BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN034L23

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAG10403.1|AF233284_1  mannose-binding lectin                        155   6e-44   Convolvulus arvensis
gb|AAC49564.1|  lectin                                                  149   2e-41   Calystegia sepium
pdb|1OUW|A  Chain A, Crystal Structure Of Calystegia Sepium Agglu...    144   1e-39   Calystegia sepium
dbj|BAA14024.1|  ipomoelin                                              117   5e-29   Ipomoea batatas [batate]
pdb|3R50|A  Chain A, Structure Analysis Of A Wound-Inducible Lect...    117   6e-29   Ipomoea batatas [batate]
gb|AAA87042.1|  putative 32.7 kDa jasmonate-induced protein           88.6    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABA93998.1|  NB-ARC domain containing protein, expressed           91.7    2e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52195.1|  hypothetical protein OsJ_34074                        90.9    3e-17   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68267.1|  hypothetical protein OsI_36302                        89.7    1e-16   Oryza sativa Indica Group [Indian rice]
gb|EMS66150.1|  hypothetical protein TRIUR3_12251                     85.5    2e-16   Triticum urartu
gb|AAA87041.1|  putative 32.6 kDa jasmonate-induced protein           84.7    4e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006663483.1|  PREDICTED: probable disease resistance RPP8-...  87.4    5e-16   
ref|XP_006663484.1|  PREDICTED: putative disease resistance RPP13...  87.0    8e-16   
ref|XP_004168675.1|  PREDICTED: pentatricopeptide repeat-containi...  84.7    3e-15   
ref|XP_004152769.1|  PREDICTED: pentatricopeptide repeat-containi...  84.0    7e-15   
gb|EMT11070.1|  hypothetical protein F775_02114                       80.9    8e-15   
gb|EEE52196.1|  hypothetical protein OsJ_34075                        80.9    6e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68269.1|  hypothetical protein OsI_36304                        80.9    6e-14   Oryza sativa Indica Group [Indian rice]
gb|ABA94002.1|  Jacalin-like lectin domain containing protein, ex...  80.9    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006853911.1|  hypothetical protein AMTR_s00036p00183970        75.1    9e-14   
ref|XP_011463712.1|  PREDICTED: jacalin-related lectin 3-like         79.7    1e-13   Fragaria vesca subsp. vesca
dbj|BAK00987.1|  predicted protein                                    77.0    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY82651.1|  hypothetical protein OsI_37872                        77.0    2e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_009795366.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   Nicotiana sylvestris
gb|KGN62634.1|  hypothetical protein Csa_2G362470                     79.0    2e-13   Cucumis sativus [cucumbers]
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   Nicotiana sylvestris
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   Nicotiana sylvestris
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  79.7    2e-13   Nicotiana sylvestris
ref|XP_008444758.1|  PREDICTED: LOW QUALITY PROTEIN: myrosinase-b...  78.6    2e-13   
ref|XP_009589464.1|  PREDICTED: agglutinin-like                       77.4    2e-13   Nicotiana tomentosiformis
ref|NP_001066367.1|  Os12g0198700                                     76.3    3e-13   
emb|CDM80625.1|  unnamed protein product                              76.3    3e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010273654.1|  PREDICTED: mannose/glucose-specific lectin-like  73.9    4e-13   Nelumbo nucifera [Indian lotus]
ref|XP_006853910.1|  hypothetical protein AMTR_s00036p00183430        74.3    6e-13   
ref|XP_002440163.1|  hypothetical protein SORBIDRAFT_09g027055        74.3    6e-13   
ref|XP_006647196.1|  PREDICTED: disease resistance protein RPM1-l...  77.8    6e-13   Oryza brachyantha
ref|XP_006647195.1|  PREDICTED: disease resistance protein RPM1-l...  77.8    7e-13   Oryza brachyantha
ref|XP_009769147.1|  PREDICTED: putative late blight resistance p...  77.8    7e-13   Nicotiana sylvestris
gb|EMT07650.1|  Horcolin                                              75.5    7e-13   
gb|AAR20919.1|  jasmonate-induced protein                             75.1    8e-13   Triticum aestivum [Canadian hard winter wheat]
gb|EMT24046.1|  hypothetical protein F775_25349                       75.1    8e-13   
ref|XP_004982894.1|  PREDICTED: salt stress-induced protein-like      72.8    9e-13   
gb|ABS82785.1|  jasmonate-induced protein                             74.7    1e-12   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002318228.2|  hypothetical protein POPTR_0012s13320g           73.6    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011030089.1|  PREDICTED: jacalin-related lectin 19             73.2    1e-12   Populus euphratica
ref|XP_006853909.1|  hypothetical protein AMTR_s00036p00182710        72.8    2e-12   
ref|XP_004235622.1|  PREDICTED: jacalin-related lectin 19             72.8    2e-12   Solanum lycopersicum
gb|EMS55842.1|  hypothetical protein TRIUR3_32339                     73.6    2e-12   Triticum urartu
ref|XP_006343016.1|  PREDICTED: agglutinin-like                       72.4    2e-12   Solanum tuberosum [potatoes]
ref|XP_010267066.1|  PREDICTED: jacalin-related lectin 19             72.0    4e-12   Nelumbo nucifera [Indian lotus]
ref|XP_008806712.1|  PREDICTED: agglutinin-like isoform X2            72.0    4e-12   Phoenix dactylifera
ref|XP_008806706.1|  PREDICTED: agglutinin-like isoform X1            72.0    4e-12   Phoenix dactylifera
ref|NP_001066495.1|  Os12g0247700                                     73.2    4e-12   
gb|EEC69076.1|  hypothetical protein OsI_37951                        72.4    4e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_010924945.1|  PREDICTED: jacalin-related lectin 19-like is...  71.6    5e-12   Elaeis guineensis
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  75.1    5e-12   Nicotiana tomentosiformis
ref|XP_009614994.1|  PREDICTED: putative late blight resistance p...  75.1    5e-12   Nicotiana tomentosiformis
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  75.1    5e-12   Nicotiana tomentosiformis
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  75.1    5e-12   Nicotiana tomentosiformis
gb|EEE60695.1|  hypothetical protein OsJ_14181                        69.7    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010924946.1|  PREDICTED: jacalin-related lectin 19-like is...  71.2    5e-12   Elaeis guineensis
gb|EMT23136.1|  hypothetical protein F775_18655                       70.1    5e-12   
ref|NP_177447.1|  Mannose-binding lectin superfamily protein          71.2    5e-12   
ref|XP_006354454.1|  PREDICTED: probable disease resistance RPP8-...  72.4    6e-12   Solanum tuberosum [potatoes]
ref|XP_002888904.1|  predicted protein                                70.9    6e-12   
gb|EAZ01021.1|  hypothetical protein OsI_23055                        74.3    6e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_007215056.1|  hypothetical protein PRUPE_ppa012210mg           70.9    7e-12   
ref|XP_009367509.1|  PREDICTED: agglutinin alpha chain                70.9    7e-12   Pyrus x bretschneideri [bai li]
ref|XP_006390600.1|  hypothetical protein EUTSA_v10019210mg           70.9    8e-12   Eutrema salsugineum [saltwater cress]
gb|EEC72970.1|  hypothetical protein OsI_06866                        74.3    8e-12   Oryza sativa Indica Group [Indian rice]
dbj|BAD23250.1|  putative LZ-NBS-LRR class RGA                        74.3    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002510452.1|  pentatricopeptide repeat-containing protein,...  74.3    8e-12   
ref|XP_009770862.1|  PREDICTED: putative late blight resistance p...  74.3    8e-12   Nicotiana sylvestris
ref|XP_003615697.1|  Myrosinase-binding protein-like protein          73.9    8e-12   
ref|XP_010471351.1|  PREDICTED: jacalin-related lectin 19             70.5    8e-12   Camelina sativa [gold-of-pleasure]
ref|XP_008348486.1|  PREDICTED: agglutinin alpha chain-like           70.9    9e-12   Malus domestica [apple tree]
sp|Q5U9T2.1|LECH_HORVU  RecName: Full=Horcolin; AltName: Full=Agg...  70.1    9e-12   Hordeum vulgare [barley]
ref|XP_009127966.1|  PREDICTED: agglutinin                            70.5    9e-12   Brassica rapa
ref|XP_010230396.1|  PREDICTED: jacalin-related lectin 3-like         71.2    1e-11   Brachypodium distachyon [annual false brome]
ref|XP_010690084.1|  PREDICTED: jacalin-related lectin 19             70.5    1e-11   Beta vulgaris subsp. vulgaris [field beet]
emb|CAD40628.2|  OSJNBa0016N04.16                                     73.2    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006301377.1|  hypothetical protein CARUB_v10021789mg           70.1    1e-11   
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  73.9    1e-11   Nicotiana sylvestris
gb|EEE60834.1|  hypothetical protein OsJ_14451                        73.6    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052560.1|  Os04g0369100                                     73.6    1e-11   
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  73.9    1e-11   Nicotiana sylvestris
gb|EMS51533.1|  hypothetical protein TRIUR3_05238                     71.6    1e-11   Triticum urartu
ref|XP_008244753.1|  PREDICTED: agglutinin-like                       70.1    1e-11   Prunus mume [ume]
ref|XP_004291831.1|  PREDICTED: jacalin-related lectin 3              73.2    2e-11   Fragaria vesca subsp. vesca
ref|XP_008677998.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.8    2e-11   Zea mays [maize]
gb|KDO84683.1|  hypothetical protein CISIN_1g007083mg                 72.8    2e-11   Citrus sinensis [apfelsine]
ref|XP_008677994.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.8    2e-11   Zea mays [maize]
ref|XP_009622524.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.8    2e-11   Nicotiana tomentosiformis
ref|XP_008677996.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.8    2e-11   Zea mays [maize]
gb|KDO84682.1|  hypothetical protein CISIN_1g007083mg                 72.8    2e-11   Citrus sinensis [apfelsine]
ref|XP_008677986.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.8    2e-11   
gb|EMT18893.1|  Disease resistance protein RPM1                       72.8    2e-11   
gb|ACF87628.1|  unknown                                               68.6    2e-11   Zea mays [maize]
ref|NP_001052399.1|  Os04g0295400                                     68.9    2e-11   
ref|XP_008677991.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.8    2e-11   
ref|XP_008677990.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.8    2e-11   
emb|CDY48032.1|  BnaA02g16250D                                        69.7    3e-11   Brassica napus [oilseed rape]
gb|KJB58185.1|  hypothetical protein B456_009G198200                  72.8    3e-11   Gossypium raimondii
gb|EAY93469.1|  hypothetical protein OsI_15270                        68.6    3e-11   Oryza sativa Indica Group [Indian rice]
gb|KJB58186.1|  hypothetical protein B456_009G198200                  72.8    3e-11   Gossypium raimondii
ref|XP_006473571.1|  PREDICTED: pentatricopeptide repeat-containi...  72.4    3e-11   Citrus sinensis [apfelsine]
ref|XP_002467724.1|  hypothetical protein SORBIDRAFT_01g033080        68.6    3e-11   
ref|XP_006435072.1|  hypothetical protein CICLE_v10000604mg           72.0    3e-11   Citrus clementina [clementine]
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  72.4    3e-11   Nicotiana sylvestris
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  72.4    3e-11   Nicotiana sylvestris
ref|XP_008244775.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  70.9    4e-11   
ref|XP_004490606.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.0    4e-11   Cicer arietinum [garbanzo]
ref|XP_006426466.1|  hypothetical protein CICLE_v10026553mg           68.9    4e-11   Citrus clementina [clementine]
ref|XP_004490607.1|  PREDICTED: mannose/glucose-specific lectin-l...  71.6    4e-11   
gb|AAB72098.1|  32 kDa protein                                        70.5    4e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010092355.1|  hypothetical protein L484_023733                 68.6    4e-11   
ref|NP_001106057.1|  PL3K2                                            68.2    4e-11   Zea mays [maize]
gb|EMS58273.1|  hypothetical protein TRIUR3_17900                     70.1    4e-11   Triticum urartu
ref|XP_008677992.1|  PREDICTED: mannose/glucose-specific lectin-l...  72.0    4e-11   
ref|XP_006473572.1|  PREDICTED: pentatricopeptide repeat-containi...  72.0    4e-11   Citrus sinensis [apfelsine]
gb|KFK41744.1|  hypothetical protein AALP_AA2G166700                  68.6    4e-11   Arabis alpina [alpine rockcress]
ref|XP_007024409.1|  Mannose-binding lectin superfamily protein       70.1    5e-11   
gb|AAL10685.1|  mannose-binding lectin                                68.2    5e-11   Morus nigra
ref|XP_010232946.1|  PREDICTED: uncharacterized protein LOC104583002  69.3    5e-11   
ref|XP_004297619.2|  PREDICTED: agglutinin                            71.2    5e-11   Fragaria vesca subsp. vesca
sp|P83304.1|LEC_PARPC  RecName: Full=Mannose/glucose-specific lectin  70.9    5e-11   Parkia platycephala
ref|XP_010932970.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.6    5e-11   Elaeis guineensis
ref|XP_010060992.1|  PREDICTED: jacalin-related lectin 3              71.2    5e-11   Eucalyptus grandis [rose gum]
ref|XP_004961357.1|  PREDICTED: agglutinin-like                       68.6    5e-11   Setaria italica
ref|XP_006372713.1|  hypothetical protein POPTR_0017s043602g          68.2    6e-11   
ref|XP_002450764.1|  hypothetical protein SORBIDRAFT_05g017250        71.6    6e-11   
emb|CDX82115.1|  BnaC02g21750D                                        68.9    6e-11   
emb|CDP17400.1|  unnamed protein product                              69.7    6e-11   Coffea canephora [robusta coffee]
ref|NP_001148739.1|  LOC100282355                                     68.6    7e-11   Zea mays [maize]
ref|XP_004960459.1|  PREDICTED: salt stress-induced protein-like      67.4    7e-11   Setaria italica
ref|XP_009622525.1|  PREDICTED: agglutinin-like isoform X2            70.9    7e-11   
ref|XP_008348483.1|  PREDICTED: agglutinin-like isoform X1            68.2    7e-11   
ref|XP_010428208.1|  PREDICTED: jacalin-related lectin 19-like is...  67.8    7e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008654961.1|  PREDICTED: LOC100282355 isoform X1               68.6    7e-11   
ref|XP_009391787.1|  PREDICTED: agglutinin-like                       68.9    7e-11   
ref|XP_002439182.1|  hypothetical protein SORBIDRAFT_09g001880        69.3    7e-11   Sorghum bicolor [broomcorn]
ref|XP_008348484.1|  PREDICTED: agglutinin-like isoform X2            67.8    8e-11   
ref|XP_008654965.1|  PREDICTED: LOC100282355 isoform X4               68.2    8e-11   Zea mays [maize]
gb|KDP38566.1|  hypothetical protein JCGZ_04491                       70.9    8e-11   Jatropha curcas
ref|XP_008654963.1|  PREDICTED: LOC100282355 isoform X3               68.6    8e-11   
ref|XP_004980504.1|  PREDICTED: protein GOS9-like                     67.0    8e-11   
ref|XP_008654962.1|  PREDICTED: LOC100282355 isoform X2               68.6    8e-11   Zea mays [maize]
ref|XP_009400545.1|  PREDICTED: agglutinin alpha chain                67.8    9e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004986922.1|  PREDICTED: horcolin-like                         67.0    9e-11   
ref|XP_009768586.1|  PREDICTED: jacalin-related lectin 3-like         68.2    9e-11   Nicotiana sylvestris
ref|XP_010428207.1|  PREDICTED: jacalin-related lectin 19-like is...  68.2    9e-11   
ref|XP_010428206.1|  PREDICTED: jacalin-related lectin 19-like is...  68.2    1e-10   
gb|KDO58671.1|  hypothetical protein CISIN_1g037526mg                 67.8    1e-10   Citrus sinensis [apfelsine]
gb|EMT33809.1|  hypothetical protein F775_16156                       67.4    1e-10   
