVKAIRRKTTGT
Sbjct  6    GKGIGSFGKRRNKTHTLCVRCGRRSFHFQKSRCFACAFPAARKRTYNWSVKAIRRKTTGT  65

Query  203  GRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            GRMRHLR VPRRFKT FRE TEA PRKK  AA++
Sbjct  66   GRMRHLRHVPRRFKTGFREGTEAAPRKKVVAASA  99



>ref|XP_009115011.1| PREDICTED: 60S ribosomal protein L37-2-like [Brassica rapa]
Length=98

 Score =   156 bits (394),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKG  289
            TGRMR+L+ VPRRFKT FRE TEA PR KG
Sbjct  61   TGRMRYLKNVPRRFKTCFREGTEAKPRNKG  90



>ref|XP_003572148.1| PREDICTED: 60S ribosomal protein L37-2-like [Brachypodium distachyon]
Length=93

 Score =   155 bits (393),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAA  295
            TGRMR++R VPRRFK+NFRE T A P+K  AA
Sbjct  61   TGRMRYMRNVPRRFKSNFREGTAAAPKKSTAA  92



>ref|XP_001772611.1| predicted protein [Physcomitrella patens]
 gb|EDQ62653.1| predicted protein [Physcomitrella patens]
Length=93

 Score =   154 bits (390),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLC RCGRRSFHIQKSRCSACAYPAAR+  YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCRRCGRRSFHIQKSRCSACAYPAARVRSYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHLR +PRRF  NFRE T+A P+K  A++
Sbjct  61   TGRMRHLRHLPRRFSNNFREGTQAAPKKAPASS  93



>ref|XP_011001601.1| PREDICTED: 60S ribosomal protein L37-3-like [Populus euphratica]
Length=98

 Score =   154 bits (389),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 86/98 (88%), Gaps = 3/98 (3%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHI---QKSRCSACAYPAARITKYNWSVKAIRRK  190
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+   QKSRCSACA+PAAR  KYNWS KAIRRK
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLFHLQKSRCSACAFPAARKRKYNWSEKAIRRK  60

Query  191  TTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TTGTGRMR+LR VP RFK+ FRE T+A PRKKG AA++
Sbjct  61   TTGTGRMRYLRNVPCRFKSGFREGTQAEPRKKGTAASA  98



>ref|XP_001785497.1| predicted protein [Physcomitrella patens]
 gb|EDQ49704.1| predicted protein [Physcomitrella patens]
Length=93

 Score =   154 bits (388),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNK+HTLC RCGRRSFHIQKSRCSACAYPAAR+  YNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKSHTLCRRCGRRSFHIQKSRCSACAYPAARVRSYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHLR +PRRF  NFRE T+A P+K  A +
Sbjct  61   TGRMRHLRHLPRRFSNNFREGTQAAPKKTVATS  93



>ref|XP_009785166.1| PREDICTED: 60S ribosomal protein L37-3-like [Nicotiana sylvestris]
Length=95

 Score =   153 bits (387),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR+ KYNWS KA+RRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARLRKYNWSEKALRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTE  268
            TGRMR+LR VPRRFKT FRE TE
Sbjct  61   TGRMRYLRNVPRRFKTGFREGTE  83



>ref|XP_010910777.1| PREDICTED: 60S ribosomal protein L37-3 [Elaeis guineensis]
Length=97

 Score =   152 bits (385),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+AC YP+ARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACGYPSARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTE  268
            TGRMR+LR VPRRFK+NFRE T+
Sbjct  61   TGRMRYLRHVPRRFKSNFREGTQ  83



>gb|KJB56587.1| hypothetical protein B456_009G134200, partial [Gossypium raimondii]
Length=147

 Score =   154 bits (388),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  2    FASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAI  181
            F ++A MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR   YNWSVKAI
Sbjct  18   FPASAPMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRTYNWSVKAI  77

Query  182  RRKTTGTGRMRHLRTVPRRFKTNFRERTE  268
            RRKTTGTGRMR+LR VPRRFKT FRE  E
Sbjct  78   RRKTTGTGRMRYLRHVPRRFKTGFREGNE  106



>ref|XP_011072354.1| PREDICTED: 60S ribosomal protein L37-3 [Sesamum indicum]
Length=95

 Score =   152 bits (383),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTE  268
            TGRMR+LR VPRRFKTNFRE T+
Sbjct  61   TGRMRYLRHVPRRFKTNFREGTQ  83



>ref|XP_011080793.1| PREDICTED: 60S ribosomal protein L37-3 [Sesamum indicum]
Length=95

 Score =   151 bits (382),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACAYPAAR   YNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTE  268
            TGRMR+LR VPRRFKTNFRE T+
Sbjct  61   TGRMRYLRHVPRRFKTNFREGTQ  83



>gb|ACG30774.1| 60S ribosomal protein L37 [Zea mays]
Length=94

 Score =   151 bits (382),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTE  268
            TGRMR++R VPRRFK+NFRE TE
Sbjct  61   TGRMRYMRHVPRRFKSNFREGTE  83



>ref|NP_001278489.1| 60S ribosomal protein L37 [Zea mays]
 ref|XP_002451369.1| hypothetical protein SORBIDRAFT_04g000910 [Sorghum bicolor]
 gb|ACG23967.1| 60S ribosomal protein L37 [Zea mays]
 gb|ACG24100.1| 60S ribosomal protein L37 [Zea mays]
 gb|ACG29489.1| 60S ribosomal protein L37 [Zea mays]
 gb|ACG30839.1| 60S ribosomal protein L37 [Zea mays]
 gb|ACG42537.1| 60S ribosomal protein L37 [Zea mays]
 gb|EES04345.1| hypothetical protein SORBIDRAFT_04g000910 [Sorghum bicolor]
 gb|AFW69770.1| ribosomal protein L37 [Zea mays]
 tpg|DAA45684.1| TPA: ribosomal protein L37 isoform 1 [Zea mays]
 tpg|DAA45685.1| TPA: ribosomal protein L37 isoform 2 [Zea mays]
Length=94

 Score =   151 bits (381),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTE  268
            TGRMR++R VPRRFK+NFRE TE
Sbjct  61   TGRMRYMRHVPRRFKSNFREGTE  83



>ref|XP_002465171.1| hypothetical protein SORBIDRAFT_01g033340 [Sorghum bicolor]
 gb|EER92169.1| hypothetical protein SORBIDRAFT_01g033340 [Sorghum bicolor]
Length=94

 Score =   150 bits (380),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWS+KAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSIKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTE  268
            TGRMR++R VPRRFK+NFRE TE
Sbjct  61   TGRMRYMRHVPRRFKSNFREGTE  83



>gb|EPS74476.1| hypothetical protein M569_00287, partial [Genlisea aurea]
Length=94

 Score =   150 bits (378),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/82 (90%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  23   GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGT  202
            GKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACAYPAAR   YNWSVKAIRRKTTGT
Sbjct  1    GKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARKRTYNWSVKAIRRKTTGT  60

Query  203  GRMRHLRTVPRRFKTNFRERTE  268
            GRMR+LR VPRRFKTNFRE T+
Sbjct  61   GRMRYLRHVPRRFKTNFREGTQ  82



>dbj|BAJ92534.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=93

 Score =   148 bits (373),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MTKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTE  268
            TGRMR++R VPRRFK+NFRE TE
Sbjct  61   TGRMRYMRHVPRRFKSNFREGTE  83



>ref|XP_009397445.1| PREDICTED: 60S ribosomal protein L37-1-like [Musa acuminata subsp. 
malaccensis]
Length=94

 Score =   147 bits (372),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YP++RI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPSSRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTE  268
            TGRMR+LR VPRRFK+NF E T+
Sbjct  61   TGRMRYLRHVPRRFKSNFCEGTQ  83



>ref|XP_007202799.1| hypothetical protein PRUPE_ppa013845mg [Prunus persica]
 gb|EMJ03998.1| hypothetical protein PRUPE_ppa013845mg [Prunus persica]
Length=100

 Score =   147 bits (372),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLCVRCGRRSFH+QKSRC++C +P++RI KYNWSVKAIRRKTTG
Sbjct  1    MSKGTASFGKRRNKTHTLCVRCGRRSFHLQKSRCASCGFPSSRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGRMR+LR V  RFK NFRE TEA PRKK
Sbjct  61   TGRMRYLRHVAVRFKFNFREGTEAGPRKK  89



>tpg|DAA45686.1| TPA: hypothetical protein ZEAMMB73_173562, partial [Zea mays]
Length=147

 Score =   149 bits (376),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  23   GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGT  202
            GKGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTGT
Sbjct  55   GKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTGT  114

Query  203  GRMRHLRTVPRRFKTNFRERTE  268
            GRMR++R VPRRFK+NFRE TE
Sbjct  115  GRMRYMRHVPRRFKSNFREGTE  136



>ref|XP_008645154.1| PREDICTED: 60S ribosomal protein L37-3-like [Zea mays]
 gb|ACG47944.1| 60S ribosomal protein L37 [Zea mays]
Length=110

 Score =   147 bits (372),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTGTG
Sbjct  19   KGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTGTG  78

Query  206  RMRHLRTVPRRFKTNFRERTE  268
            RMR++R VPRRFK+NFRE TE
Sbjct  79   RMRYMRHVPRRFKSNFREGTE  99



>ref|XP_001777517.1| predicted protein [Physcomitrella patens]
 gb|EDQ57692.1| predicted protein, partial [Physcomitrella patens]
Length=84

 Score =   145 bits (366),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGTGSFGKRRNK+HTLC RCGRRSFHIQKSRCSACAYPAAR+  YNWSVKAIRRKTTGTG
Sbjct  3    KGTGSFGKRRNKSHTLCRRCGRRSFHIQKSRCSACAYPAARVRSYNWSVKAIRRKTTGTG  62

Query  206  RMRHLRTVPRRFKTNFRERTEA  271
            RMRHLR +PRRF  NFRE T A
Sbjct  63   RMRHLRHLPRRFSNNFREGTSA  84



>gb|KCW69608.1| hypothetical protein EUGRSUZ_F03027 [Eucalyptus grandis]
Length=128

 Score =   146 bits (368),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  5    ASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIR  184
            +  A MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC +P+AR  KYNWSVKAIR
Sbjct  29   SPPASMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGFPSARKRKYNWSVKAIR  88

Query  185  RKTTGTGRMRHLRTVPRRFKTNFRERTE  268
            RKTTGTGRM++LR +PRRFK+ FRE T+
Sbjct  89   RKTTGTGRMKYLRHLPRRFKSGFREGTQ  116



>ref|XP_008242650.1| PREDICTED: 60S ribosomal protein L37-3-like [Prunus mume]
Length=125

 Score =   146 bits (368),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLCVRCG RSFH+QKSRC++C +P++RI KYNWSVKAIRRKTTG
Sbjct  1    MSKGTASFGKRRNKTHTLCVRCGHRSFHLQKSRCASCGFPSSRIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGA  292
            TGRMR+LR V  RFK NFRE TEA PR+K A
Sbjct  61   TGRMRYLRHVAVRFKFNFREGTEAGPRRKRA  91



>ref|XP_005648609.1| ribosomal protein L37 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
 gb|EIE24065.1| ribosomal protein L37 component of cytosolic 80S ribosome and 
60S large subunit [Coccomyxa subellipsoidea C-169]
Length=94

 Score =   145 bits (365),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
             + GKGTGSFGKR NKTHTLC RCGRRSFHIQKSRCS+CAYPAARI KYNWS KAIRRKT
Sbjct  2    GKAGKGTGSFGKRHNKTHTLCRRCGRRSFHIQKSRCSSCAYPAARIRKYNWSQKAIRRKT  61

Query  194  TGTGRMRHLRTVPRRFKTNFRERTEATPR  280
            TGTGRMRHL+ V ++FK  FRE T+ TPR
Sbjct  62   TGTGRMRHLKVVLQKFKNGFREGTQPTPR  90



>ref|XP_009381841.1| PREDICTED: 60S ribosomal protein L37-3-like [Musa acuminata subsp. 
malaccensis]
Length=102

 Score =   145 bits (365),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  2    FASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAI  181
             +    MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC YP++RI KYNWSVKAI
Sbjct  15   LSRVPSMGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGYPSSRIRKYNWSVKAI  74

Query  182  RRKTTGTGRMRHLRTVPRRFKTNFRE  259
            RRKTTGTGRMR+LR V RRFK++FRE
Sbjct  75   RRKTTGTGRMRYLRHVARRFKSSFRE  100



>ref|XP_010062467.1| PREDICTED: 60S ribosomal protein L37-3 [Eucalyptus grandis]
Length=95

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC AC +P+AR  KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCGACGFPSARKRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTE  268
            TGRM++LR +PRRFK+ FRE T+
Sbjct  61   TGRMKYLRHLPRRFKSGFREGTQ  83



>gb|EMT05334.1| 60S ribosomal protein L37-2 [Aegilops tauschii]
Length=126

 Score =   144 bits (362),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGTGSFGKRRNKTHTLC+RCGRRSFH+QKS C +C YPAARI KYNWSVKAIRRKTTGTG
Sbjct  36   KGTGSFGKRRNKTHTLCIRCGRRSFHLQKSPCPSCGYPAARIRKYNWSVKAIRRKTTGTG  95

Query  206  RMRHLRTVPRRFKTNFRERTE  268
            RMR++R VPRRFK+NFRE TE
Sbjct  96   RMRYMRHVPRRFKSNFREGTE  116



>ref|XP_002964514.1| hypothetical protein SELMODRAFT_81515, partial [Selaginella moellendorffii]
 ref|XP_002992013.1| hypothetical protein SELMODRAFT_134686, partial [Selaginella 
moellendorffii]
 gb|EFJ06862.1| hypothetical protein SELMODRAFT_134686, partial [Selaginella 
moellendorffii]
 gb|EFJ34847.1| hypothetical protein SELMODRAFT_81515, partial [Selaginella moellendorffii]
Length=97

 Score =   141 bits (356),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
             GKGTGSFGKRRNK+HTLC RCGRRSFHIQK+RC+ACAYPA RI KYNWS KAIRRKTTG
Sbjct  1    QGKGTGSFGKRRNKSHTLCRRCGRRSFHIQKARCAACAYPAKRIRKYNWSEKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERT  265
            TGRMR+LR +PRRFK+NFRE T
Sbjct  61   TGRMRYLRHLPRRFKSNFREGT  82