ref|XP_010654564.1|  PREDICTED: jacalin-related lectin 19-like        67.8    1e-10   Vitis vinifera
gb|AHW81907.1|  mannose-binding lectin                                67.0    1e-10   Morus alba var. atropurpurea
ref|XP_009398855.1|  PREDICTED: protein GOS9-like                     67.0    1e-10   
ref|XP_010232948.1|  PREDICTED: jacalin-related lectin 19-like        68.6    1e-10   
emb|CBI35988.3|  unnamed protein product                              67.8    1e-10   Vitis vinifera
ref|XP_010932961.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.9    1e-10   Elaeis guineensis
ref|XP_010932865.1|  PREDICTED: jacalin-related lectin 3-like iso...  67.8    1e-10   
emb|CAE76026.1|  B1292H11.12                                          67.4    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAY80990.1|  hypothetical protein OsI_36172                        70.9    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_008677993.1|  PREDICTED: mannose/glucose-specific lectin-l...  70.5    1e-10   
gb|KHN46147.1|  Agglutinin                                            70.1    1e-10   Glycine soja [wild soybean]
pdb|1XXQ|A  Chain A, Structure Of A Mannose-Specific Jacalin-Rela...  67.0    1e-10   Morus nigra
ref|XP_011081586.1|  PREDICTED: jacalin-related lectin 19-like        68.9    1e-10   
ref|XP_009588771.1|  PREDICTED: agglutinin-like                       68.9    2e-10   Nicotiana tomentosiformis
gb|ACG29554.1|  hypothetical protein                                  66.6    2e-10   Zea mays [maize]
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  70.5    2e-10   Nicotiana sylvestris
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  70.5    2e-10   Nicotiana sylvestris
ref|XP_004979669.1|  PREDICTED: mannose/glucose-specific lectin-l...  70.1    2e-10   
gb|ABA94728.1|  Jacalin-like lectin domain containing protein         70.1    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004979670.1|  PREDICTED: mannose/glucose-specific lectin-l...  70.1    2e-10   Setaria italica
ref|XP_008804539.1|  PREDICTED: mannose/glucose-specific lectin-like  66.2    2e-10   Phoenix dactylifera
ref|XP_004979671.1|  PREDICTED: mannose/glucose-specific lectin-l...  70.1    2e-10   
ref|XP_006372325.1|  Mannose/glucose-specific lectin family protein   69.3    2e-10   Populus trichocarpa [western balsam poplar]
gb|AGT16237.1|  Jacalin-like lectin domain containing protein         69.3    2e-10   Saccharum hybrid cultivar R570
gb|EMS65594.1|  hypothetical protein TRIUR3_06346                     68.6    2e-10   Triticum urartu
ref|XP_010088386.1|  hypothetical protein L484_008121                 66.6    2e-10   Morus notabilis
ref|XP_003597652.1|  Agglutinin alpha chain                           69.7    2e-10   
ref|XP_009338132.1|  PREDICTED: uncharacterized protein LOC103930...  69.7    2e-10   Pyrus x bretschneideri [bai li]
gb|AFW60405.1|  putative protein kinase superfamily protein           69.3    2e-10   
gb|KHG26998.1|  Agglutinin                                            69.3    3e-10   Gossypium arboreum [tree cotton]
ref|XP_002461768.1|  hypothetical protein SORBIDRAFT_02g007760        68.6    3e-10   
gb|ADV38315.1|  mannose/glucose-specific lectin                       65.9    3e-10   Litchi chinensis [litchi]
ref|XP_008778289.1|  PREDICTED: mannose/glucose-specific lectin-like  67.8    3e-10   
ref|XP_002510454.1|  hypothetical protein RCOM_1595950                68.9    3e-10   
ref|NP_001148448.1|  jasmonate-induced protein                        65.9    3e-10   
gb|AEQ30064.1|  mannose/glucose-specific lectin                       65.5    3e-10   Litchi chinensis [litchi]
ref|XP_009608039.1|  PREDICTED: putative late blight resistance p...  69.3    4e-10   
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  69.3    4e-10   
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  69.3    4e-10   
gb|AGT16242.1|  Jacalin-like lectin domain containing protein         68.9    4e-10   Saccharum hybrid cultivar R570
ref|XP_010533565.1|  PREDICTED: jacalin-related lectin 3 isoform X1   68.9    4e-10   Tarenaya hassleriana [spider flower]
ref|XP_010533571.1|  PREDICTED: jacalin-related lectin 3 isoform X2   68.9    4e-10   Tarenaya hassleriana [spider flower]
gb|KCW69704.1|  hypothetical protein EUGRSUZ_F03098                   66.6    4e-10   Eucalyptus grandis [rose gum]
ref|XP_009784520.1|  PREDICTED: uncharacterized protein LOC104232941  68.9    4e-10   Nicotiana sylvestris
ref|XP_004964114.1|  PREDICTED: mannose/glucose-specific lectin-like  64.7    4e-10   
ref|XP_004974871.1|  PREDICTED: mannose/glucose-specific lectin-like  66.6    4e-10   
gb|EYU45843.1|  hypothetical protein MIMGU_mgv1a014002mg              65.9    5e-10   Erythranthe guttata [common monkey flower]
tpg|DAA60181.1|  TPA: hypothetical protein ZEAMMB73_326702            67.0    5e-10   
gb|EAY90359.1|  hypothetical protein OsI_11939                        65.1    5e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_007216928.1|  hypothetical protein PRUPE_ppa016643mg           67.4    6e-10   
gb|EEE52450.1|  hypothetical protein OsJ_34606                        67.4    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663456.1|  PREDICTED: disease resistance protein RPM1-like  68.6    6e-10   
ref|XP_004984089.1|  PREDICTED: protein GOS9-like                     64.7    6e-10   Setaria italica
ref|XP_010231090.1|  PREDICTED: jacalin-related lectin 19-like is...  65.9    6e-10   Brachypodium distachyon [annual false brome]
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...  68.6    7e-10   Nicotiana sylvestris
ref|XP_010932856.1|  PREDICTED: mannose/glucose-specific lectin-l...  66.2    7e-10   
ref|XP_006838698.1|  hypothetical protein AMTR_s00002p00248970        64.7    7e-10   
ref|XP_010062570.1|  PREDICTED: jacalin-related lectin 19             66.2    7e-10   Eucalyptus grandis [rose gum]
ref|XP_009760249.1|  PREDICTED: agglutinin-like                       67.0    8e-10   Nicotiana sylvestris
ref|XP_008466548.1|  PREDICTED: agglutinin-like                       67.4    8e-10   Cucumis melo [Oriental melon]
gb|ABA94732.1|  Jacalin-like lectin domain containing protein, ex...  67.8    8e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010110011.1|  hypothetical protein L484_021900                 68.2    8e-10   
ref|XP_010231088.1|  PREDICTED: jacalin-related lectin 19-like is...  65.9    8e-10   Brachypodium distachyon [annual false brome]
ref|XP_010231089.1|  PREDICTED: jacalin-related lectin 19-like is...  65.5    8e-10   Brachypodium distachyon [annual false brome]
ref|NP_001141303.1|  uncharacterized protein LOC100273394             66.6    8e-10   
emb|CDO97947.1|  unnamed protein product                              66.2    9e-10   Coffea canephora [robusta coffee]
ref|XP_010064569.1|  PREDICTED: jacalin-related lectin 4-like         67.8    9e-10   
ref|XP_008221341.1|  PREDICTED: uncharacterized protein LOC103321320  67.8    9e-10   Prunus mume [ume]
ref|XP_007222058.1|  hypothetical protein PRUPE_ppa003185mg           67.4    9e-10   
gb|AAM46813.1|  hessian fly response gene 1 protein                   66.6    1e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007142198.1|  hypothetical protein PHAVU_008G260500g           67.4    1e-09   Phaseolus vulgaris [French bean]
gb|KHG23822.1|  Agglutinin alpha chain                                64.7    1e-09   Gossypium arboreum [tree cotton]
ref|XP_011001798.1|  PREDICTED: mannose/glucose-specific lectin-l...  67.0    1e-09   Populus euphratica
ref|XP_007142199.1|  hypothetical protein PHAVU_008G260500g           67.4    1e-09   Phaseolus vulgaris [French bean]
ref|XP_008677995.1|  PREDICTED: mannose/glucose-specific lectin-l...  67.4    1e-09   
ref|XP_011001797.1|  PREDICTED: mannose/glucose-specific lectin-l...  67.0    1e-09   Populus euphratica
ref|XP_006372328.1|  hypothetical protein POPTR_0017s00620g           63.9    1e-09   
pdb|4MQ0|A  Chain A, Crystal Structure Of Parkia Biglobosa Seed L...  66.6    1e-09   Parkia biglobosa
emb|CAJ38387.1|  jacalin-domain protein                               64.3    1e-09   Plantago major [cart-track plant]
ref|NP_001104964.1|  beta-glucosidase aggregating factor precursor    65.9    1e-09   
gb|ABJ97445.1|  beta-glucosidase aggregating factor 1                 65.9    1e-09   Zea mays [maize]
ref|XP_002515891.1|  hypothetical protein RCOM_1485780                66.6    2e-09   
ref|XP_010110012.1|  hypothetical protein L484_021901                 67.0    2e-09   
gb|EMS53468.1|  hypothetical protein TRIUR3_21407                     63.2    2e-09   Triticum urartu
ref|NP_001068257.2|  Os11g0607900                                     62.8    2e-09   
gb|KJB70346.1|  hypothetical protein B456_011G068300                  63.9    2e-09   Gossypium raimondii
ref|XP_006416472.1|  hypothetical protein EUTSA_v10007145mg           66.6    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_006597181.1|  PREDICTED: agglutinin-like isoform X1            66.6    2e-09   Glycine max [soybeans]
ref|XP_007017646.1|  Mannose-binding lectin superfamily protein, ...  66.6    2e-09   
ref|XP_010664949.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    2e-09   
ref|XP_010312054.1|  PREDICTED: jacalin-related lectin 3 isoform X1   66.6    2e-09   
ref|XP_011001796.1|  PREDICTED: mannose/glucose-specific lectin-l...  66.6    2e-09   Populus euphratica
gb|EYU45162.1|  hypothetical protein MIMGU_mgv1a025414mg              65.9    2e-09   Erythranthe guttata [common monkey flower]
ref|XP_006838705.1|  hypothetical protein AMTR_s00002p00249920        66.6    2e-09   Amborella trichopoda
gb|KDP40814.1|  hypothetical protein JCGZ_24813                       63.9    2e-09   Jatropha curcas
ref|XP_011028924.1|  PREDICTED: uncharacterized protein LOC105128...  67.0    2e-09   Populus euphratica
gb|KCW69706.1|  hypothetical protein EUGRSUZ_F03098                   64.3    2e-09   Eucalyptus grandis [rose gum]
ref|XP_007017648.1|  Mannose-binding lectin superfamily protein, ...  66.6    2e-09   
ref|XP_009608047.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  67.0    2e-09   
ref|XP_011074623.1|  PREDICTED: jacalin-related lectin 3              66.6    2e-09   Sesamum indicum [beniseed]
gb|AAZ73669.1|  At1g19715-like protein                                63.5    2e-09   Arabidopsis lyrata [lyrate rockcress]
emb|CDM80401.1|  unnamed protein product                              64.7    2e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004164005.1|  PREDICTED: agglutinin-like                       63.5    2e-09   
ref|XP_004249154.1|  PREDICTED: jacalin-related lectin 3 isoform X2   66.2    2e-09   
ref|XP_010237569.1|  PREDICTED: mannose/glucose-specific lectin-l...  66.6    2e-09   
ref|XP_006654724.1|  PREDICTED: agglutinin-like                       63.5    2e-09   
ref|XP_010236764.1|  PREDICTED: jacalin-related lectin 19-like        63.2    3e-09   
ref|XP_011015046.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.9    3e-09   Populus euphratica
ref|XP_008651439.1|  PREDICTED: jasmonate-induced protein isoform X1  65.1    3e-09   
ref|XP_006362248.1|  PREDICTED: myrosinase-binding protein-like A...  66.2    3e-09   Solanum tuberosum [potatoes]
ref|XP_010092351.1|  hypothetical protein L484_023729                 63.5    3e-09   
ref|XP_002449838.1|  hypothetical protein SORBIDRAFT_05g024220        64.7    3e-09   
ref|XP_010239309.1|  PREDICTED: LOW QUALITY PROTEIN: protein GOS9...  64.3    3e-09   Brachypodium distachyon [annual false brome]
ref|XP_002300741.2|  hypothetical protein POPTR_0002s03180g           65.9    3e-09   
ref|XP_011015045.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.9    3e-09   Populus euphratica
gb|KCW67999.1|  hypothetical protein EUGRSUZ_F01690                   66.2    3e-09   Eucalyptus grandis [rose gum]
ref|XP_003577374.2|  PREDICTED: mannose/glucose-specific lectin-l...  65.9    3e-09   
gb|AFK34206.1|  unknown                                               63.2    3e-09   Lotus japonicus
gb|KCW67998.1|  hypothetical protein EUGRSUZ_F01690                   66.2    3e-09   Eucalyptus grandis [rose gum]
ref|XP_006362247.1|  PREDICTED: myrosinase-binding protein-like A...  65.9    3e-09   Solanum tuberosum [potatoes]
ref|XP_003575754.1|  PREDICTED: uncharacterized protein LOC100829827  65.1    4e-09   Brachypodium distachyon [annual false brome]
gb|KJB63589.1|  hypothetical protein B456_010G007400                  65.9    4e-09   Gossypium raimondii
gb|EMT07336.1|  hypothetical protein F775_29709                       65.1    4e-09   
ref|XP_009599288.1|  PREDICTED: jacalin-related lectin 3 isoform X1   65.9    4e-09   Nicotiana tomentosiformis
ref|XP_009599289.1|  PREDICTED: jacalin-related lectin 3 isoform X2   65.9    4e-09   Nicotiana tomentosiformis
ref|XP_010935305.1|  PREDICTED: jacalin-related lectin 3-like         65.5    4e-09   
ref|XP_010932909.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.3    4e-09   
ref|XP_007146775.1|  hypothetical protein PHAVU_006G068800g           65.5    5e-09   
ref|XP_010932917.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.3    5e-09   
gb|EEE60415.1|  hypothetical protein OsJ_13609                        61.2    6e-09   
ref|XP_008466549.1|  PREDICTED: agglutinin-like                       64.7    6e-09   
gb|AAB22274.1|  jacalin heavy chain, agglutinin heavy chain=Thoms...  61.6    6e-09   
ref|XP_002467725.1|  hypothetical protein SORBIDRAFT_01g033090        62.0    6e-09   
ref|XP_004147879.1|  PREDICTED: uncharacterized protein LOC101206551  65.5    6e-09   
ref|XP_006597184.1|  PREDICTED: agglutinin-like isoform X4            62.4    6e-09   
gb|KHN32674.1|  Agglutinin alpha chain                                62.4    6e-09   
emb|CBI19765.3|  unnamed protein product                              65.1    7e-09   
gb|AAZ73661.1|  At1g19715                                             62.0    7e-09   
ref|XP_006306414.1|  hypothetical protein CARUB_v10012347mg           65.1    7e-09   
ref|XP_008466552.1|  PREDICTED: agglutinin-like                       62.0    7e-09   
ref|XP_008391447.1|  PREDICTED: uncharacterized protein LOC103453663  64.3    7e-09   
ref|XP_009622527.1|  PREDICTED: agglutinin-like isoform X4            64.7    7e-09   
gb|AAZ73664.1|  At1g19715                                             62.0    7e-09   
ref|XP_009622528.1|  PREDICTED: agglutinin-like isoform X5            64.7    7e-09   
ref|XP_009614721.1|  PREDICTED: jacalin-related lectin 19             62.8    7e-09   
emb|CDX96652.1|  BnaA08g21950D                                        64.7    7e-09   
ref|XP_009110261.1|  PREDICTED: agglutinin-like                       64.7    8e-09   
ref|XP_010030903.1|  PREDICTED: agglutinin alpha chain-like           60.8    8e-09   
ref|XP_010459648.1|  PREDICTED: jacalin-related lectin 3 isoform X1   64.7    8e-09   
ref|XP_006383725.1|  hypothetical protein POPTR_0005s25400g           64.3    8e-09   
gb|KDP38565.1|  hypothetical protein JCGZ_04490                       64.7    8e-09   
gb|KEH34301.1|  mannose-binding lectin superfamily protein            64.7    8e-09   
ref|XP_009622526.1|  PREDICTED: agglutinin-like isoform X3            64.7    8e-09   
emb|CDY63700.1|  BnaC08g19180D                                        64.7    9e-09   
gb|AAZ73652.1|  At1g19715                                             61.6    9e-09   
ref|XP_009771019.1|  PREDICTED: jacalin-related lectin 3 isoform X1   64.7    9e-09   
ref|XP_009771020.1|  PREDICTED: jacalin-related lectin 3 isoform X2   64.7    9e-09   
ref|NP_001140746.1|  hypothetical protein                             64.3    9e-09   
ref|XP_006595102.1|  PREDICTED: agglutinin                            62.0    9e-09   
gb|KHN30030.1|  Agglutinin alpha chain                                61.6    9e-09   
emb|CAE76030.1|  B1292H11.16                                          61.2    1e-08   