>gb|ACG34589.1| 60S ribosomal protein L37 [Zea mays]
Length=85

 Score =   139 bits (350),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 72/76 (95%), Gaps = 0/76 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            MGKGTGSFGKRRNKTHTLC+RCGRRSFH+QKS CS+C YPAARI KYNWSVKAIRRKTTG
Sbjct  1    MGKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKT  247
            TGRMR++R VPRRFK+
Sbjct  61   TGRMRYMRHVPRRFKS  76



>ref|XP_010047730.1| PREDICTED: 60S ribosomal protein L37-2-like [Eucalyptus grandis]
Length=100

 Score =   139 bits (349),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLCVRCG RSFH+QKSRC++C +PA R+ +YNWS KA R +TTG
Sbjct  1    MTKGTASFGKRRNKTHTLCVRCGHRSFHLQKSRCASCGFPARRMRRYNWSEKAKRWRTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR V  RFKTNFRE  EA PR+KG AA+
Sbjct  61   TGRMRYLRYVAIRFKTNFREGIEAAPRRKGIAAS  94



>gb|KJB09390.1| hypothetical protein B456_001G1385002, partial [Gossypium raimondii]
Length=93

 Score =   137 bits (346),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +2

Query  23   GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGT  202
            GKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRCSACA+PAAR   YNWSVKAIRRKT GT
Sbjct  1    GKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRTYNWSVKAIRRKTIGT  60

Query  203  GRMRHLRTVPRRFKTNFRE--RTEATPRK  283
            GRMR+LR VP RFK  FRE   +  TP K
Sbjct  61   GRMRYLRHVPCRFKMGFREDDHSHDTPAK  89



>ref|XP_003080511.1| ribosomal protein L37 (ISS) [Ostreococcus tauri]
 emb|CAL54678.1| Ribosomal protein L37e [Ostreococcus tauri]
Length=91

 Score =   137 bits (344),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
             + GKGTGSFG RRNK+HTLC RCG+RS+HIQKS C++C YP+AR+ KYNWSVKAI RKT
Sbjct  2    GKKGKGTGSFGSRRNKSHTLCRRCGKRSYHIQKSTCASCGYPSARVRKYNWSVKAIGRKT  61

Query  194  TGTGRMRHLRTVPRRFKTNFRERTEATPR  280
            TGTGRMR+L+T+PRRFK  FRE T AT +
Sbjct  62   TGTGRMRYLKTLPRRFKNGFREGTAATKK  90



>ref|XP_001418774.1| Ribosomal protein L37, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97067.1| Ribosomal protein L37, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=93

 Score =   135 bits (340),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
             + GKGTGSFG RRNK+HTLC RCG+RS+HIQKS C+AC YP+AR   YNWSVKAI RKT
Sbjct  2    GKKGKGTGSFGSRRNKSHTLCRRCGKRSYHIQKSTCAACGYPSARTRSYNWSVKAIGRKT  61

Query  194  TGTGRMRHLRTVPRRFKTNFRERTEA  271
            TGTGRMR+L+T+PRRFK  FRE TEA
Sbjct  62   TGTGRMRYLKTLPRRFKNGFREGTEA  87



>ref|XP_002499547.1| ribosomal protein L37e [Micromonas sp. RCC299]
 gb|ACO60805.1| ribosomal protein L37e [Micromonas sp. RCC299]
Length=96

 Score =   135 bits (339),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
             ++GKGTGSFGKR NK+HTLC RCGRRS+HIQKS C AC YP+AR   YNWSVKAI R+T
Sbjct  2    GKIGKGTGSFGKRHNKSHTLCRRCGRRSYHIQKSTCGACGYPSARKRNYNWSVKAIGRRT  61

Query  194  TGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAA  295
            TGTGRMR+L+ +PRRFK  FRE T+A  +K+ A+
Sbjct  62   TGTGRMRYLKHLPRRFKNGFREGTQAVSKKRAAS  95



>gb|KFM65885.1| putative 60S ribosomal protein L37-A, partial [Stegodyphus mimosarum]
Length=101

 Score =   132 bits (333),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS C+ C YP  R+  YNWSVK  RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSLCAQCGYPHKRLRHYNWSVKGKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS*ISF  316
            TGR+RHLR V RRF+  FRE  +A P+K+GAAA++  S 
Sbjct  61   TGRLRHLRKVWRRFRHGFREGGQAKPQKQGAAASTTASL  99



>gb|ABX75388.1| 60S ribosomal protein L37A [Lycosa singoriensis]
Length=101

 Score =   132 bits (333),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS C+ C YP  R+  YNWSVK  RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSLCAQCGYPHKRLRHYNWSVKGKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGR+RHLR V RRF+  FRE  +A P+K G AAAS
Sbjct  61   TGRLRHLRKVWRRFRHGFREGGQAKPQKHGVAAAS  95



>ref|XP_007513881.1| 60S ribosomal protein L37 [Bathycoccus prasinos]
 emb|CCO16406.1| 60S ribosomal protein L37 [Bathycoccus prasinos]
Length=93

 Score =   132 bits (332),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
             + GKGTGSFGKR+NK+HTLC RCGRRS+HIQKS CS+C YPAA+   YNWSVKA  R T
Sbjct  2    GKKGKGTGSFGKRKNKSHTLCRRCGRRSYHIQKSTCSSCGYPAAKTRGYNWSVKAKGRST  61

Query  194  TGTGRMRHLRTVPRRFKTNFRERTEATPR  280
            TGTGRMR+++++PRRFK  FRE TEAT +
Sbjct  62   TGTGRMRYIKSLPRRFKNGFREGTEATKK  90



>ref|XP_002067427.1| GK16414 [Drosophila willistoni]
 gb|EDW78413.1| GK16414 [Drosophila willistoni]
Length=94

 Score =   132 bits (332),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHL+ V RRF+  FRE T+A PRK   A+
Sbjct  61   TGRMRHLKVVRRRFRNGFREGTQAKPRKTTQAS  93



>ref|XP_008344788.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L37-3-like, 
partial [Malus domestica]
Length=103

 Score =   131 bits (330),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +2

Query  17   QMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTT  196
            + GKGTGSF K RNKTHTLC RCG RSF +QKSRCSACAYPAAR+  YN S KA+  KTT
Sbjct  1    KWGKGTGSFRKSRNKTHTLCERCGHRSFQLQKSRCSACAYPAARLRTYNCSEKALCXKTT  60

Query  197  GTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            GTG +R++R VPRRFK+ F   T+A PR KGAAAAS
Sbjct  61   GTGWIRYMRNVPRRFKSGFLXNTQAAPRSKGAAAAS  96



>ref|XP_009374074.1| PREDICTED: 60S ribosomal protein L37-3-like [Pyrus x bretschneideri]
Length=98

 Score =   130 bits (328),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLCVRCGRR FH+QKSRC++C +P++R  K NW  KAIRRKTTG
Sbjct  1    MSKGTASFGKRRNKTHTLCVRCGRRGFHLQKSRCASCGFPSSRKKKKNWGEKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TG MR++R    RFK NFRE TEA P KK A+ +S
Sbjct  61   TGGMRYIRHFAVRFKFNFREGTEAAPIKKRASVSS  95



>ref|XP_009828152.1| 60S ribosomal protein L37 [Aphanomyces astaci]
 gb|ETV82483.1| 60S ribosomal protein L37 [Aphanomyces astaci]
Length=92

 Score =   130 bits (328),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT S+GKR NKTHT+C RCG+ S+HIQKS C +C YPAA++ KYNWSVKA+RR+TTG
Sbjct  1    MTKGTSSYGKRHNKTHTICRRCGKSSYHIQKSTCGSCGYPAAKLRKYNWSVKALRRRTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRMR+L+TVPR+FK  FRE ++A  +K
Sbjct  61   TGRMRYLKTVPRKFKNGFREGSQAVSKK  88



>ref|XP_005177543.1| PREDICTED: probable 60S ribosomal protein L37-A [Musca domestica]
Length=93

 Score =   130 bits (326),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++  YNWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSIKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRMRHL+ V RRF+  FRE T+A P+K
Sbjct  61   TGRMRHLKVVRRRFRNGFREGTQAKPKK  88



>gb|ABW23234.1| ribosomal protein rpl37 [Eurythoe complanata]
Length=102

 Score =   130 bits (326),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHT+C RCGR ++HIQK  C+ C YP+ RI KYNWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTICRRCGRSAYHIQKKTCARCGYPSQRIRKYNWSIKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMRH+++V RRF+  FRE T   P++KGAAAA
Sbjct  61   TGRMRHMKSVFRRFRNGFREGTVPKPKRKGAAAA  94



>ref|XP_001978118.1| GG19417 [Drosophila erecta]
 ref|XP_002043812.1| GM12004 [Drosophila sechellia]
 ref|XP_002100633.1| GE16068 [Drosophila yakuba]
 gb|EDV47045.1| GG19417 [Drosophila erecta]
 gb|EDW51081.1| GM12004 [Drosophila sechellia]
 gb|EDX01741.1| GE16068 [Drosophila yakuba]
Length=94

 Score =   130 bits (326),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRM+HL+ V RRF+  FRE T+A P+K
Sbjct  61   TGRMQHLKVVRRRFRNGFREGTQAKPKK  88



>ref|XP_001963823.1| GF21054 [Drosophila ananassae]
 gb|EDV34272.1| GF21054 [Drosophila ananassae]
Length=105

 Score =   130 bits (326),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++  YNWSVKA RRKTTGTG
Sbjct  14   KGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTG  73

Query  206  RMRHLRTVPRRFKTNFRERTEATPRK  283
            RMRHL+ V RRF+  FRE T+A PRK
Sbjct  74   RMRHLKVVRRRFRNGFREGTQAKPRK  99



>ref|NP_573005.1| ribosomal protein L37a, isoform A [Drosophila melanogaster]
 ref|NP_001259561.1| ribosomal protein L37a, isoform B [Drosophila melanogaster]
 sp|Q9VXX8.1|RL371_DROME RecName: Full=Probable 60S ribosomal protein L37-A [Drosophila 
melanogaster]
 pdb|3J39|JJ Chain j, Structure Of The D. Melanogaster 60s Ribosomal Proteins
 gb|AAF48428.1| ribosomal protein L37a, isoform A [Drosophila melanogaster]
 gb|ABV82427.1| TA01551p [Drosophila melanogaster]
 gb|AGB95403.1| ribosomal protein L37a, isoform B [Drosophila melanogaster]
Length=93

 Score =   129 bits (325),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAA  295
            TGRM+HL+ V RRF+  FRE T+A P+K  A+
Sbjct  61   TGRMQHLKVVRRRFRNGFREGTQAKPKKAVAS  92



>gb|ACO12718.1| Probable 60S ribosomal protein L37-A [Lepeophtheirus salmonis]
Length=90

 Score =   129 bits (324),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQK  CS+C YP+A+I KYNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRVSYHIQKKACSSCGYPSAQIRKYNWSVKARRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGRMR+L+ V R+F+  FRE T A P+KK
Sbjct  61   TGRMRYLKVVRRKFRNGFREGTVALPQKK  89



>gb|ADD24054.1| Probable 60S ribosomal protein L37-A [Lepeophtheirus salmonis]
 gb|ADD37969.1| Probable 60S ribosomal protein L37-A [Lepeophtheirus salmonis]
Length=90

 Score =   129 bits (324),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQK  CS+C YP+A+I KYNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRVSYHIQKKTCSSCGYPSAQIRKYNWSVKARRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGRMR+L+ V R+F+  FRE T A P+KK
Sbjct  61   TGRMRYLKVVRRKFRNGFREGTVALPQKK  89



>gb|AAR09756.1| similar to Drosophila melanogaster CG9091, partial [Drosophila 
yakuba]
 gb|AAR10042.1| similar to Drosophila melanogaster CG9091, partial [Drosophila 
yakuba]
Length=89

 Score =   129 bits (324),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRM+HL+ V RRF+  FRE T+A P+K
Sbjct  61   TGRMQHLKVVRRRFRNGFREGTQAKPKK  88



>ref|XP_008614900.1| 60S ribosomal protein L37-A [Saprolegnia diclina VS20]
 gb|EQC31501.1| 60S ribosomal protein L37-A [Saprolegnia diclina VS20]
 gb|KDO25957.1| 60S ribosomal protein L37-A [Saprolegnia parasitica CBS 223.65]
Length=92

 Score =   129 bits (323),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT S+GKR NKTHT+C RCG+ S+HIQKS C +C YPAA++ KYNWS KA+RR+TTG
Sbjct  1    MTKGTSSYGKRHNKTHTICRRCGKSSYHIQKSTCGSCGYPAAKMRKYNWSAKALRRRTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRMR+L+TVPR+FK  FRE T+A  +K
Sbjct  61   TGRMRYLKTVPRKFKNGFREGTKAVSKK  88



>ref|XP_002606048.1| hypothetical protein BRAFLDRAFT_269803 [Branchiostoma floridae]
 gb|EEN62058.1| hypothetical protein BRAFLDRAFT_269803 [Branchiostoma floridae]
Length=99

 Score =   128 bits (322),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR  KTH+LC RCG+ S+HIQK RC+ C YP+ ++  YNWS+KA RRK TG
Sbjct  1    MTKGTSSFGKRNQKTHSLCRRCGKSSYHIQKKRCAGCGYPSKKMRSYNWSMKAKRRKMTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMRHL+ V RRF   FRE T   PRK+GAAAA+
Sbjct  61   TGRMRHLKQVQRRFDNGFREGTTPKPRKRGAAAAA  95



>emb|CAJ17427.1| ribosomal protein L37e [Biphyllus lunatus]
Length=91

 Score =   128 bits (321),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YP+A++  YNWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPSAKMRSYNWSIKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGR+RHL+ V RRF+  FRE  +A+P+K
Sbjct  61   TGRLRHLKIVRRRFRNGFREGGKASPKK  88



>gb|AGN29663.1| 60S ribosomal protein L37 [Acartia pacifica]
 gb|AGN29664.1| 60S ribosomal protein L37 [Acartia pacifica]
Length=91

 Score =   128 bits (321),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCG+ SFHIQK  C+AC YPAA+I KYNWS KA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGKVSFHIQKKTCAACGYPAAKIRKYNWSEKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGRMRHL+ V R+F+  FRE T A   KK
Sbjct  61   TGRMRHLKVVLRKFRNGFREGTVAVALKK  89