ref|XP_004960703.1|  PREDICTED: agglutinin-like                       63.5    1e-08   
ref|XP_002440040.1|  hypothetical protein SORBIDRAFT_09g024950        64.3    1e-08   
emb|CDM83580.1|  unnamed protein product                              63.9    1e-08   
gb|EAY98637.1|  hypothetical protein OsI_20561                        64.3    1e-08   
gb|EEE64302.1|  hypothetical protein OsJ_19139                        64.7    1e-08   
ref|XP_006662244.1|  PREDICTED: uncharacterized protein LOC102708001  63.5    1e-08   
ref|NP_001055995.1|  Os05g0508400                                     64.3    1e-08   
emb|CDM86053.1|  unnamed protein product                              63.9    1e-08   
gb|KFK44089.1|  hypothetical protein AALP_AA1G214700                  64.3    1e-08   
gb|EMT16343.1|  Cysteine-rich receptor-like protein kinase 41         64.3    1e-08   
ref|XP_010498396.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    1e-08   
ref|XP_011028923.1|  PREDICTED: jacalin-related lectin 3-like iso...  64.3    1e-08   
ref|XP_004960702.1|  PREDICTED: mannose/glucose-specific lectin-like  63.5    1e-08   
pdb|1TOQ|A  Chain A, Crystal Structure Of A Galactose Specific Le...  60.8    1e-08   
ref|XP_010477194.1|  PREDICTED: jacalin-related lectin 3-like iso...  64.3    1e-08   
gb|EMT07330.1|  Disease resistance protein RPM1                       64.3    1e-08   
gb|KEH39537.1|  mannose-binding lectin superfamily protein            61.6    1e-08   
ref|XP_009384641.1|  PREDICTED: agglutinin alpha chain-like isofo...  61.6    1e-08   
emb|CDP07465.1|  unnamed protein product                              63.9    1e-08   
ref|XP_006654618.1|  PREDICTED: myrosinase-binding protein-like A...  63.9    1e-08   
ref|XP_010477195.1|  PREDICTED: jacalin-related lectin 3-like iso...  63.9    1e-08   
ref|XP_008804538.1|  PREDICTED: uncharacterized protein LOC103717797  63.9    1e-08   
gb|KDP31690.1|  hypothetical protein JCGZ_15015                       63.9    1e-08   
ref|XP_009384722.1|  PREDICTED: agglutinin alpha chain-like isofo...  61.2    2e-08   
gb|KEH39538.1|  mannose-binding lectin superfamily protein            61.6    2e-08   
ref|XP_011048836.1|  PREDICTED: jacalin-related lectin 3-like iso...  63.5    2e-08   
gb|KEH39536.1|  mannose-binding lectin superfamily protein            61.2    2e-08   
ref|XP_011048835.1|  PREDICTED: jacalin-related lectin 3-like iso...  63.5    2e-08   
ref|XP_011001803.1|  PREDICTED: mannose/glucose-specific lectin-like  63.5    2e-08   
gb|EMT04092.1|  hypothetical protein F775_28592                       63.2    2e-08   
gb|AAC49284.1|  unknown                                               63.2    2e-08   
gb|KDP46660.1|  hypothetical protein JCGZ_10969                       63.5    2e-08   
ref|XP_009588746.1|  PREDICTED: putative late blight resistance p...  63.9    2e-08   
ref|XP_009588743.1|  PREDICTED: putative late blight resistance p...  63.9    2e-08   
ref|XP_004147859.1|  PREDICTED: myrosinase-binding protein-like A...  63.5    2e-08   
ref|XP_002893064.1|  hypothetical protein ARALYDRAFT_472198           63.9    2e-08   
ref|XP_004500273.1|  PREDICTED: agglutinin-like                       63.5    2e-08   
pdb|3P8S|A  Chain A, Crystal Structure Of Single Chain Recombinan...  60.5    2e-08   
ref|NP_849691.1|  Mannose-binding lectin superfamily protein          63.5    2e-08   
ref|NP_001185041.1|  Mannose-binding lectin superfamily protein       63.5    2e-08   
ref|NP_001176790.1|  Os12g0144100                                     59.3    2e-08   
ref|XP_004977415.1|  PREDICTED: uncharacterized protein LOC101784...  62.8    2e-08   
ref|NP_001117315.1|  Mannose-binding lectin superfamily protein       63.5    2e-08   
ref|XP_009413293.1|  PREDICTED: protein GOS9-like                     60.1    2e-08   
ref|XP_002893063.1|  jacalin lectin family protein                    63.5    2e-08   
ref|XP_006662272.1|  PREDICTED: uncharacterized protein LOC102701759  62.4    2e-08   
ref|XP_010320536.1|  PREDICTED: mannose/glucose-specific lectin-like  60.8    2e-08   
ref|XP_008388156.1|  PREDICTED: uncharacterized protein LOC103450568  63.2    2e-08   
gb|KHN02073.1|  Agglutinin                                            63.2    2e-08   
ref|XP_010477196.1|  PREDICTED: pentatricopeptide repeat-containi...  63.5    2e-08   
ref|XP_009608045.1|  PREDICTED: putative late blight resistance p...  63.5    2e-08   
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...  63.5    2e-08   
gb|AAA32677.1|  jacalin                                               61.2    3e-08   
ref|XP_010109960.1|  hypothetical protein L484_009242                 60.8    3e-08   
ref|XP_010059625.1|  PREDICTED: jacalin-related lectin 4-like         63.5    3e-08   
ref|XP_002281330.1|  PREDICTED: jacalin-related lectin 19-like        60.5    3e-08   
emb|CDM86063.1|  unnamed protein product                              63.2    3e-08   
ref|XP_006644795.1|  PREDICTED: mannose/glucose-specific lectin-like  63.2    3e-08   
emb|CBI35989.3|  unnamed protein product                              60.8    3e-08   
gb|AFW82809.1|  hypothetical protein ZEAMMB73_630227                  60.8    3e-08   
gb|ABA94721.1|  Jacalin-like lectin domain containing protein         63.2    3e-08   
gb|EAY92859.1|  hypothetical protein OsI_14658                        61.2    3e-08   
gb|EEE68468.1|  hypothetical protein OsJ_26865                        62.8    3e-08   
gb|AAL09163.1|  galactose-binding lectin                              60.8    3e-08   
ref|XP_006602089.1|  PREDICTED: agglutinin-like                       62.8    3e-08   
ref|XP_008656248.1|  PREDICTED: putative receptor-like protein ki...  62.8    3e-08   
ref|XP_010674585.1|  PREDICTED: uncharacterized protein LOC104890703  63.2    3e-08   
gb|AFW81812.1|  putative protein kinase superfamily protein           62.8    3e-08   
gb|AAB23126.1|  jacalin minor alpha'-subunit=65 kda lectin minor ...  59.7    3e-08   
emb|CDY39357.1|  BnaC05g15300D                                        62.8    3e-08   
gb|EMT33622.1|  Cysteine proteinase RD21a                             62.8    4e-08   
ref|NP_001044410.1|  Os01g0775500                                     62.0    4e-08   
ref|XP_009336846.1|  PREDICTED: uncharacterized protein LOC103929382  62.4    4e-08   
ref|XP_004961574.1|  PREDICTED: mannose/glucose-specific lectin-like  62.8    4e-08   
ref|XP_009149456.1|  PREDICTED: agglutinin                            62.4    4e-08   
dbj|BAJ85606.1|  predicted protein                                    62.4    4e-08   
ref|XP_010099935.1|  hypothetical protein L484_020123                 60.5    4e-08   
ref|XP_009417114.1|  PREDICTED: horcolin {ECO:0000312|EMBL:AAV395...  59.3    4e-08   
ref|XP_009782510.1|  PREDICTED: jacalin-related lectin 19             60.5    4e-08   
ref|XP_010227994.1|  PREDICTED: jacalin-related lectin 3-like         61.6    5e-08   
dbj|BAJ88436.1|  predicted protein                                    62.4    5e-08   
sp|P18670.2|LECA_ARTIN  RecName: Full=Agglutinin alpha chain; Alt...  58.9    5e-08   
ref|XP_010099937.1|  hypothetical protein L484_020125                 62.0    5e-08   
ref|XP_010320393.1|  PREDICTED: jacalin-related lectin 3-like         61.6    5e-08   
gb|EMS46735.1|  hypothetical protein TRIUR3_02016                     61.6    5e-08   
pdb|1UGW|A  Chain A, Crystal Structure Of Jacalin- Gal Complex        58.9    6e-08   
gb|EMS47225.1|  hypothetical protein TRIUR3_25909                     61.6    6e-08   
ref|XP_004170416.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  61.6    6e-08   
gb|AAA32679.1|  jacalin                                               60.1    6e-08   
gb|ABA96465.1|  Protein GOS9, putative                                58.5    6e-08   
ref|XP_009413935.1|  PREDICTED: protein GOS9-like                     58.9    7e-08   
gb|EEC71570.1|  hypothetical protein OsI_03937                        62.0    7e-08   
gb|EEE55471.1|  hypothetical protein OsJ_03649                        62.0    7e-08   
ref|XP_010026053.1|  PREDICTED: jacalin-related lectin 3-like         60.5    7e-08   
ref|XP_003578760.1|  PREDICTED: mannose/glucose-specific lectin-like  61.2    7e-08   
gb|AAA32678.1|  jacalin                                               60.1    7e-08   
pdb|4AKB|A  Chain A, Structure Of Galactose Binding Lectin From C...  58.5    8e-08   
gb|KDP46650.1|  hypothetical protein JCGZ_10959                       61.6    8e-08   
pdb|4AK4|A  Chain A, High Resolution Structure Of Galactose Bindi...  58.5    8e-08   
gb|AAA32680.1|  jacalin                                               59.7    8e-08   
gb|KFK35812.1|  hypothetical protein AALP_AA4G040800                  59.7    8e-08   
gb|ABF96452.1|  Jacalin-like lectin domain containing protein, ex...  58.9    9e-08   
ref|XP_010537548.1|  PREDICTED: LOW QUALITY PROTEIN: jacalin-rela...  58.9    9e-08   
gb|ABC70328.1|  agglutinin isoform                                    60.8    9e-08   
sp|P82859.1|LECA_CASCR  RecName: Full=Agglutinin; AltName: Full=CCA   60.8    1e-07   
pdb|4AKD|A  Chain A, High Resolution Structure Of Mannose Binding...  58.5    1e-07   
ref|XP_010029744.1|  PREDICTED: jacalin-related lectin 4-like         61.6    1e-07   
gb|AAK55472.1|AC084295_5  putative salt-induced protein               58.9    1e-07   
ref|XP_008671662.1|  PREDICTED: horcolin-like                         58.9    1e-07   
ref|XP_011048832.1|  PREDICTED: jacalin-related lectin 3-like iso...  61.2    1e-07   
ref|XP_010545658.1|  PREDICTED: nitrile-specifier protein 2-like      61.2    1e-07   
emb|CDM86052.1|  unnamed protein product                              60.8    1e-07   
ref|NP_001050311.2|  Os03g0399800                                     58.9    1e-07   
gb|EYU34206.1|  hypothetical protein MIMGU_mgv1a025615mg              60.5    1e-07   
gb|AEE92792.1|  lectin                                                59.3    1e-07   
ref|XP_009614655.1|  PREDICTED: mannose/glucose-specific lectin-like  58.2    1e-07   
gb|EMT31922.1|  hypothetical protein F775_02779                       58.5    1e-07   
ref|XP_010233169.1|  PREDICTED: jacalin-related lectin 3-like         61.2    1e-07   
gb|EYU36743.1|  hypothetical protein MIMGU_mgv1a007927mg              60.5    1e-07   
ref|XP_011048833.1|  PREDICTED: jacalin-related lectin 3-like iso...  60.8    1e-07   
gb|KCW56701.1|  hypothetical protein EUGRSUZ_I02393                   60.8    1e-07   
ref|XP_003576339.1|  PREDICTED: jacalin-related lectin 3-like         60.1    1e-07   
pdb|1VBP|A  Chain A, Crystal Structure Of Artocarpin-Mannopentose...  57.8    2e-07   
pdb|1VBO|A  Chain A, Crystal Structure Of Artocarpin-Mannotriose ...  57.8    2e-07   
gb|EAZ25557.1|  hypothetical protein OsJ_09383                        57.4    2e-07   
pdb|1J4S|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  57.8    2e-07   
pdb|1J4T|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  57.8    2e-07   
ref|XP_006383724.1|  hypothetical protein POPTR_0005s25390g           60.5    2e-07   
ref|XP_009114784.1|  PREDICTED: myrosinase-binding protein-like A...  60.5    2e-07   
gb|EMT07620.1|  hypothetical protein F775_29169                       60.1    2e-07   
ref|XP_006651478.1|  PREDICTED: horcolin-like                         58.2    2e-07   
dbj|BAF02001.1|  hypothetical protein                                 57.8    2e-07   
gb|ABS86033.1|  mannose-specific recombinant lectin                   57.8    2e-07   
emb|CDY20195.1|  BnaA01g28070D                                        60.5    2e-07   
gb|ACN33395.1|  unknown                                               60.1    2e-07   
ref|XP_002883010.1|  jacalin lectin family protein                    60.5    2e-07   
ref|NP_001183767.1|  hypothetical protein                             58.2    2e-07   
ref|XP_010100192.1|  hypothetical protein L484_015337                 57.8    2e-07   
ref|XP_004979687.1|  PREDICTED: myrosinase-binding protein-like A...  60.1    2e-07   
ref|XP_008782838.1|  PREDICTED: agglutinin alpha chain-like           58.5    2e-07   
ref|XP_010501974.1|  PREDICTED: myrosinase-binding protein 1-like     59.7    2e-07   
ref|XP_003573652.1|  PREDICTED: horcolin-like                         56.6    2e-07   
gb|KGN59976.1|  hypothetical protein Csa_3G859630                     60.1    2e-07   
ref|NP_175616.1|  myrosinase-binding protein 1                        60.1    2e-07   
gb|AAK82527.1|  At1g52040/F5F19_10                                    60.1    2e-07   
gb|EMS51477.1|  Mannose/glucose-specific lectin                       59.7    2e-07   
sp|Q9M5W9.1|JAL6L_ARATH  RecName: Full=Myrosinase-binding protein...  60.1    2e-07   
tpg|DAA39774.1|  TPA: hypothetical protein ZEAMMB73_034611            57.4    2e-07   
sp|O65187.1|JAL7L_ARATH  RecName: Full=Myrosinase-binding protein...  60.1    3e-07   
ref|XP_010320537.1|  PREDICTED: agglutinin-like                       57.4    3e-07   
gb|EMT07556.1|  hypothetical protein F775_11805                       56.6    3e-07   
ref|NP_001174671.1|  Os06g0226050                                     57.0    3e-07   
gb|EMT29229.1|  B3 domain-containing protein                          60.1    3e-07   
gb|EEC79620.1|  hypothetical protein OsI_20824                        58.2    3e-07   
sp|P18674.2|LECA_MACPO  RecName: Full=Agglutinin alpha chain; Alt...  56.6    3e-07   
ref|XP_004970153.1|  PREDICTED: myrosinase-binding protein-like A...  59.7    3e-07   
emb|CDM80828.1|  unnamed protein product                              56.6    4e-07   
gb|EEE59214.1|  hypothetical protein OsJ_11170                        58.9    4e-07   
ref|XP_010026052.1|  PREDICTED: agglutinin-like                       57.0    4e-07   
gb|EEC83910.1|  hypothetical protein OsI_29960                        58.9    4e-07   
gb|ABI24164.1|  beta-glucosidase aggregating factor                   58.9    5e-07   
ref|XP_002461767.1|  hypothetical protein SORBIDRAFT_02g007750        58.9    5e-07   
ref|XP_010501971.1|  PREDICTED: myrosinase-binding protein 1-like     59.3    5e-07   
ref|XP_008677750.1|  PREDICTED: hypothetical protein isoform X2       58.2    5e-07   
ref|XP_010030259.1|  PREDICTED: jacalin-related lectin 3-like         58.9    5e-07   
ref|XP_006342218.1|  PREDICTED: agglutinin-like                       58.9    5e-07   
gb|KDP38344.1|  hypothetical protein JCGZ_04269                       59.3    5e-07   
ref|XP_004147880.1|  PREDICTED: mannose/glucose-specific lectin-like  58.5    6e-07   
gb|EMS65495.1|  hypothetical protein TRIUR3_18396                     58.9    6e-07   
ref|XP_004959227.1|  PREDICTED: salt stress-induced protein-like      57.4    6e-07   
ref|XP_010545655.1|  PREDICTED: myrosinase-binding protein 1-like     58.9    6e-07   
gb|EMS47771.1|  hypothetical protein TRIUR3_34363                     55.8    6e-07   
emb|CDM85887.1|  unnamed protein product                              58.5    6e-07   
gb|KHN34265.1|  Agglutinin                                            58.9    6e-07   
ref|XP_003539332.1|  PREDICTED: agglutinin-like isoform X1            58.9    7e-07   
dbj|BAD95192.1|  hypothetical protein                                 57.0    7e-07   
ref|XP_006591219.1|  PREDICTED: agglutinin-like isoform X2            58.9    7e-07   
ref|XP_002894350.1|  myrosinase-binding protein 2                     58.9    7e-07   
ref|XP_008677749.1|  PREDICTED: hypothetical protein isoform X1       58.2    7e-07   
gb|EEE69027.1|  hypothetical protein OsJ_28001                        58.5    7e-07   
ref|XP_004979688.1|  PREDICTED: mannose/glucose-specific lectin-like  58.2    8e-07   
gb|EAY82243.1|  hypothetical protein OsI_37448                        58.2    8e-07   
ref|XP_002440568.1|  hypothetical protein SORBIDRAFT_09g003330        55.5    8e-07   
ref|XP_010029925.1|  PREDICTED: agglutinin-like                       58.5    8e-07   
gb|KCW56858.1|  hypothetical protein EUGRSUZ_I02520                   58.9    8e-07   