>ref|XP_011191715.1| PREDICTED: probable 60S ribosomal protein L37-A [Bactrocera cucurbitae]
Length=93

 Score =   127 bits (320),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQKS CS C YPAA++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCSQCGYPAAKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGR+R+L+ V RRF+  FRE T+A P+K
Sbjct  61   TGRVRYLKVVRRRFRNGFREGTQAKPKK  88



>ref|XP_011198860.1| PREDICTED: probable 60S ribosomal protein L37-A [Bactrocera dorsalis]
Length=93

 Score =   127 bits (320),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQKS CS C YPAA++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCSQCGYPAAKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGR+R+L+ V RRF+  FRE T+A P+K
Sbjct  61   TGRVRYLKVVRRRFRNGFREGTQAKPKK  88



>ref|XP_004524980.1| PREDICTED: probable 60S ribosomal protein L37-A-like isoform 
X2 [Ceratitis capitata]
Length=93

 Score =   127 bits (320),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQKS CS C YPAA++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCSQCGYPAAKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGR+R+L+ V RRF+  FRE T+A P+K
Sbjct  61   TGRVRYLKVVRRRFRNGFREGTQAKPKK  88



>ref|XP_001992243.1| GH24309 [Drosophila grimshawi]
 gb|EDV91950.1| GH24309 [Drosophila grimshawi]
Length=106

 Score =   127 bits (320),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++  YNWSVKA RRKTTGTG
Sbjct  16   KGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTG  75

Query  206  RMRHLRTVPRRFKTNFRERTEATPRKKGAA  295
            RM HL+ V RRF+  FRE T+A P+K  A+
Sbjct  76   RMSHLKVVRRRFRNGFREGTQAKPKKAQAS  105



>ref|XP_796231.2| PREDICTED: probable 60S ribosomal protein L37-A-like [Strongylocentrotus 
purpuratus]
Length=94

 Score =   127 bits (318),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHT C RCGRRS+HIQK  CS+C YPA  I KYNWS KA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTFCRRCGRRSYHIQKLTCSSCGYPAKTIRKYNWSAKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGR++HLR V R+F   FRE T+  PR +GAA+
Sbjct  61   TGRIKHLRAVNRKFSNGFREGTKPKPRARGAAS  93



>ref|XP_004524979.1| PREDICTED: probable 60S ribosomal protein L37-A-like isoform 
X1 [Ceratitis capitata]
Length=130

 Score =   128 bits (321),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGT SFGKR NKTHTLC RCGR S+HIQKS CS C YPAA++  YNWSVKA RRKTTGTG
Sbjct  40   KGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCSQCGYPAAKLRSYNWSVKAKRRKTTGTG  99

Query  206  RMRHLRTVPRRFKTNFRERTEATPRK  283
            R+R+L+ V RRF+  FRE T+A P+K
Sbjct  100  RVRYLKVVRRRFRNGFREGTQAKPKK  125



>gb|ABM55635.1| ribosomal protein L37-like protein [Maconellicoccus hirsutus]
Length=89

 Score =   126 bits (317),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YP+ ++  +NWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPSKKLRHFNWSIKAQRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRMRHL+ V RRF+  FRE  +A PRK
Sbjct  61   TGRMRHLKVVRRRFRNGFREGGQAKPRK  88



>gb|AEE63535.1| unknown [Dendroctonus ponderosae]
 gb|ENN76981.1| hypothetical protein YQE_06475, partial [Dendroctonus ponderosae]
 gb|ERL85477.1| hypothetical protein D910_02896 [Dendroctonus ponderosae]
Length=90

 Score =   126 bits (317),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YP+ ++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPSVKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGR+RHL+ V RRFK  FRE  +  P+K
Sbjct  61   TGRLRHLKIVRRRFKNGFREGVKPAPKK  88



>ref|XP_002058058.1| GJ15698 [Drosophila virilis]
 gb|EDW66166.1| GJ15698 [Drosophila virilis]
Length=96

 Score =   127 bits (318),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++  YNWSVKA RRKTTGTG
Sbjct  6    KGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTG  65

Query  206  RMRHLRTVPRRFKTNFRERTEATPRK  283
            RM HL+ V RRF+  FRE T+A P+K
Sbjct  66   RMSHLKVVRRRFRNGFREGTQAKPKK  91



>ref|NP_001037247.1| ribosomal protein L37 [Bombyx mori]
 gb|AAV34850.1| ribosomal protein L37 [Bombyx mori]
Length=93

 Score =   126 bits (317),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 1/94 (1%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++  Y+WSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMRHL+ V RRF+  F+E  + TP KK  A++
Sbjct  61   TGRMRHLKIVRRRFRNGFKE-GKPTPPKKAVASS  93



>ref|XP_011493218.1| AAEL017198-PA [Aedes aegypti]
 gb|AAS79345.1| 60S ribosomal protein L37 [Aedes aegypti]
 gb|EJY57510.1| AAEL017198-PA [Aedes aegypti]
Length=91

 Score =   126 bits (316),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQK  CS C YPAA+I  YNWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKHTCSQCGYPAAKIRSYNWSIKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGA  292
            TGRMR+L+ V R+F+  FRE   A PRK  A
Sbjct  61   TGRMRYLKVVRRKFRNGFREGQVAKPRKATA  91



>ref|XP_011163999.1| PREDICTED: 60S ribosomal protein L37 [Solenopsis invicta]
Length=91

 Score =   126 bits (316),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPA ++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAKKMRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHL+ V R+FK  FR   E  P+ K  AA
Sbjct  61   TGRMRHLKIVRRKFKNGFR---EGLPKPKAVAA  90



>gb|ACY71284.1| ribosomal protein L37 [Chrysomela tremula]
Length=89

 Score =   125 bits (315),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 72/89 (81%), Gaps = 2/89 (2%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPAAKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGR+RHL+ V RRF+  FRE T+  P KK
Sbjct  61   TGRLRHLKIVRRRFRNGFREGTK--PEKK  87



>ref|XP_001630296.1| predicted protein [Nematostella vectensis]
 gb|EDO38233.1| predicted protein [Nematostella vectensis]
Length=100

 Score =   126 bits (316),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NK+HTLCVRCGR+++HIQK RC+ C +P+AR+ K+NWS+KA RR TTG
Sbjct  1    MTKGTSSFGKRHNKSHTLCVRCGRKAYHIQKKRCAGCGFPSARLRKFNWSMKAKRRTTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGA  292
            TGRMRHL+ V RRF+  F+E T+A  +KK  
Sbjct  61   TGRMRHLKLVYRRFQNGFQEGTQAKSQKKNV  91



>ref|XP_009533584.1| hypothetical protein PHYSODRAFT_355302 [Phytophthora sojae]
 gb|EGZ10839.1| hypothetical protein PHYSODRAFT_355302 [Phytophthora sojae]
Length=92

 Score =   125 bits (315),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFG R NKTHT+C RCGR S+HIQKS CS+C YPAA++ KYNWS KA+RR+TTG
Sbjct  1    MTKGTQSFGMRHNKTHTICRRCGRSSYHIQKSTCSSCGYPAAKMRKYNWSQKALRRRTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRMRHL+ V R+FK  FRE + A  +K
Sbjct  61   TGRMRHLKNVQRKFKNGFREGSSAVSKK  88