>gb|AAG10403.1|AF233284_1 mannose-binding lectin [Convolvulus arvensis]
Length=152

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 114/155 (74%), Gaps = 6/155 (4%)
 Frame = +3

Query  36   MAISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCL  215
            M +  D   GP G+NGG+FWSFRP+NKI+QI+I      N   +  TFS+T  DGSKD +
Sbjct  1    MTVPIDTISGPWGNNGGNFWSFRPINKINQIVITYSAGNNPIAL--TFSATKADGSKDTI  58

Query  216  TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG  395
            T+GG G ++ +   DT++I GADEY+T ISG FG ++D   +VLRS+KF TN++A+GPYG
Sbjct  59   TVGGAGPDS-ITGTDTVDI-GADEYVTGISGTFGIYLDN--NVLRSIKFITNLKAYGPYG  114

Query  396  PNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYN  500
            PNVGTPF+ +   G +IVGF GR+G+YVDAIGTYN
Sbjct  115  PNVGTPFSSENVVGNEIVGFLGRSGYYVDAIGTYN  149



>gb|AAC49564.1| lectin [Calystegia sepium]
Length=153

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 113/155 (73%), Gaps = 5/155 (3%)
 Frame = +3

Query  36   MAISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCL  215
            MA+  D   GP G+NGG+FWSFRP+NKI+QI+I  GG GNN     TFSST  DGSKD +
Sbjct  1    MAVPMDTISGPWGNNGGNFWSFRPVNKINQIVISYGGGGNNPIAL-TFSSTKADGSKDTI  59

Query  216  TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG  395
            T+GGGG ++ +   + +NI G DEYLT ISG FG ++D   +VLRS+ FTTN++A GPYG
Sbjct  60   TVGGGGPDS-ITGTEMVNI-GTDEYLTGISGTFGIYLDN--NVLRSITFTTNLKAHGPYG  115

Query  396  PNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYN  500
              VGTPF+     G +IVGF GR+G+YVDAIGTYN
Sbjct  116  QKVGTPFSSANVVGNEIVGFLGRSGYYVDAIGTYN  150



>pdb|1OUW|A Chain A, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|B Chain B, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|C Chain C, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|D Chain D, Crystal Structure Of Calystegia Sepium Agglutinin
Length=152

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 111/153 (73%), Gaps = 5/153 (3%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTI  221
            +  D   GP G+NGG+FWSFRP+NKI+QI+I  GG GNN     TFSST  DGSKD +T+
Sbjct  2    VPMDTISGPWGNNGGNFWSFRPVNKINQIVISYGGGGNNPIAL-TFSSTKADGSKDTITV  60

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GGGG ++ +   + +NI G DEYLT ISG FG ++D   +VLRS+ FTTN++A GPYG  
Sbjct  61   GGGGPDS-ITGTEMVNI-GTDEYLTGISGTFGIYLDN--NVLRSITFTTNLKAHGPYGQK  116

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYN  500
            VGTPF+     G +IVGF GR+G+YVDAIGTYN
Sbjct  117  VGTPFSSANVVGNEIVGFLGRSGYYVDAIGTYN  149



>dbj|BAA14024.1| ipomoelin [Ipomoea batatas]
Length=154

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 99/156 (63%), Gaps = 12/156 (8%)
 Frame = +3

Query  36   MAISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggs--gnnnpigiTFSSTNKDGSKD  209
            +A  +D   GP+G NGG FWSFRP+  +++I++   GS     N I ITFSS       D
Sbjct  5    LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSN----PTD  60

Query  210  CLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGP  389
             +T+GG G E  +   +T+NIDG    + EISG    +    ++V+RS+KFTTN + +GP
Sbjct  61   IITVGGVGPEP-LTYTETVNIDGD---IIEISGMIANY--KGYNVIRSIKFTTNKKEYGP  114

Query  390  YGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            YG N GTPFN +  DG KIVGFFG +G+YVDAIG Y
Sbjct  115  YGANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAY  150



>pdb|3R50|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|E Chain E, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
Length=160

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 99/156 (63%), Gaps = 12/156 (8%)
 Frame = +3

Query  36   MAISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggs--gnnnpigiTFSSTNKDGSKD  209
            +A  +D   GP+G NGG FWSFRP+  +++I++   GS     N I ITFSS       D
Sbjct  11   LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSN----PTD  66

Query  210  CLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGP  389
             +T+GG G E  +   +T+NIDG    + EISG    +    ++V+RS+KFTTN + +GP
Sbjct  67   IITVGGVGPEP-LTYTETVNIDGD---IIEISGMIANY--KGYNVIRSIKFTTNKKEYGP  120

Query  390  YGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            YG N GTPFN +  DG KIVGFFG +G+YVDAIG Y
Sbjct  121  YGANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAY  156



>gb|AAA87042.1| putative 32.7 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72097.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 7/92 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+ T +        GA E++ E+SG FG +   R +++ S+KF TNV+ +GP+G  
Sbjct  216  GSGGNQNTFVL-------GASEFMKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEA  268

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF   AQ  + IVGFFGR+G Y+DA+G Y
Sbjct  269  KGTPFTIPAQKNSSIVGFFGRSGIYLDALGVY  300



>gb|ABA93998.1| NB-ARC domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=1384

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 57/92 (62%), Gaps = 7/92 (8%)
 Frame = +3

Query  222   GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
             G GGN   +I+       G  E+L E+SG FGRF     D++ S+ F TN +++GPYG  
Sbjct  1026  GYGGNNVHMIQL------GPSEFLVEVSGTFGRF-RAALDIITSLTFVTNAQSYGPYGQR  1078

Query  402   VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              GTPF+   Q    IVGFFGRAG+YVDAIG Y
Sbjct  1079  EGTPFHISVQSRGCIVGFFGRAGWYVDAIGIY  1110


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 52/92 (57%), Gaps = 5/92 (5%)
 Frame = +3

Query  222   GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
             GG G +     +D +   G  E LT +SG FG + +T +DV+ S+   TN+  +GP+G  
Sbjct  1133  GGNGGKA----HDIMIQFGPSELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKE  1187

Query  402   VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              G  FNF  Q    IVGFFG A  Y+DAIG Y
Sbjct  1188  KGISFNFPIQGNGSIVGFFGHAELYIDAIGVY  1219



>gb|EEE52195.1| hypothetical protein OsJ_34074 [Oryza sativa Japonica Group]
Length=1311

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 45/92 (49%), Positives = 57/92 (62%), Gaps = 7/92 (8%)
 Frame = +3

Query  222   GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
             G GGN   +I+       G  E+L E+SG FGRF     D++ S+ F TN +++GPYG  
Sbjct  958   GYGGNNVHMIQL------GPSEFLVEVSGTFGRF-RAALDIITSLTFVTNAQSYGPYGQR  1010

Query  402   VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              GTPF+   Q    IVGFFGRAG+YVDAIG Y
Sbjct  1011  EGTPFHISVQSRGCIVGFFGRAGWYVDAIGIY  1042


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  276   GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
             G  E LT +SG FG + +T +DV+ S+   TN+  +GP+G   G  FNF  Q    IVGF
Sbjct  1079  GPSELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGF  1137

Query  456   FGRAGFYVDAIGTY  497
             FG A  Y+DAIG Y
Sbjct  1138  FGHAELYIDAIGVY  1151


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 42/109 (39%), Positives = 57/109 (52%), Gaps = 7/109 (6%)
 Frame = +3

Query  174   TFSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
             TFS  + DG +  L   GGG E     N  IN+ G  E++T++ G FG F +    V+ S
Sbjct  1205  TFSYRSHDGLQYILGPWGGGGEN----NYKINL-GPSEFITKVHGTFGPFGEFPI-VITS  1258

Query  354   VKFTTNV-RAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             + F  N    +GP+G   GTPF+        IVGFFG  G  ++AIG Y
Sbjct  1259  LTFINNAGHQYGPFGQGGGTPFHAPISGNGSIVGFFGHQGACLEAIGFY  1307



>gb|EEC68267.1| hypothetical protein OsI_36302 [Oryza sativa Indica Group]
Length=1396

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 7/92 (8%)
 Frame = +3

Query  222   GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
             G GGN   +I+       G  E+L E+SG FGRF     +++ S+ F TN +++GPYG  
Sbjct  998   GYGGNNVHMIQL------GPSEFLVEVSGTFGRF-RAALNIITSLTFVTNAQSYGPYGQR  1050

Query  402   VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              GTPF+   Q    IVGFFGRAG+YVDAIG Y
Sbjct  1051  EGTPFHIPVQSSGCIVGFFGRAGWYVDAIGIY  1082


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 58/109 (53%), Gaps = 10/109 (9%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTI--GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLR  350
             FS ++ DG         G GGN      N TI   G  E LT +SG FG + +T +DV+ 
Sbjct  1137  FSYSDHDGQHHTAGPWGGDGGN------NQTIQF-GPSELLTTVSGTFGSY-NTSYDVIT  1188

Query  351   SVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             S+   TN+  +GP+G   G  FNF  Q    IVGFFG A  Y+DAIG Y
Sbjct  1189  SITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFFGHAELYIDAIGVY  1237


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 41/109 (38%), Positives = 57/109 (52%), Gaps = 7/109 (6%)
 Frame = +3

Query  174   TFSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
             TFS  + DG +  L   GGG E     N  IN+ G  E++T++ G FG + +    V+ S
Sbjct  1290  TFSYRSHDGQQYILGPWGGGGEN----NYKINL-GPSEFITKVHGTFGPYGEFPI-VITS  1343

Query  354   VKFTTNV-RAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             + F  N    +GP+G   GTPF+        IVGFFG  G  ++AIG Y
Sbjct  1344  LTFINNAGHQYGPFGQGGGTPFHAPISGNGSIVGFFGHQGACLEAIGFY  1392



>gb|EMS66150.1| hypothetical protein TRIUR3_12251 [Triticum urartu]
Length=307

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 61/92 (66%), Gaps = 7/92 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+ T++        GA E++ E+SG +G +   + +++ S+KF TNV+A+GP+G  
Sbjct  219  GSGGNQNTIVL-------GASEFVKEVSGTYGIYDADQHNIIMSLKFITNVKAYGPFGEA  271

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF    ++ + IVGFFGR+G Y+DA+G Y
Sbjct  272  NGTPFTIPVENNSSIVGFFGRSGIYLDALGVY  303



>gb|AAA87041.1| putative 32.6 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72096.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 57/92 (62%), Gaps = 7/92 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+ T +        GA E++ E+SG FG +   R +++ S+KF TNV+ +GP+G  
Sbjct  216  GSGGNQNTFVL-------GASEFVKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEA  268

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF    Q  + IVGFF R+G Y+DA+G Y
Sbjct  269  KGTPFTIAVQKNSSIVGFFARSGIYLDALGVY  300



>ref|XP_006663483.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Oryza brachyantha]
Length=1368

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 48/107 (45%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
             F+ ++ +G K      GG     V   D I +    E+L E+SG FGRF  T  +V+ S+
Sbjct  952   FTYSDHNGQKHVAGPWGGYGSGNV---DMIQL-APSEFLLEVSGTFGRF-RTALNVMTSL  1006

Query  357   KFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F TN  ++GPYG   GTPF+   Q    IVGFFGRAG+YVDAIG Y
Sbjct  1007  TFVTNAHSYGPYGKIEGTPFHMPVQSNGCIVGFFGRAGWYVDAIGIY  1053


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 8/92 (9%)
 Frame = +3

Query  222   GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
             G GGN      N  I  D  +E++T + G  G + +T FDV+ S+   TN+  +GP+G  
Sbjct  1125  GQGGN------NQLIQFD-PEEFITSVCGTIGSY-NTSFDVITSITLVTNIDCYGPFGQE  1176

Query  402   VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              G PF+F  Q    IVGFFG A  YVDAIG Y
Sbjct  1177  NGIPFHFPIQGNGSIVGFFGHADIYVDAIGVY  1208


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 60/109 (55%), Gaps = 7/109 (6%)
 Frame = +3

Query  174   TFSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
             TFS  + DG +  L   G GNE     N TIN+ G  E+LT++ G FG+F D    V+ S
Sbjct  1262  TFSYRSHDGQQHILGPWGSGNEN----NYTINL-GPSEFLTKVLGTFGQF-DEFPIVITS  1315

Query  354   VKFTTNV-RAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             + F +N    +GP+G   GTPF+        IVGFFG  G  V+AIG Y
Sbjct  1316  LTFFSNTGHQYGPFGQGGGTPFHAPISGNGSIVGFFGYQGDCVEAIGFY  1364



>ref|XP_006663484.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Oryza brachyantha]
Length=1366

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 5/107 (5%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
             FS  +++G K      GG   ++V   + I ++ + E L E+SG FGRFI  + +++ S+
Sbjct  948   FSYNDRNGKKHVAGPWGGYGGSSV---NAIQLEPS-EILVEVSGTFGRFIGFQ-NIITSL  1002

Query  357   KFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F TN R++GPYG   GTPF+   Q    IVGFFGRAG+ VDAIG Y
Sbjct  1003  TFVTNTRSYGPYGQRKGTPFDIPVQGSGCIVGFFGRAGWCVDAIGIY  1049


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 44/108 (41%), Positives = 59/108 (55%), Gaps = 6/108 (6%)
 Frame = +3

Query  174   TFSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
             TFS  + DG    + + G    + V     I   G+ E++T +SG  G + +T  DV+ S
Sbjct  1103  TFSYNDHDGEHHTVCLKG----SLVGTCQKIQF-GSSEFITRVSGTIGSY-NTPSDVVTS  1156

Query  354   VKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             +   TNV  +GP+G   G PFNF  Q   +IVGFFG A  YVDAIG Y
Sbjct  1157  ITLVTNVGCYGPFGQENGIPFNFPVQGNGRIVGFFGHADLYVDAIGVY  1204


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 49/92 (53%), Gaps = 9/92 (10%)
 Frame = +3

Query  225   GGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNV-RAFGPYGPN  401
             GGGN+ T+         G  E+L ++ G FG F +   +V+ S+ F TN    +GP+G  
Sbjct  1279  GGGNKYTIQL-------GPLEFLVKVLGTFGPFGEFP-NVITSLTFVTNTDHHYGPFGQG  1330

Query  402   VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              GTPF         IVGFFGR G  ++AIG Y
Sbjct  1331  GGTPFYGPMSGHGSIVGFFGRKGPCIEAIGFY  1362



>ref|XP_004168675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like, 
partial [Cucumis sativus]
Length=1090

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +3

Query  228  GGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            GGN  T  + DT+ +D  DEYLT I G +G F+      +RS+ F +N + +GPYG   G
Sbjct  906  GGNGGT--KTDTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQG  963

Query  408  TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            T F+F   +G KIVGF GR+G Y+DAIG Y
Sbjct  964  TIFSFPTTEG-KIVGFHGRSGLYLDAIGVY  992



>ref|XP_004152769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Cucumis sativus]
Length=1463

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +3

Query  228   GGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
             GGN  T  + DT+ +D  DEYLT I G +G F+      +RS+ F +N + +GPYG   G
Sbjct  933   GGNGGT--KTDTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQG  990

Query  408   TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             T F+F   +G KIVGF GR+G Y+DAIG Y
Sbjct  991   TIFSFPTTEG-KIVGFHGRSGLYLDAIGVY  1019


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +3

Query  228   GGNETTVIRNDTINIDGADEYLTEISGAFGRF-IDTRFDVLRSVKFTTNVRAFGPYGPNV  404
             GGN  T I    + +D   E LT ISG +G    D R   ++S+ F T+   FGP+G  V
Sbjct  1357  GGNSGTTIHR--VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEEV  1414

Query  405   GTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             G+ F     +G K+VGF GR+  Y+DAIG +
Sbjct  1415  GSFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  1444


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 32/92 (35%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = +3

Query  222   GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
             G     T   + D +  D   E LT ++G +G  +    +V++S+ F T    +GP+G  
Sbjct  1157  GARAGGTGGFKYDKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEA  1216

Query  402   VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              GTPF+   ++G KIVGF GR G ++DA+G +
Sbjct  1217  QGTPFSTNVKEG-KIVGFHGRKGLFLDALGVH  1247



>gb|EMT11070.1| hypothetical protein F775_02114 [Aegilops tauschii]
Length=332

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            DEYLT + G +G+F D  F V+RS+ F +N+R++GPYG   G PF   A  G KI+GF  
Sbjct  257  DEYLTSVHGHYGQFKD--FVVIRSLTFVSNLRSYGPYGKEDGVPFALHAGPGGKIIGFHA  314

Query  462  RAGFYVDAIGTY  497
            R+G ++DAIGTY
Sbjct  315  RSGQFLDAIGTY  326



>gb|EEE52196.1| hypothetical protein OsJ_34075 [Oryza sativa Japonica Group]
Length=1431

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
             F  ++++G K      GG   + V     I ++ + E L E+SG FGRF   + +++ S+
Sbjct  1015  FEYSDRNGQKHVAGPWGGYGGSNV---HMIQLE-SSEVLVEVSGTFGRFAGFQ-NIITSL  1069

Query  357   KFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F TN +++GP+G   GTPF+   Q G +IVGFFGRAG+  DAIG Y
Sbjct  1070  TFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRAGWCFDAIGIY  1116


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 57/110 (52%), Gaps = 10/110 (9%)
 Frame = +3

Query  174   TFSSTNKDGSKDCLTIGG--GGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVL  347
             TFS  + +G      + G  GG+      N TI   G  E++T + G  G + +T  DV+
Sbjct  1170  TFSYNDHNGDHHLAGLWGSHGGS------NQTIQF-GPSEFITRVYGTIGSY-NTPSDVV  1221

Query  348   RSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              S+   TN   +GP+G   G PF+F  Q    IVGFFG A  YVDAIG Y
Sbjct  1222  TSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHANLYVDAIGVY  1271


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 57/108 (53%), Gaps = 7/108 (6%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
             FS  + D  +  +   G G E+    N TI + G  E+  ++SG FG F +   +V+ S+
Sbjct  1326  FSYISHDKQQHIVGPWGSGGES----NYTIQL-GPSEFFVKVSGTFGPFGEFP-NVITSL  1379

Query  357   KFTTNVR-AFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F TN    +GP+G   GTPF+        IVGFFGR G  ++A+G Y
Sbjct  1380  TFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGFFGREGLCIEAVGFY  1427



>gb|EEC68269.1| hypothetical protein OsI_36304 [Oryza sativa Indica Group]
Length=1419

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
             F  ++++G K      GG   + V     I ++ + E L E+SG FGRF   + +++ S+
Sbjct  1015  FEYSDRNGQKHVAGPWGGYGGSNV---HMIQLE-SSEVLVEVSGTFGRFAGFQ-NIITSL  1069

Query  357   KFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F TN +++GP+G   GTPF+   Q G +IVGFFGRAG+  DAIG Y
Sbjct  1070  TFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRAGWCFDAIGIY  1116


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  291   LTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAG  470
             +T + G  G + +T  DV+ S+   TN   +GP+G   G PF+F  Q    IVGFFG A 
Sbjct  1192  ITRVYGTSGSY-NTPSDVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHAN  1250

Query  471   FYVDAIGTY  497
              YVDAIG Y
Sbjct  1251  LYVDAIGVY  1259


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 57/108 (53%), Gaps = 7/108 (6%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
             FS  + D  +  +   G G E+    N TI + G  E+  ++SG FG F +   +V+ S+
Sbjct  1314  FSYISHDKQQHIVGPWGSGGES----NYTIQL-GPSEFFVKVSGTFGPFGEFP-NVITSL  1367

Query  357   KFTTNVR-AFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F TN    +GP+G   GTPF+        IVGFFGR G  ++A+G Y
Sbjct  1368  TFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGFFGREGLCIEAVGFY  1415



>gb|ABA94002.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=1386

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 64/107 (60%), Gaps = 5/107 (5%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
             F  ++++G K      GG   + V     I ++ + E L E+SG FGRF   + +++ S+
Sbjct  970   FEYSDRNGQKHVAGPWGGYGGSNV---HMIQLE-SSEVLVEVSGTFGRFAGFQ-NIITSL  1024

Query  357   KFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F TN +++GP+G   GTPF+   Q G +IVGFFGRAG+  DAIG Y
Sbjct  1025  TFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRAGWCFDAIGIY  1071


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 57/110 (52%), Gaps = 10/110 (9%)
 Frame = +3

Query  174   TFSSTNKDGSKDCLTIGG--GGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVL  347
             TFS  + +G      + G  GG+      N TI   G  E++T + G  G + +T  DV+
Sbjct  1125  TFSYNDHNGDHHLAGLWGSHGGS------NQTIQF-GPSEFITRVYGTIGSY-NTPSDVV  1176

Query  348   RSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              S+   TN   +GP+G   G PF+F  Q    IVGFFG A  YVDAIG Y
Sbjct  1177  TSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHANLYVDAIGVY  1226


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 57/108 (53%), Gaps = 7/108 (6%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
             FS  + D  +  +   G G E+    N TI + G  E+  ++SG FG F +   +V+ S+
Sbjct  1281  FSYISHDKQQHIVGPWGSGGES----NYTIQL-GPSEFFVKVSGTFGPFGEFP-NVITSL  1334

Query  357   KFTTNVR-AFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F TN    +GP+G   GTPF+        IVGFFGR G  ++A+G Y
Sbjct  1335  TFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGFFGREGLCIEAVGFY  1382



>ref|XP_006853911.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
 gb|ERN15378.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
Length=126

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN T  I+         +E++T +SG +   + +   V+RS+KF TN + +GPYG  
Sbjct  7    GDGGNRTAHIK-----FQYPEEFITGVSGHYSPMVHSGTPVIRSLKFATNRKTYGPYGVE  61

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF+F   DG  IVGF GR+G+Y+DAIG
Sbjct  62   EGTPFSF-PMDGGHIVGFKGRSGWYLDAIG  90



>ref|XP_011463712.1| PREDICTED: jacalin-related lectin 3-like [Fragaria vesca subsp. 
vesca]
Length=599

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = +3

Query  249  IRNDTINIDGADEYLTEISGAFG--RFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNF  422
            + +  I +D  DE+L  +SG +    +I     VLRS+KF TN R FGP+G  VGTPF F
Sbjct  322  LSDAEIKLDYPDEFLVSVSGYYCGVTWIVGAPVVLRSLKFETNKRTFGPFGVEVGTPFTF  381

Query  423  QAQDGAKIVGFFGRAGFYVDAIG  491
            + +DG KIVGF GR G+Y+DAIG
Sbjct  382  RVKDGVKIVGFKGRNGWYLDAIG  404


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 56/96 (58%), Gaps = 8/96 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN T  I+     +   DE+L  +SG +   +     V+RS+KF +N R FGP+G  
Sbjct  68   GLGGNRTAEIK-----LQYPDEFLVSVSGHYCPVVYGGSPVIRSLKFESNRRTFGPFGVE  122

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG--TYNA  503
             GTPF F   DG KIVG  GR G+Y+DAIG   Y+A
Sbjct  123  EGTPFTFTV-DGGKIVGLKGRGGWYLDAIGFHVYHA  157


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (66%), Gaps = 2/82 (2%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFG--RFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDG  437
            I ++  +E++  ++G +G   +I     VL S++F +N R FGP+G  VGTPF F+ +DG
Sbjct  479  IKLEYPNEFIVSVTGHYGGVTWIVGAPVVLLSLRFESNRRTFGPFGVQVGTPFTFRVKDG  538

Query  438  AKIVGFFGRAGFYVDAIGTYNA  503
             +IVG  GR G+Y+DAIG + +
Sbjct  539  DQIVGLKGRNGWYLDAIGFHTS  560



>dbj|BAK00987.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 61/103 (59%), Gaps = 11/103 (11%)
 Frame = +3

Query  195  DGSKDCLT--IGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTT  368
            +  ++C T  +GG G  ++ I+          E+LTE+SG      D+R +V+ S++F T
Sbjct  207  EADQNCTTDRLGGPGGSSSTIQL------APSEFLTEVSGTIS---DSRCEVVESIQFVT  257

Query  369  NVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            N++ +GP+G   GTPF F      K+VGFFGR G ++DAIG Y
Sbjct  258  NIQTYGPFGTQDGTPFTFSVPRYKKVVGFFGRGGLFLDAIGIY  300



>gb|EAY82651.1| hypothetical protein OsI_37872 [Oryza sativa Indica Group]
Length=304