>ref|NP_001129424.1| ribosomal protein L37 [Acyrthosiphon pisum]
Length=91

 Score =   125 bits (315),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQKS+C+ C YP+ ++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSKCAQCGYPSKKLRHYNWSVKAQRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPR  280
            TGR+RHL+ V R+F+  FRE T+A PR
Sbjct  61   TGRLRHLKIVRRKFRNGFREGTQAKPR  87



>ref|XP_005851841.1| hypothetical protein CHLNCDRAFT_133342 [Chlorella variabilis]
 gb|EFN59739.1| hypothetical protein CHLNCDRAFT_133342 [Chlorella variabilis]
Length=178

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  29   GTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTGR  208
            GTGSFG R  K+HTLC RCGRRSFHIQKS C +C YPAA+I KYNWSVKAI RKTTGTGR
Sbjct  93   GTGSFGLRHTKSHTLCRRCGRRSFHIQKSTCGSCGYPAAKIRKYNWSVKAIGRKTTGTGR  152

Query  209  MRHLRTVPRRFKTNFRERTEA  271
            M+HL++V RRFK  FRE T A
Sbjct  153  MKHLKSVQRRFKNGFREGTAA  173



>ref|XP_969650.2| PREDICTED: 60S ribosomal protein L37 [Tribolium castaneum]
Length=90

 Score =   125 bits (314),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YP+A++  YNWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPSAKLRSYNWSIKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGR+RHL+ V RRF+  FRE  +  P+K
Sbjct  61   TGRLRHLKIVRRRFRNGFREGGKPAPKK  88



>ref|XP_011055673.1| PREDICTED: 60S ribosomal protein L37 [Acromyrmex echinatior]
 ref|XP_011301644.1| PREDICTED: 60S ribosomal protein L37 [Fopius arisanus]
Length=91

 Score =   125 bits (314),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPA ++  YNWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPAKKMRSYNWSIKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHL+ V R+FK  FR   E  P+ K  AA
Sbjct  61   TGRMRHLKIVRRKFKNGFR---EGLPKPKAVAA  90



>gb|ACL37990.1| cytosolic large ribosomal subunit L37 [Ochlerotatus taeniorhynchus]
Length=91

 Score =   125 bits (314),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQK  CS C YPAA+I  YNWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKHTCSQCGYPAAKIRTYNWSIKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGA  292
            TGRMR+L+ V R+F+  FRE   A PRK  A
Sbjct  61   TGRMRYLKIVRRKFRNGFREGQVAKPRKATA  91



>ref|XP_003058272.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58223.1| predicted protein [Micromonas pusilla CCMP1545]
Length=100

 Score =   125 bits (314),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
             ++GKGTGSFGKR NK+HT+C RCGRRS+HIQK+ C AC YP+AR   YNWS KAI R+T
Sbjct  2    GKIGKGTGSFGKRHNKSHTMCRRCGRRSYHIQKATCGACGYPSARKRNYNWSTKAIGRRT  61

Query  194  TGTGRMRHLRTVPRRFKTNFRE  259
            TGTGRMR+L+T+PRRFK  FRE
Sbjct  62   TGTGRMRYLKTLPRRFKNGFRE  83



>emb|CBV76072.1| 60S ribosomal protein L37 [Polytomella sp. Pringsheim 198.80]
Length=92

 Score =   125 bits (314),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  23   GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGT  202
            GKGTGSFGKRRNKTHT+C RCGR+S+HIQKS CS C YP+A    Y W  KAIRRKTTGT
Sbjct  5    GKGTGSFGKRRNKTHTMCRRCGRKSYHIQKSTCSMCGYPSATKRTYQWGQKAIRRKTTGT  64

Query  203  GRMRHLRTVPRRFKTNFRERTEA  271
            GRMR+++T+ RRFK  FRE TEA
Sbjct  65   GRMRYMKTLSRRFKNGFREGTEA  87



>gb|ETN60779.1| 60S ribosomal protein L37 [Anopheles darlingi]
Length=91

 Score =   125 bits (314),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQK  CS C YPAA+I  YNWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKHTCSRCGYPAAKIRSYNWSIKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGA  292
            TGRMR+L+ V RRF+  FRE   A PRK  A
Sbjct  61   TGRMRYLKVVRRRFRNGFREGQVAKPRKAAA  91



>ref|XP_001851080.1| 60S ribosomal protein L37 [Culex quinquefasciatus]
 gb|EDS33026.1| 60S ribosomal protein L37 [Culex quinquefasciatus]
Length=91

 Score =   125 bits (313),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQK  CS C YP+A+I  YNWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKHTCSQCGYPSAKIRTYNWSIKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGA  292
            TGRMR+L+ V R+F+  FRE   A PRK  A
Sbjct  61   TGRMRYLKIVRRKFRNGFREGQVAKPRKAAA  91



>ref|XP_002010714.1| GI21554 [Drosophila mojavensis]
 gb|EDW06369.1| GI21554 [Drosophila mojavensis]
Length=105

 Score =   125 bits (314),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++  YNWSVKA RRKTTGTG
Sbjct  15   KGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTG  74

Query  206  RMRHLRTVPRRFKTNFRERTEATPRK  283
            RM +L+ V RRF+  FRE T+A P+K
Sbjct  75   RMSYLKVVRRRFRNGFREGTQAKPKK  100



>gb|ADP21472.1| ribosomal protein L37 [Antheraea yamamai]
Length=92

 Score =   125 bits (313),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++  Y+WSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHL+ V RRF+  F+E  + TP+K  A++
Sbjct  61   TGRMRHLKIVRRRFRNGFKE-GKLTPKKVVASS  92



>ref|XP_009996478.1| PREDICTED: 60S ribosomal protein L37 [Chaetura pelagica]
Length=97

 Score =   125 bits (313),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCG +++H+QKS C  C YPA R  KYNWSVKA RR TTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSVKAKRRNTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMRHL+ V RRF+  FRE T   P++   AA+S
Sbjct  61   TGRMRHLKRVHRRFRNGFREGTMPKPKRAAVAASS  95



>sp|Q962S7.3|RL37_SPOFR RecName: Full=60S ribosomal protein L37 [Spodoptera frugiperda]
 gb|AAK92171.1|AF400199_1 ribosomal protein L37 [Spodoptera frugiperda]
 gb|ACY95299.1| ribosomal protein L37 [Manduca sexta]
 gb|AEL28858.1| ribosomal protein L37 [Heliconius melpomene cythera]
 dbj|BAM17855.1| ribosomal protein L37a [Papilio xuthus]
 dbj|BAM19063.1| ribosomal protein L37a [Papilio polytes]
Length=92

 Score =   125 bits (313),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++  Y+WSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHL+ V RRF+  F+E  + TP+K  A++
Sbjct  61   TGRMRHLKIVRRRFRNGFKE-GKPTPKKAVASS  92



>ref|XP_002902894.1| ribosomal protein L37e, putative [Phytophthora infestans T30-4]
 gb|EEY56064.1| ribosomal protein L37e, putative [Phytophthora infestans T30-4]
Length=92

 Score =   125 bits (313),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFG R NKTHT+C RCGR S+HIQKS CS+C YPAA++ K+NWS KA+RR+TTG
Sbjct  1    MTKGTQSFGMRHNKTHTICRRCGRSSYHIQKSTCSSCGYPAAKMRKFNWSQKALRRRTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRMRHL+ V RRFK  FRE + A  +K
Sbjct  61   TGRMRHLKNVQRRFKNGFREGSSAVSKK  88