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = +3

Query  258  DTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDG  437
            +TI +  + E+L E+SG FG +  +  +V+ S+KF TNV+ +GP+G   GTPF+   Q+ 
Sbjct  224  NTIELS-SSEFLKEVSGTFGTYYGS--NVITSIKFVTNVKTYGPFGKQNGTPFSIPVQNN  280

Query  438  AKIVGFFGRAGFYVDAIGTY  497
            + +VGFFGR G Y+DA+G Y
Sbjct  281  SSVVGFFGRGGKYLDAVGVY  300



>ref|XP_009795366.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795367.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795368.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795369.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795370.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795371.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795372.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795373.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795374.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795375.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1346

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 78/147 (53%), Gaps = 14/147 (10%)
 Frame = +3

Query  66   PLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNET  242
            P G  GG  W++   + I +I+I  G   ++      F +  + G+  D    GG G   
Sbjct  36   PWGGTGGSEWNYMLKSPIKEILIAHGDVIDSI----MFRTITEQGTTIDSPKFGGDGG--  89

Query  243  TVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG-PNVGTPF  416
               R D + I+    EYLT I G FGRF D    +++S+ F TN + +GP+G    GTPF
Sbjct  90   ---RRDKVVIEATPLEYLTGIKGTFGRFYDR--SIIKSLCFITNAKNYGPFGCEAAGTPF  144

Query  417  NFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +   ++G  IVGF GR+G ++DAIG Y
Sbjct  145  SLVMEEGVAIVGFHGRSGLFLDAIGVY  171



>gb|KGN62634.1| hypothetical protein Csa_2G362470 [Cucumis sativus]
Length=598

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +3

Query  228  GGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            GGN  T  + DT+ +D  DEYLT I G +G F+      +RS+ F +N + +GPYG   G
Sbjct  64   GGNGGT--KTDTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQG  121

Query  408  TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            T F+F   +G KIVGF GR+G Y+DAIG Y
Sbjct  122  TIFSFPTTEG-KIVGFHGRSGLYLDAIGVY  150


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            + D +  D   E LT ++G +G  +    +V++S+ F T    +GP+G   GTPF+   +
Sbjct  302  KYDKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVK  361

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVGF GR G ++DA+G +
Sbjct  362  EG-KIVGFHGRKGLFLDALGVH  382


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (55%), Gaps = 4/99 (4%)
 Frame = +3

Query  204  KDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRF-IDTRFDVLRSVKFTTNVRA  380
            +   ++  GGN  T I    + +D   E LT ISG +G    D R   ++S+ F T+   
Sbjct  484  QSVWSVRHGGNSGTTIHR--VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGK  541

Query  381  FGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            FGP+G  VG+ F     +G K+VGF GR+  Y+DAIG +
Sbjct  542  FGPFGEEVGSFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  579



>ref|XP_009772163.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009772164.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
Length=1547

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 76/147 (52%), Gaps = 12/147 (8%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNE  239
            GP G   G  W+++  + I +I+I  G   ++      F +  + G+  D    GG G  
Sbjct  174  GPWGGTSGSEWNYKLKHPIKEILIAHGYFIDSI----MFRTITEQGTTTDSQKFGGNGGR  229

Query  240  TTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPF  416
                 N  +      EYLT I G FG + D    V++S+ F TN   +GP+G N G TPF
Sbjct  230  I----NKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGTPF  283

Query  417  NFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +   ++G  IVGF GR+GFY+DAIG Y
Sbjct  284  SLVMKEGVAIVGFHGRSGFYLDAIGVY  310


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 40/93 (43%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG    V+  +T       E LT I G  GRF      V++S+ FTTNV+ +GP+G  
Sbjct  19   GNGGQINKVVFEET-----PLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFGSE  71

Query  402  VG-TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             G TPF+   ++G  I+GF GR G Y+DAIG Y
Sbjct  72   GGGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVY  104



>ref|XP_009772162.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X2 [Nicotiana sylvestris]
Length=1598

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 76/147 (52%), Gaps = 12/147 (8%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNE  239
            GP G   G  W+++  + I +I+I  G   ++      F +  + G+  D    GG G  
Sbjct  226  GPWGGTSGSEWNYKLKHPIKEILIAHGYFIDSI----MFRTITEQGTTTDSQKFGGNGGR  281

Query  240  TTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPF  416
                 N  +      EYLT I G FG + D    V++S+ F TN   +GP+G N G TPF
Sbjct  282  I----NKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGTPF  335

Query  417  NFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +   ++G  IVGF GR+GFY+DAIG Y
Sbjct  336  SLVMKEGVAIVGFHGRSGFYLDAIGVY  362


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 82/155 (53%), Gaps = 13/155 (8%)
 Frame = +3

Query  42   ISTDVAYGPLGH-NGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCL  215
            ++  +  GP G  +GG  W+++  N I +I+I  G + N+      F +  + G+  +  
Sbjct  12   LADSILVGPWGDTSGGSEWNYKLKNPIKEILIAHGDAINSI----MFRTITEQGTTINSQ  67

Query  216  TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG  395
              GG G +     N  +  +   E LT I G  GRF      V++S+ FTTNV+ +GP+G
Sbjct  68   KFGGNGGQI----NKVVFEETPLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFG  121

Query  396  PNVG-TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
               G TPF+   ++G  I+GF GR G Y+DAIG Y
Sbjct  122  SEGGGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVY  156



>ref|XP_009772161.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X1 [Nicotiana sylvestris]
Length=1599

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 76/147 (52%), Gaps = 12/147 (8%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNE  239
            GP G   G  W+++  + I +I+I  G   ++      F +  + G+  D    GG G  
Sbjct  226  GPWGGTSGSEWNYKLKHPIKEILIAHGYFIDSI----MFRTITEQGTTTDSQKFGGNGGR  281

Query  240  TTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPF  416
                 N  +      EYLT I G FG + D    V++S+ F TN   +GP+G N G TPF
Sbjct  282  I----NKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGTPF  335

Query  417  NFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +   ++G  IVGF GR+GFY+DAIG Y
Sbjct  336  SLVMKEGVAIVGFHGRSGFYLDAIGVY  362


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 53/155 (34%), Positives = 82/155 (53%), Gaps = 13/155 (8%)
 Frame = +3

Query  42   ISTDVAYGPLGH-NGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCL  215
            ++  +  GP G  +GG  W+++  N I +I+I  G + N+      F +  + G+  +  
Sbjct  12   LADSILVGPWGDTSGGSEWNYKLKNPIKEILIAHGDAINSI----MFRTITEQGTTINSQ  67

Query  216  TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG  395
              GG G +     N  +  +   E LT I G  GRF      V++S+ FTTNV+ +GP+G
Sbjct  68   KFGGNGGQI----NKVVFEETPLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFG  121

Query  396  PNVG-TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
               G TPF+   ++G  I+GF GR G Y+DAIG Y
Sbjct  122  SEGGGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVY  156



>ref|XP_008444758.1| PREDICTED: LOW QUALITY PROTEIN: myrosinase-binding protein-like 
At3g16470 [Cucumis melo]
Length=598

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 57/90 (63%), Gaps = 3/90 (3%)
 Frame = +3

Query  228  GGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            GGN  T  + DT+ +D  DEYLT I G +G F+      +RS+ F +N + +GPYG   G
Sbjct  64   GGNGGT--KTDTVKLDFPDEYLTMIRGYYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQG  121

Query  408  TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            T F+F   +G KIVGF GR+G Y+DAIG Y
Sbjct  122  TVFSFPTTEG-KIVGFHGRSGLYLDAIGVY  150


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            + D +  D   E LT ++G +G  +    +V++S+ F T    +GP+G   GTPF+   +
Sbjct  302  KYDKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLSFHTTKAKYGPFGEAQGTPFSTNVK  361

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVGF GR G ++DA+G +
Sbjct  362  EG-KIVGFHGRKGLFLDALGVH  382


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 4/99 (4%)
 Frame = +3

Query  204  KDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRF-IDTRFDVLRSVKFTTNVRA  380
            +   ++  GGN  T +    + +D   E LT ISG +G    D R   ++S+ F T+   
Sbjct  484  QSVWSVRHGGNSGTNVHR--VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGK  541

Query  381  FGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            FGP+G  VG+ F     +G K+VGF GR+  Y+DAIG +
Sbjct  542  FGPFGEEVGSFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  579



>ref|XP_009589464.1| PREDICTED: agglutinin-like, partial [Nicotiana tomentosiformis]
Length=363

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 76/146 (52%), Gaps = 13/146 (9%)
 Frame = +3

Query  66   PLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNET  242
            P G  GG  W ++  + I +I+I  G    +      F +  + G+  D    GG G   
Sbjct  44   PWGGTGGSEWYYKLKSPIKEILITHGDCIESI----MFRTVTEQGTTIDSPKFGGDGG--  97

Query  243  TVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFN  419
               R D + I+ A  EYLT I G FG      + V++S+ F TN R +GP+G  +GTPF+
Sbjct  98   ---RRDKVVIEAASLEYLTGIKGTFGHC--GSYLVIKSLCFETNARNYGPFGSEIGTPFS  152

Query  420  FQAQDGAKIVGFFGRAGFYVDAIGTY  497
               ++G  IVGF GR G Y+DAIG Y
Sbjct  153  LVMKEGGAIVGFHGRCGAYLDAIGVY  178


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 50/89 (56%), Gaps = 9/89 (10%)
 Frame = +3

Query  225  GGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNV  404
            GG  E  VI+   +      EYL  I G F R+  + F V+ S+ F TN + +GP+G   
Sbjct  283  GGRREKVVIKEPPL------EYLIGIKGTFRRY-GSHF-VINSLCFITNAKNYGPFGSEA  334

Query  405  G-TPFNFQAQDGAKIVGFFGRAGFYVDAI  488
            G TPF+F  ++G  I GF GR G Y+DAI
Sbjct  335  GGTPFSFVMKEGGAIEGFHGRCGAYLDAI  363



>ref|NP_001066367.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|ABA96667.1| jasmonate-induced protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29386.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|EAY82558.1| hypothetical protein OsI_37779 [Oryza sativa Indica Group]
 gb|EAZ19941.1| hypothetical protein OsJ_35533 [Oryza sativa Japonica Group]
Length=307

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G+ E+L E+SG FG +    + V+RS+KF TN + +GP+G   GTPF+   Q+ + IVGF
Sbjct  232  GSSEFLKEVSGTFGPY--EGWKVIRSIKFVTNKKTYGPFGRQEGTPFSVPVQNNSTIVGF  289

Query  456  FGRAGFYVDAIGTY  497
            FGR+G Y+D +G Y
Sbjct  290  FGRSGKYLDTVGIY  303



>emb|CDM80625.1| unnamed protein product [Triticum aestivum]
 emb|CDM80626.1| unnamed protein product [Triticum aestivum]
Length=307

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            DEYLT + G +G+F    F V+RS+KF +N+R++GPYG   G  F   A  G KI+GF  
Sbjct  232  DEYLTSVHGHYGQF--KGFVVVRSLKFVSNLRSYGPYGKEDGVSFALHAGPGGKIIGFHA  289

Query  462  RAGFYVDAIGTY  497
            R+G ++DAIGTY
Sbjct  290  RSGQFLDAIGTY  301



>ref|XP_010273654.1| PREDICTED: mannose/glucose-specific lectin-like [Nelumbo nucifera]
Length=147

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = +3

Query  258  DTINIDGADEYLTEISGAFGRFIDTR--FDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            D I I   DEYLT ISG FGR    +    V+RS++F TN R++GPYG   GT F+   +
Sbjct  64   DQIQIAWPDEYLTSISGTFGRRWKNQNGHVVVRSIQFNTNARSYGPYGSTDGTAFSLPVK  123

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
             G KIVGF GR G  +D+IG Y
Sbjct  124  QG-KIVGFHGRCGADLDSIGVY  144



>ref|XP_006853910.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
 gb|ERN15377.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
Length=191

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN TT I+         +E++TE+SG +   +     V+RS+KFTTN+R +GPYG  
Sbjct  75   GDGGNRTTHIK-----FQYPEEFITEVSGHYCPVVHGGTPVIRSLKFTTNMRTYGPYGVE  129

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAI  488
             GTPF+    DG  IVGF GR G+Y+D+I
Sbjct  130  EGTPFSC-PMDGGLIVGFKGRNGWYLDSI  157



>ref|XP_002440163.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
 gb|EES18593.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
Length=206

 Score = 74.3 bits (181),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            I +   DEYLT +SG +         V+RS+ F TN+RA+GP+G   GTPF+F    G  
Sbjct  77   IKLSCPDEYLTTVSGHYAPIAHGGSPVIRSLAFRTNLRAYGPFGAAEGTPFSFPVVGGV-  135

Query  444  IVGFFGRAGFYVDAIGTYNA  503
            IVGF+GR+G+ +DA+G Y A
Sbjct  136  IVGFYGRSGWQLDAVGLYVA  155



>ref|XP_006647196.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Oryza 
brachyantha]
Length=960

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = +3

Query  177  FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
            FS  +KDG +   ++ GG   +  +    IN+D   EYL E+ G  G F +   + + S+
Sbjct  856  FSYFDKDGERHTTSLWGGLGGSVQL----INLD-EREYLVEVIGTVGPF-NVSSEAITSL  909

Query  357  KFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
               TNVR++GP+G   GTPF    +  + IVGFFGR+G Y+DA+G Y
Sbjct  910  TLVTNVRSYGPFGQPQGTPFRTPLKKNSCIVGFFGRSGTYLDAVGVY  956



>ref|XP_006647195.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Oryza 
brachyantha]
Length=1077

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
             FS  +KDG +   ++ GG   +  +    IN+D   EYL E+ G  G F +   + + S+
Sbjct  973   FSYFDKDGERHTTSLWGGLGGSVQL----INLD-EREYLVEVIGTVGPF-NVSSEAITSL  1026

Query  357   KFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
                TNVR++GP+G   GTPF    +  + IVGFFGR+G Y+DA+G Y
Sbjct  1027  TLVTNVRSYGPFGQPQGTPFRTPLKKNSCIVGFFGRSGTYLDAVGVY  1073



>ref|XP_009769147.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1335

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 61/110 (55%), Gaps = 10/110 (9%)
 Frame = +3

Query  177  FSSTNKDGSK-DCLTIGGGGNETTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLR  350
            F +  + G+  D    GG G      R D + ++    EYLT I G FGRF      V++
Sbjct  66   FRTITEQGTTIDSPKFGGDGG-----RRDKVVVEATPLEYLTGIKGTFGRFYG--HSVIK  118

Query  351  SVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+ F TN + +GP+G   G TPF+   ++G  IVGF GR+G Y+DAIG Y
Sbjct  119  SLCFITNAKNYGPFGSEAGGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  168



>gb|EMT07650.1| Horcolin [Aegilops tauschii]
Length=320

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            DEYLT + G +G+F DT   V+RS+   +N+R++G YG   G PF   A  G KI+GF  
Sbjct  245  DEYLTSVHGHYGQFKDTV--VIRSLTLVSNLRSYGSYGKEDGVPFALHAGPGGKIIGFHA  302

Query  462  RAGFYVDAIGTY  497
            R+G ++DAIGTY
Sbjct  303  RSGQFLDAIGTY  314



>gb|AAR20919.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 9/109 (8%)
 Frame = +3

Query  177  FSSTNKDGSKDCLTI--GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLR  350
            FS  ++ G K  +    G GG + T +        G  E++ E+SG FG +     +++ 
Sbjct  199  FSYVDQAGQKRTVGPWGGSGGKQNTFVL-------GTSEFVKEVSGTFGLYGRDNHNIIT  251

Query  351  SVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+KF TNV+ +GP+G   GT F    Q  + IVGFFGR+G Y+DA+G Y
Sbjct  252  SLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGFFGRSGIYLDALGVY  300



>gb|EMT24046.1| hypothetical protein F775_25349 [Aegilops tauschii]
Length=304

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 7/92 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG + T +        G  E++ E+SG FG +     +++ S+KF TNV+ +GP+G  
Sbjct  216  GSGGKQNTFVL-------GTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQA  268

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GT F    Q  + IVGFFGR+G Y+DA+G Y
Sbjct  269  KGTTFTIPVQKNSSIVGFFGRSGIYLDALGVY  300



>ref|XP_004982894.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=151

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 63/109 (58%), Gaps = 7/109 (6%)
 Frame = +3

Query  174  TFSSTNKDGSKDCL-TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLR  350
            +F+    DG+   +   GG G +   +R+    + GA E++ EISG +G F      V+R
Sbjct  46   SFTYAGVDGAPRMVGPWGGSGGQEHKVRH----MFGAGEFVKEISGTYGPF--GGHTVVR  99

Query  351  SVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+ F TN+   GP+G    TPF+   QDGA +VGFFGR+G  +DA+G Y
Sbjct  100  SLTFVTNIGKHGPFGTPWQTPFSVPVQDGAHVVGFFGRSGSLLDAVGVY  148



>gb|ABS82785.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 9/109 (8%)
 Frame = +3

Query  177  FSSTNKDGSKDCLTI--GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLR  350
            FS  ++ G K  +    G GG + T +        G  E++ E+SG FG +     +++ 
Sbjct  199  FSYVDQAGQKRTVGPWGGSGGKQNTFVL-------GTSEFVREVSGTFGLYGRDNHNIIT  251

Query  351  SVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+KF TNV+ +GP+G   GT F    Q  + IVGFFGR+G Y+DA+G Y
Sbjct  252  SLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGFFGRSGIYLDALGVY  300



>ref|XP_002318228.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
 gb|EEE96448.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
Length=237

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R   I +   +EYLT +SG +   +     V+RS+ F++N R FGP+G   GTPF   + 
Sbjct  120  RTAEIKLQYPEEYLTSVSGHYCPVVYGGSPVIRSLAFSSNKRTFGPFGVEEGTPFTL-SM  178

Query  432  DGAKIVGFFGRAGFYVDAIG  491
            DGA IVGF GR G+Y+DAIG
Sbjct  179  DGASIVGFKGRGGWYLDAIG  198



>ref|XP_011030089.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
 ref|XP_011030090.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
Length=191

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 1/80 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R   I +   +EYLT +SG +   +     V+RS+ F++N R FGP+G   GTPF   + 
Sbjct  74   RTAEIKLRYPEEYLTSVSGHYCPVVYGGSPVIRSLTFSSNKRTFGPFGVEEGTPFTL-SM  132

Query  432  DGAKIVGFFGRAGFYVDAIG  491
            DGA IVGF GR+G+Y+DAIG
Sbjct  133  DGASIVGFKGRSGWYLDAIG  152



>ref|XP_006853909.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
 gb|ERN15376.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
Length=196

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN T  I+     +   +E++TE+SG +   +     V+RS+KF T+ R +GPYG  
Sbjct  77   GDGGNHTAHIK-----LQYPEEFITEVSGHYCPVVHGGTPVIRSLKFITSKRTYGPYGVE  131

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAI  488
             GTPF+F   DG  IVGF GR G+Y+DAI
Sbjct  132  EGTPFSF-LMDGGLIVGFKGRNGWYLDAI  159



>ref|XP_004235622.1| PREDICTED: jacalin-related lectin 19 [Solanum lycopersicum]
Length=201

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R   I +   +EYLT +SG +   +     V+RS+ F++N R FGP+G   GTPF+    
Sbjct  71   RTAQIKLQFPEEYLTSVSGYYCPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSM-PM  129

Query  432  DGAKIVGFFGRAGFYVDAIGTYNA  503
            +G +IVGF GR+G+YVDAIG Y A
Sbjct  130  EGGQIVGFKGRSGWYVDAIGFYIA  153



>gb|EMS55842.1| hypothetical protein TRIUR3_32339 [Triticum urartu]
Length=288

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +3

Query  270  IDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIV  449
            + G  E++ E+SG FG +     +++ S+KF TN++ +GP+G   GT F    Q  + IV
Sbjct  209  VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSSIV  268

Query  450  GFFGRAGFYVDAIGTY  497
            GFFGR+G Y+DA+G Y
Sbjct  269  GFFGRSGIYLDALGVY  284



>ref|XP_006343016.1| PREDICTED: agglutinin-like [Solanum tuberosum]
Length=201

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R   I +   +EYLT +SG +   +     V+RS+ F++N R FGP+G   GTPF+    
Sbjct  71   RTAQIKLQFPEEYLTSVSGYYSPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSM-PM  129

Query  432  DGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSSEA*CSI  548
            +G +IVGF GR+G+Y+DAIG Y A V  + +  +A  S+
Sbjct  130  EGGQIVGFKGRSGWYLDAIGFYIAKVKTTTVLQKAQQSL  168



>ref|XP_010267066.1| PREDICTED: jacalin-related lectin 19 [Nelumbo nucifera]
Length=205

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN TT     TI +   +E+LT +SG +   +     V+RS+ F +N  +FGP+G  
Sbjct  68   GNGGNHTT-----TIKLQYPEEFLTTVSGHYSPVVHGGTPVIRSLTFKSNQGSFGPFGVE  122

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             G PF+F   DG  I+GF+GR G+Y+DAIG
Sbjct  123  EGMPFSF-PMDGGSIIGFWGRNGWYLDAIG  151



>ref|XP_008806712.1| PREDICTED: agglutinin-like isoform X2 [Phoenix dactylifera]
Length=197

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN T  ++     +   +E+LT +SG +   +     V+RS+ F +N RAFGP+G  
Sbjct  64   GVGGNLTVQVK-----LQYPEEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVE  118

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   DG  IVGF GR+G+Y+DAIG
Sbjct  119  EGTPFTF-PMDGGMIVGFSGRSGWYLDAIG  147



>ref|XP_008806706.1| PREDICTED: agglutinin-like isoform X1 [Phoenix dactylifera]
Length=200

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN T  ++     +   +E+LT +SG +   +     V+RS+ F +N RAFGP+G  
Sbjct  67   GVGGNLTVQVK-----LQYPEEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVE  121

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   DG  IVGF GR+G+Y+DAIG
Sbjct  122  EGTPFTF-PMDGGMIVGFSGRSGWYLDAIG  150



>ref|NP_001066495.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|ABA97248.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABB51090.1| mannose-specific jacalin-related lectin [Oryza sativa Japonica 
Group]
 dbj|BAF29514.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|EAZ20117.1| hypothetical protein OsJ_35712 [Oryza sativa Japonica Group]
Length=306

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G+ E+L E+SG FG +  +   V+ S+ F TN + +GP+G   GTPF+  AQ+ + IVGF
Sbjct  231  GSSEFLKEVSGTFGPYEGST--VITSINFITNKQTYGPFGRQEGTPFSVPAQNNSSIVGF  288

Query  456  FGRAGFYVDAIGTY  497
            FGR+G Y++A+G Y
Sbjct  289  FGRSGKYINAVGVY  302



>gb|EEC69076.1| hypothetical protein OsI_37951 [Oryza sativa Indica Group]
Length=250

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G+ E+L E+S  FG +  +   V+RS+ F TN + +GP+G   GTPF+  AQ+ + +VGF
Sbjct  175  GSSEFLKEVSRTFGPYEGS--TVIRSINFITNKQTYGPFGRQEGTPFSVPAQNNSSVVGF  232

Query  456  FGRAGFYVDAIGTY  497
            FGR+G Y++A+G Y
Sbjct  233  FGRSGKYINAVGVY  246



>ref|XP_010924945.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Elaeis 
guineensis]
Length=200

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN T  ++     +   +E+LT +SG +   +     V+RS+ F +N RAFGP+G  
Sbjct  67   GNGGNLTVQVK-----LHYPEEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVE  121

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   DG  IVGF GR G+Y+DAIG
Sbjct  122  EGTPFTF-PMDGGMIVGFSGRGGWYLDAIG  150



>ref|XP_009614996.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009614997.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1313

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 45/110 (41%), Positives = 60/110 (55%), Gaps = 10/110 (9%)
 Frame = +3

Query  177  FSSTNKDGSK-DCLTIGGGGNETTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLR  350
            F S  + G+  D    GG G      R D + I+    EYLT I G FG F      V++
Sbjct  22   FKSITEQGTTIDSPKFGGDGG-----RRDKVVIEATPLEYLTGIKGTFGCFYG--HSVIK  74

Query  351  SVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+ F TN + +GP+G   G TPF+   ++G  IVGF GR+G Y+DAIG Y
Sbjct  75   SLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  124



>ref|XP_009614994.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=1334

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 45/110 (41%), Positives = 60/110 (55%), Gaps = 10/110 (9%)
 Frame = +3

Query  177  FSSTNKDGSK-DCLTIGGGGNETTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLR  350
            F S  + G+  D    GG G      R D + I+    EYLT I G FG F      V++
Sbjct  69   FKSITEQGTTIDSPKFGGDGG-----RRDKVVIEATPLEYLTGIKGTFGCFYG--HSVIK  121

Query  351  SVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+ F TN + +GP+G   G TPF+   ++G  IVGF GR+G Y+DAIG Y
Sbjct  122  SLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  171



>ref|XP_009614993.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1351

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 45/110 (41%), Positives = 60/110 (55%), Gaps = 10/110 (9%)
 Frame = +3

Query  177  FSSTNKDGSK-DCLTIGGGGNETTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLR  350
            F S  + G+  D    GG G      R D + I+    EYLT I G FG F      V++
Sbjct  69   FKSITEQGTTIDSPKFGGDGG-----RRDKVVIEATPLEYLTGIKGTFGCFYG--HSVIK  121

Query  351  SVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+ F TN + +GP+G   G TPF+   ++G  IVGF GR+G Y+DAIG Y
Sbjct  122  SLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  171



>ref|XP_009614991.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009614992.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1360

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 45/110 (41%), Positives = 60/110 (55%), Gaps = 10/110 (9%)
 Frame = +3

Query  177  FSSTNKDGSK-DCLTIGGGGNETTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLR  350
            F S  + G+  D    GG G      R D + I+    EYLT I G FG F      V++
Sbjct  69   FKSITEQGTTIDSPKFGGDGG-----RRDKVVIEATPLEYLTGIKGTFGCFYG--HSVIK  121

Query  351  SVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+ F TN + +GP+G   G TPF+   ++G  IVGF GR+G Y+DAIG Y
Sbjct  122  SLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  171



>gb|EEE60695.1| hypothetical protein OsJ_14181 [Oryza sativa Japonica Group]
Length=95

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG-PNVGTPFNFQAQDGAKIVG  452
            G  +++ EISG  G ++    +VLRS+K TT  R +GPYG P  G PF+F      +I G
Sbjct  17   GLMDFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPFSFSVDGSDRITG  76

Query  453  FFGRAGFYVDAIGTY  497
            FF RAGF  DAIG Y
Sbjct  77   FFVRAGFITDAIGVY  91



>ref|XP_010924946.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Elaeis 
guineensis]
Length=197

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN T  ++     +   +E+LT +SG +   +     V+RS+ F +N RAFGP+G  
Sbjct  64   GNGGNLTVQVK-----LHYPEEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVE  118

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   DG  IVGF GR G+Y+DAIG
Sbjct  119  EGTPFTF-PMDGGMIVGFSGRGGWYLDAIG  147



>gb|EMT23136.1| hypothetical protein F775_18655 [Aegilops tauschii]
Length=118

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 3/81 (4%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
             DTIN+D A  Y+TEISG  G+F     D++ S+K  T+      YG   GTPF     D
Sbjct  38   EDTINLD-ATNYVTEISGTVGKF--GTDDIVTSLKIVTSKGVTKTYGSGTGTPFRVPVLD  94

Query  435  GAKIVGFFGRAGFYVDAIGTY  497
            G KIVGFFGRAG ++DAIG Y
Sbjct  95   GGKIVGFFGRAGAFLDAIGFY  115



>ref|NP_177447.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 sp|Q9SSM3.1|JAL19_ARATH RecName: Full=Jacalin-related lectin 19 [Arabidopsis thaliana]
 gb|AAD55651.1|AC008017_24 Similar to jacalin [Arabidopsis thaliana]
 gb|AAX49365.1| At1g73040 [Arabidopsis thaliana]
 gb|ABR46196.1| At1g73040 [Arabidopsis thaliana]
 gb|AEE35407.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=176

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 58/90 (64%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T+ I+     +   +EYLT +SG +   +++   V+RS+ F +N + +GPYG  
Sbjct  66   GVGGNKTSEIK-----LQYPEEYLTGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVE  120

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   +G +IVG  GR+G+Y+D+IG
Sbjct  121  QGTPFTFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_006354454.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Solanum tuberosum]
Length=303

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 79/153 (52%), Gaps = 11/153 (7%)
 Frame = +3

Query  72   GHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGGNETTVI  251
            G +GG  W++RP   + QI++  G   ++      F S+ ++G  +  T GG G   T  
Sbjct  161  GGSGGSHWNYRPKGVVKQIVVKHGLIIDSI----MFKSSEENGVMESKTFGGSGGHLTT-  215

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQ-A  428
                INID   EYLT +SG +G +    + +++S+K  TN+   GP G  + T  NF   
Sbjct  216  ---EINIDSPSEYLTGLSGTYGLY--GPYLIIKSIKLHTNLSHHGPMGSVIETDTNFSFI  270

Query  429  QDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLS  527
              G  +VGF G +G ++DA+G Y     I+L S
Sbjct  271  MQGGVVVGFHGFSGLFLDAVGLYVMPTSITLPS  303



>ref|XP_002888904.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65163.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=176

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T  ++     +   DEYLT +SG +   +D+   V+RS+ F +N + +GPYG  
Sbjct  66   GVGGNKTAELK-----LQYPDEYLTGVSGYYSIVVDSGTPVIRSMTFKSNKQVYGPYGVE  120

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   +G +IVG   R+G+Y+D+IG
Sbjct  121  QGTPFTFSV-NGGRIVGMSSRSGWYLDSIG  149



>gb|EAZ01021.1| hypothetical protein OsI_23055 [Oryza sativa Indica Group]
Length=694

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 2/82 (2%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            + TI++ G  EYL EISG  G F      V+ S+   T +R +GPYG  VG PF+   Q+
Sbjct  305  DHTIHL-GPSEYLIEISGTVGPFTYAPHGVITSLTLVTTIRTYGPYGELVGNPFHIPMQN  363