>dbj|BAD26666.1| Ribosomal protein L37 [Plutella xylostella]
Length=92

 Score =   125 bits (313),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++  Y+WSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMRHL+ V RRF+  F+   E  P  K A A+S
Sbjct  61   TGRMRHLKIVRRRFRNGFK---EGLPTPKKAVASS  92



>ref|XP_008867284.1| 60S ribosomal protein L37 [Aphanomyces invadans]
 gb|ETW04328.1| 60S ribosomal protein L37 [Aphanomyces invadans]
Length=143

 Score =   126 bits (317),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGT S+GKR NKTHT+C RCG+ S+HIQKS C +C YPAA++ KYNWSVKA+RR+TTGTG
Sbjct  54   KGTSSYGKRHNKTHTICRRCGKSSYHIQKSTCGSCGYPAAKMRKYNWSVKALRRRTTGTG  113

Query  206  RMRHLRTVPRRFKTNFRERTEATPRK  283
            RMR+L+TVPR+FK  FRE  +A  +K
Sbjct  114  RMRYLKTVPRKFKNGFREGGKAVSKK  139



>gb|EHJ72003.1| 60S ribosomal protein L37 [Danaus plexippus]
Length=92

 Score =   124 bits (312),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++  Y+WSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPAAKLRSYHWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHL+ V RRF+  F+E  + TP+K  A++
Sbjct  61   TGRMRHLKIVRRRFRNGFKE-GKPTPKKAVASS  92



>gb|AGN29583.1| ribosomal protein L37 [Acartia pacifica]
Length=92

 Score =   124 bits (312),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQK  C+ C YP+ +  +YNWSVKAIRRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKKTCAQCGYPSKKTRRYNWSVKAIRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGR+RHL+ V RRF+  FRE  +A PRK
Sbjct  61   TGRLRHLKVVRRRFRNGFREGIKAQPRK  88



>gb|ADT80678.1| ribosomal protein L37 [Euphydryas aurinia]
Length=92

 Score =   124 bits (312),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++  Y+WSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHL+ V RRF+  F+E  + TP+K  A++
Sbjct  61   TGRMRHLKIVRRRFRNGFKE-GKPTPKKTVASS  92



>gb|ABM55421.1| ribosomal protein L37 [Xenopsylla cheopis]
Length=92

 Score =   124 bits (312),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YP A++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPFAKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRMRHL+ V RRF+  FRE  +  P K
Sbjct  61   TGRMRHLKIVRRRFRNGFREGGKPAPAK  88



>gb|AAX62386.1| ribosomal protein L37 [Lysiphlebus testaceipes]
Length=90

 Score =   124 bits (311),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 70/93 (75%), Gaps = 4/93 (4%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS C+ C YPA ++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSECAQCGYPAKKMRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHL+ V R+FK  FRE     P+ K  AA
Sbjct  61   TGRMRHLKIVRRKFKNAFRE----GPKPKAVAA  89



>ref|XP_005703880.1| 60S ribosomal protein L37e [Galdieria sulphuraria]
 gb|EME27360.1| 60S ribosomal protein L37e [Galdieria sulphuraria]
Length=96

 Score =   124 bits (312),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTH LC+RCGRR++H+QK RC++C YP+A+  ++NWS K+IRR+TTG
Sbjct  1    MTKGTSSFGKRNNKTHVLCIRCGRRAYHLQKKRCASCGYPSAKKRRFNWSEKSIRRRTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            TGRMR+LR +PRRFK  FRE  +A+ +   +A +
Sbjct  61   TGRMRYLRHLPRRFKNGFREGVKASSKHPASATS  94



>ref|XP_008557106.1| PREDICTED: 60S ribosomal protein L37 [Microplitis demolitor]
 gb|EZA45985.1| 60S ribosomal protein L37 [Microplitis demolitor]
Length=91

 Score =   124 bits (311),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQKS+C+ C YPA ++  YNWS+KA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSKCAQCGYPAKKMRSYNWSIKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMRHL+ V R+FK  FR   E  P+ K  AA
Sbjct  61   TGRMRHLKIVRRKFKNGFR---EGVPKPKAVAA  90



>ref|XP_002954149.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ44866.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=94

 Score =   124 bits (311),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  23   GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGT  202
            GKGTGSFGKRRNKTHTLC RCGR S+H QK  CSAC YPAAR   Y W  KAI RKTTGT
Sbjct  5    GKGTGSFGKRRNKTHTLCRRCGRTSYHNQKHVCSACGYPAARKRTYQWGQKAIGRKTTGT  64

Query  203  GRMRHLRTVPRRFKTNFRERTEATPR  280
            GRMR+++T+ RRFK  FRE +EA P+
Sbjct  65   GRMRYMKTLARRFKNGFREGSEAKPK  90



>dbj|BAN20136.1| ribosomal protein L37a [Riptortus pedestris]
Length=90

 Score =   124 bits (310),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKSRC+ C YP+A++  YNWSVK  RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSRCAQCGYPSAKLRHYNWSVKGQRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRMR+L+ V RRF+  FRE     P+K
Sbjct  61   TGRMRYLKVVRRRFRNGFREGGRPAPKK  88



>gb|ACO10534.1| Probable 60S ribosomal protein L37-A [Caligus rogercresseyi]
Length=90

 Score =   124 bits (310),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQK  C++C YP+A+   YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRVSYHIQKKTCASCGYPSAQTRGYNWSVKATRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGRMRHL+ + R+F+  FRE T A  +KK
Sbjct  61   TGRMRHLKVIRRKFRNGFREGTVAVSKKK  89



>gb|EGI64662.1| 60S ribosomal protein L37 [Acromyrmex echinatior]
Length=91

 Score =   124 bits (310),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPA ++  YNWS+KA RRKTTGTG
Sbjct  3    KGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPAKKMRSYNWSIKAKRRKTTGTG  62

Query  206  RMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            RMRHL+ V R+FK  FR   E  P+ K  AA
Sbjct  63   RMRHLKIVRRKFKNGFR---EGLPKPKAVAA  90



>ref|XP_011264945.1| PREDICTED: 60S ribosomal protein L37 [Camponotus floridanus]
Length=91

 Score =   124 bits (310),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPA ++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPAKKMRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            TGRMR+L+ V R+FK  FR   E  P+ K  AA
Sbjct  61   TGRMRYLKIVRRKFKNGFR---EGLPKPKAVAA  90



>gb|ERG78989.1| putative 60s ribosomal protein l37-a [Ascaris suum]
Length=99

 Score =   124 bits (310),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR ++HIQK RC++C YPA R   Y WSVKAIRR TTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSAYHIQKHRCASCGYPAKRKRTYQWSVKAIRRHTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKG  289
            TGRMRH++ V RRF+ +FRE T A  +K G
Sbjct  61   TGRMRHMKVVQRRFRNHFREGTMAKSKKGG  90



>gb|EJW79669.1| ribosomal protein L37 [Wuchereria bancrofti]
Length=101

 Score =   123 bits (309),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQK RC++C YP+AR   Y WS KAIRR TTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKHRCASCGYPSARKRTYQWSAKAIRRHTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGRMRHL+ V RRF+ +FRE T A P+ +
Sbjct  61   TGRMRHLKIVRRRFRNHFREGTTAKPKNR  89



>emb|CAJ17428.1| ribosomal protein L37e [Sphaerius sp. APV-2005]
Length=93

 Score =   123 bits (309),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YP+A++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPSAKMRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGRMR+L+ V RRF+  FRE T     KK
Sbjct  61   TGRMRYLKIVRRRFRNGFREGTRGGNVKK  89



>gb|EFA10173.1| hypothetical protein TcasGA2_TC012363 [Tribolium castaneum]
Length=117

 Score =   124 bits (311),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YP+A++  YNWS+KA RRKTTGTG
Sbjct  30   KGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPSAKLRSYNWSIKAKRRKTTGTG  89

Query  206  RMRHLRTVPRRFKTNFRERTEATPRK  283
            R+RHL+ V RRF+  FRE  +  P+K
Sbjct  90   RLRHLKIVRRRFRNGFREGGKPAPKK  115



>gb|KFU90030.1| 60S ribosomal protein L37, partial [Chaetura pelagica]
Length=95

 Score =   123 bits (309),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGT SFGKRRNKTHTLC RCG +++H+QKS C  C YPA R  KYNWSVKA RR TTGTG
Sbjct  2    KGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSVKAKRRNTTGTG  61

Query  206  RMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            RMRHL+ V RRF+  FRE T   P++   AA+S
Sbjct  62   RMRHLKRVHRRFRNGFREGTMPKPKRAAVAASS  94



>gb|AAX48871.1| L37 [Suberites domuncula]
Length=98

 Score =   123 bits (309),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLCVRC R ++HIQK  C++CAYPAAR  +YNWSVKA RR+TTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCVRCHRSAYHIQKKVCASCAYPAARKRRYNWSVKAKRRRTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRM+HLR+V RR    FRE T+A  RK
Sbjct  61   TGRMKHLRSVQRRANNGFREGTQAKIRK  88



>ref|XP_001702514.1| ribosomal protein L37, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP06293.1| ribosomal protein L37 [Chlamydomonas reinhardtii]
Length=94

 Score =   123 bits (308),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  14   AQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKT  193
             + GKGTGSFGKRRNKTHTLC RCGR S+H QK  CSAC YPAAR   Y W  KAI RKT
Sbjct  2    GKKGKGTGSFGKRRNKTHTLCRRCGRTSYHNQKHVCSACGYPAARKRTYQWGQKAIGRKT  61

Query  194  TGTGRMRHLRTVPRRFKTNFRERTEATPR  280
            TG+GRMR+++T+ RRFK  FRE +EA P+
Sbjct  62   TGSGRMRYMKTLARRFKNGFREGSEAKPK  90



>ref|XP_004276717.1| PREDICTED: 60S ribosomal protein L37-like [Orcinus orca]
Length=97

 Score =   123 bits (308),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCG  ++H+QKS C  C YPA R  KYNWS KA RR TTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGSNAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAAS  304
            TGRMRHL+ V RRF+  FRE T   P++   AA+S
Sbjct  61   TGRMRHLKIVYRRFRHGFREETTPKPKRAAVAASS  95



>gb|KHJ30462.1| putative 60s ribosomal protein l37 [Erysiphe necator]
Length=93

 Score =   123 bits (308),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGRR+ HIQK  C+AC YPAA+I KYNW  KA RRKTTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRRALHIQKHTCAACGYPAAKIRKYNWGEKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFR  256
            TGRMRH++ VPRRFK +F+
Sbjct  61   TGRMRHMKDVPRRFKNDFQ  79



>ref|NP_001279695.1| ribosomal protein L37 [Callorhinchus milii]
 gb|AFK11300.1| ribosomal protein L37-like protein [Callorhinchus milii]
Length=97

 Score =   123 bits (308),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCG ++FH+QKS C  CAYPA R  KYNWS+KA RR TTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGAKAFHLQKSTCGRCAYPAKRKRKYNWSIKAKRRNTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRMRHL+ V RRF+  FRE T   PR+
Sbjct  61   TGRMRHLKVVYRRFRNGFREGTTPKPRR  88



>emb|CAJ17429.1| ribosomal protein L37e [Timarcha balearica]
Length=89

 Score =   122 bits (307),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YP+A++  YNWSVKA RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPSAKLRSYNWSVKAKRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRE  259
            TGR+RHL+ V RRF+  FRE
Sbjct  61   TGRLRHLKIVRRRFRNGFRE  80



>ref|XP_001894606.1| 60S ribosomal protein L37-A [Brugia malayi]
 emb|CDP97678.1| Protein Bm14074 [Brugia malayi]
Length=101

 Score =   122 bits (307),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKR NKTHTLC RCGR S+HIQK RC++C YP+AR   Y WS KAIRR TTG
Sbjct  1    MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKHRCASCGYPSARKRTYQWSAKAIRRHTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRKK  286
            TGRMRHL+ V RRF+ +FRE T A P+ +
Sbjct  61   TGRMRHLKIVRRRFRNHFREGTIAKPKNR  89



>ref|XP_002423268.1| 60S ribosomal protein L37, putative [Pediculus humanus corporis]
 gb|EEB10530.1| 60S ribosomal protein L37, putative [Pediculus humanus corporis]
Length=90

 Score =   122 bits (307),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = +2

Query  20   MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTG  199
            M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YP+ ++  YNWS K  RRKTTG
Sbjct  1    MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPSKKLRHYNWSEKGQRRKTTG  60

Query  200  TGRMRHLRTVPRRFKTNFRERTEATPRK  283
            TGRMRHL+ V RRFK  FRE     P+K
Sbjct  61   TGRMRHLKIVRRRFKNGFREGPRPVPKK  88



>gb|EIE90927.1| 60S ribosomal protein L37 [Rhizopus delemar RA 99-880]
Length=387

 Score =   129 bits (325),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 2/100 (2%)
 Frame = +2

Query  2    FASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAI  181
            F  A+ + KGT SFGKR  K+HTLC RCG R+FH QK  C+ C YPAA+I  +NWS K  
Sbjct  290  FTLASALTKGTSSFGKRHTKSHTLCRRCGNRAFHKQKKTCAQCGYPAAKIRSFNWSEKGK  349

Query  182  RRKTTGTGRMRHLRTVPRRFKTNFRERTEATPRKKGAAAA  301
            RRKTTGTGRM HL+ V RRFK  FRE ++A  +K+ AA+A
Sbjct  350  RRKTTGTGRMAHLKEVHRRFKNGFREGSQA--KKQVAASA  387



>gb|EFN73831.1| 60S ribosomal protein L37 [Camponotus floridanus]
Length=91

 Score =   122 bits (306),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (77%), Gaps = 3/91 (3%)
 Frame = +2

Query  26   KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARITKYNWSVKAIRRKTTGTG  205
            KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPA ++  YNWSVKA RRKTTGTG
Sbjct  3    KGTSSFGKRRNKTHTLCRRCGRSSYHIQKSQCAQCGYPAKKMRSYNWSVKAKRRKTTGTG  62

Query  206  RMRHLRTVPRRFKTNFRERTEATPRKKGAAA  298
            RMR+L+ V R+FK  FR   E  P+ K  AA
Sbjct  63   RMRYLKIVRRKFKNGFR---EGLPKPKAVAA  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561481202700