Query  435  -GAKIVGFFGRAGFYVDAIGTY  497
             G  IVGFF R G+YVDA G Y
Sbjct  364  KGGSIVGFFARVGWYVDAFGIY  385


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 6/71 (8%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGR  464
            E+LT  SG  G       +V+ S+   TN R++GP+G   G PF    ++ A IVGFFGR
Sbjct  470  EFLTGFSGTTGH------NVVTSLTLITNARSYGPFGQVGGAPFQVPMRNNASIVGFFGR  523

Query  465  AGFYVDAIGTY  497
            A  Y++AIG Y
Sbjct  524  ADQYLNAIGVY  534


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 2/75 (3%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDG-AKIVG  452
            G  E++T + G  G F +    V+ S++F TN   +GP+G  +GT F      G + IVG
Sbjct  617  GPSEFVTAVYGTVGPFGNYS-SVITSLRFVTNAGKYGPFGQGIGTHFQAPMHKGSSSIVG  675

Query  453  FFGRAGFYVDAIGTY  497
            FFGR+   V++IG Y
Sbjct  676  FFGRSSSCVESIGFY  690



>ref|XP_007215056.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
 gb|EMJ16255.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
Length=179

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG++T  I+     +   DE+L  +SG +   +     ++RS+KF +N R FGPYG  
Sbjct  67   GRGGDQTAEIK-----LQYPDEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIE  121

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   DG KIVG  GR G+Y+DAIG
Sbjct  122  EGTPFTFSV-DGGKIVGLKGRNGWYLDAIG  150



>ref|XP_009367509.1| PREDICTED: agglutinin alpha chain [Pyrus x bretschneideri]
Length=189

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T  I+     +   DEY+  ++G +G  +     ++RS+KF +N R FGP+G +
Sbjct  74   GRGGNQTAEIK-----LQYPDEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMD  128

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF +   D +KIVG  GR G+Y+DAIG
Sbjct  129  EGTPFTYTL-DRSKIVGLKGRNGWYIDAIG  157



>ref|XP_006390600.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
 gb|ESQ27886.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
Length=176

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T+ I+     +   DEYL  +SG +   + +   V+RS+ F +N + +GPYG  
Sbjct  66   GQGGNKTSEIK-----LQYPDEYLIGVSGYYWPVVHSGSPVIRSITFKSNKQVYGPYGVE  120

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   +G +IVG  GR+G+Y+D+IG
Sbjct  121  QGTPFTFSV-NGGRIVGINGRSGWYLDSIG  149



>gb|EEC72970.1| hypothetical protein OsI_06866 [Oryza sativa Indica Group]
Length=1072

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 8/108 (7%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGG-GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
             FS  +KDG +   ++ GG G    +I  D        E+L E+ G  G F +   + + S
Sbjct  968   FSYLDKDGERHTTSLWGGLGGSVQLIDLDE------REFLMEVIGTVGPF-NVLSEAITS  1020

Query  354   VKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             +   TNVR++GP+G   GTPF    +  + IVGFFGR+G Y+DA+G Y
Sbjct  1021  LTLVTNVRSYGPFGQPQGTPFRTPRKKNSCIVGFFGRSGTYLDAVGVY  1068



>dbj|BAD23250.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 dbj|BAD23344.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 gb|EAZ22703.1| hypothetical protein OsJ_06375 [Oryza sativa Japonica Group]
Length=1072

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 8/108 (7%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGG-GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
             FS  +KDG +   ++ GG G    +I  D        E+L E+ G  G F +   + + S
Sbjct  968   FSYLDKDGERHTTSLWGGLGGSVQLIDLDE------REFLMEVIGTVGPF-NVLSEAITS  1020

Query  354   VKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             +   TNVR++GP+G   GTPF    +  + IVGFFGR+G Y+DA+G Y
Sbjct  1021  LTLVTNVRSYGPFGQPQGTPFRTPRKKNSCIVGFFGRSGTYLDAVGVY  1068



>ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1218

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 6/92 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN     R D + +D  DEYL  +SG +G         +RS+ F +N R +GP+G  
Sbjct  686  GNGGN-----RTDKVKLDYPDEYLASVSGHYGSLNQWGPVFVRSLTFQSNKRTYGPFGVE  740

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GT F+F    G +IVGF G+ G++VDAIG Y
Sbjct  741  QGTYFSF-PMTGGRIVGFHGKGGYFVDAIGIY  771


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 36/93 (39%), Positives = 52/93 (56%), Gaps = 6/93 (6%)
 Frame = +3

Query  222   GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGP  398
             GG G   T    + + ++   E LT ISG +G    D R  V++S+ F T+   +GP+G 
Sbjct  1111  GGSGGTAT----NRVKLEYPHEVLTRISGYYGPASRDERPTVVKSLTFYTSRGQYGPFGE  1166

Query  399   NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              +GT F     +G K+VGF GR G Y+DAIG +
Sbjct  1167  EIGTFFTSTTTEG-KVVGFHGRCGAYLDAIGVH  1198


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 33/90 (37%), Positives = 49/90 (54%), Gaps = 5/90 (6%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GG G      + + I  D   E LT ISG +G  +    ++++S+ F TN    GP+G  
Sbjct  915  GGTGG----FKTEKITFDYPYEILTHISGTYGPLMFMGPNIIKSLTFYTNKGKHGPFGDE  970

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             G  F+ +  +G KIVGF G+ G ++DAIG
Sbjct  971  QGPSFSTKP-NGGKIVGFHGKEGLFLDAIG  999



>ref|XP_009770862.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770863.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770864.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770865.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770866.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1328

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 54/149 (36%), Positives = 79/149 (53%), Gaps = 18/149 (12%)
 Frame = +3

Query  66   PLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGG---GGN  236
            P G  GG  W+++  N I +I+I  G   ++      F +  K G    +TIG    GGN
Sbjct  12   PWGGTGGSKWNYKLKNPIKEILIAHGDIIDSI----MFRTVTKKG----ITIGSPKFGGN  63

Query  237  ETTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-T  410
               + +   + I+    EYLT I G FG +      V++S+ F TNV+ +GP+G   G T
Sbjct  64   GGQISK---VVIEATPLEYLTGIKGTFGHYCG--LSVIKSLCFITNVKNYGPFGCEAGGT  118

Query  411  PFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            PF+   ++G  IVGF GR G ++DAIG Y
Sbjct  119  PFSLVMKEGVAIVGFHGRCGAFLDAIGVY  147



>ref|XP_003615697.1| Myrosinase-binding protein-like protein [Medicago truncatula]
 gb|AES98655.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=604

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T     D + +D  DE+LT + G +G       +++RS+ F +N + +GP+G  
Sbjct  69   GTGGNKT-----DKVKLDYPDEFLTSVHGYYGSLNQWGHNLVRSLSFESNKKTYGPFGVE  123

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GT F+     GAKIVGF GR G+Y+DAIG Y
Sbjct  124  QGTYFSV-PMTGAKIVGFHGRCGWYLDAIGVY  154


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            ++D I  D   E LT ISG  G  +     V+RS+ F T  R +GP+G   GT F  + +
Sbjct  307  KSDKIVFDFPYEVLTYISGYHGPLMYMGPAVIRSLTFHTTKRKYGPFGEEQGTYFTTKVK  366

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVG  GR G ++DA G +
Sbjct  367  EG-KIVGIHGRKGLFLDAFGVH  387


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 6/93 (6%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGP  398
            GG G +T       I ++   E LT ISG +G    D +  V++S+ F T+   +GPYG 
Sbjct  498  GGNGGDTM----HRIQLEFPHEVLTCISGYYGSITKDEKHTVIKSLTFHTSRGQYGPYGE  553

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             VG  F     +G K+VGF GR+  Y+DAIG +
Sbjct  554  EVGKFFTSTTTEG-KVVGFHGRSSLYLDAIGIH  585



>ref|XP_010471351.1| PREDICTED: jacalin-related lectin 19 [Camelina sativa]
Length=177

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T+ I+     +   DEYL  +SG +   +++   V+RS+ F +N + +GPYG  
Sbjct  66   GVGGNKTSEIK-----LQYPDEYLIGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVE  120

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   +G +IVG  GR+G+Y+D+IG
Sbjct  121  QGTPFTFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_008348486.1| PREDICTED: agglutinin alpha chain-like [Malus domestica]
Length=189

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG +T  I+     +   DEY+  ++G +G  +     ++RS+KF +N R FGP+G +
Sbjct  74   GRGGTQTAEIK-----LQYPDEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMD  128

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF +   DG KIVG  GR G+Y+DAIG
Sbjct  129  EGTPFTY-TLDGGKIVGLKGRNGWYIDAIG  157



>sp|Q5U9T2.1|LECH_HORVU RecName: Full=Horcolin; AltName: Full=Agglutinin; AltName: Full=Mannose-specific 
lectin [Hordeum vulgare]
 sp|P82953.2|LECH_HORVD RecName: Full=Horcolin; AltName: Full=Agglutinin; AltName: Full=Mannose-specific 
lectin [Hordeum vulgare subsp. vulgare]
 gb|AAK54458.1| horcolin [Hordeum vulgare subsp. vulgare]
 gb|AAV39531.1| horcolin [Hordeum vulgare]
 dbj|BAJ87539.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=146

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 74/153 (48%), Gaps = 11/153 (7%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTI  221
            +S  V  GP G NGG     +P   I  + +        + I  T+  T+       +  
Sbjct  1    MSKPVKIGPWGGNGGSERDVQP-KPIRMVSMTVSSGAIVDAIAFTYVGTDNVQHSSGIKW  59

Query  222  GG-GGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGP  398
            GG GG E      DTIN+D A  Y+TEISG  G+F     D++ S+K  T+      YG 
Sbjct  60   GGTGGTE------DTINLD-ATNYVTEISGTVGKF--GTDDIVTSLKIITSKGVTRTYGS  110

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              G PF     DG KI GFFGRAG ++DAIG Y
Sbjct  111  GTGIPFRVPVLDGGKIAGFFGRAGAFLDAIGFY  143



>ref|XP_009127966.1| PREDICTED: agglutinin [Brassica rapa]
Length=176

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+TT I+     +   +EYL  +SG +   + +   V+RS+ F +N + +GPYG  
Sbjct  66   GQGGNKTTEIK-----LQYPEEYLIGVSGYYCPVVHSGTPVIRSMTFKSNKQVYGPYGVE  120

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF+F   +G +IVG  GR+G+Y+D+IG
Sbjct  121  QGTPFSFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_010230396.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
 ref|XP_010230397.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=246

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 57/104 (55%), Gaps = 8/104 (8%)
 Frame = +3

Query  201  SKDCLTIGGGGNETTVI-----RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFT  365
            S  CL   G   +T V      +   I +D  DEYLT + G +G+F    + V+R++ F 
Sbjct  142  SALCLRDDGHEEQTKVWGAAFGKRSEICLD-KDEYLTGVKGRYGQF--DGWSVIRALTFV  198

Query  366  TNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +N R  GPYG + G  F   A  G KIVGF GR+G  VDAIGTY
Sbjct  199  SNRRTIGPYGTDEGMEFELPAAGGGKIVGFHGRSGGLVDAIGTY  242



>ref|XP_010690084.1| PREDICTED: jacalin-related lectin 19 [Beta vulgaris subsp. vulgaris]
Length=189

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GG G   TV     I +   +EYL  +SG +   +     V+RS+ F +N R+FGP+G  
Sbjct  67   GGNGGTITV----EIKLIYPEEYLISVSGYYSPVVQGMTPVVRSLSFKSNRRSFGPFGVE  122

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF F   +G +I+GF GR+G+Y+D+IG Y
Sbjct  123  EGTPFYFPV-EGGRIIGFKGRSGWYLDSIGFY  153



>emb|CAD40628.2| OSJNBa0016N04.16 [Oryza sativa Japonica Group]
 emb|CAD40707.2| OSJNBb0042I07.4 [Oryza sativa Japonica Group]
 emb|CAH66364.1| H0607F01.9 [Oryza sativa Indica Group]
Length=477

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G  EY+TE+SG  G F      V+ S+ F TN  ++GP+G   GTPF+   QD   IVGF
Sbjct  76   GLIEYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGF  135

Query  456  FGRAGFYVDAIGTY  497
            F RAG+YVDA G Y
Sbjct  136  FARAGWYVDAFGIY  149



>ref|XP_006301377.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
 gb|EOA34275.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
Length=177

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T+ I+     +   DEYL  +SG +   + +   V+RS+ F +N + +GPYG  
Sbjct  66   GLGGNKTSEIK-----LQYPDEYLIGVSGYYCPLVSSGTPVIRSMTFKSNKQVYGPYGVE  120

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   +G +IVG  GR+G+Y+D+IG
Sbjct  121  QGTPFTFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_009763421.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763428.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763437.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 52/146 (36%), Positives = 74/146 (51%), Gaps = 13/146 (9%)
 Frame = +3

Query  66   PLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGG-GGNE  239
            P G  GG  W ++  + I +I+I  G    +      F +  + G+  D    GG GG  
Sbjct  39   PWGGAGGSEWYYKLKSPIKEILIAHGDCIKSI----MFKTVTEQGTTIDSPKFGGDGGRR  94

Query  240  TTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFN  419
              V+  +T       EYLT I G FG      + V++S+ F TN + +GP+G   GTPF+
Sbjct  95   DKVVMEET-----PLEYLTCIKGTFGYC--GGYSVVKSLCFITNAKNYGPFGCEAGTPFS  147

Query  420  FQAQDGAKIVGFFGRAGFYVDAIGTY  497
               ++G  IVGF GR G Y+DAIG Y
Sbjct  148  LVMKEGGAIVGFHGRCGAYLDAIGVY  173


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 52/146 (36%), Positives = 77/146 (53%), Gaps = 12/146 (8%)
 Frame = +3

Query  66   PLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNET  242
            P G  GG  W+++  + I +I+I  GG  ++      F +  + G+  D    GG G   
Sbjct  221  PWGGTGGSEWNYKLKSPIKEILIAHGGCIDSI----MFKTITEQGTTIDSPKFGGNGGRI  276

Query  243  TVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPFN  419
                N  +  +   E+LT I G  G F    + V++S+ FTTNV+ +GP+G   G TPF+
Sbjct  277  ----NKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFS  330

Query  420  FQAQDGAKIVGFFGRAGFYVDAIGTY  497
               ++G  IVGF GR G Y+DAIG Y
Sbjct  331  LVMKEGVAIVGFHGRCGAYLDAIGVY  356


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 77/148 (52%), Gaps = 14/148 (9%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNE  239
            GP G  GG  W+++  + I +I+I  GG  ++      F +  + G+  D    GG G  
Sbjct  426  GPWGGTGGSEWNYKLKSYIKEILIAHGGCIDSI----MFKTITEQGTTIDSPKFGGNGG-  480

Query  240  TTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TP  413
                R + + I+    EYLT I G FG +      V++S+ F TN   +GP+G + G TP
Sbjct  481  ----RINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTP  534

Query  414  FNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            F+   ++G  IVGF G  G Y+DAIG Y
Sbjct  535  FSLVMKEGVAIVGFHGLCGAYLDAIGIY  562



>gb|EEE60834.1| hypothetical protein OsJ_14451 [Oryza sativa Japonica Group]
Length=736

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G  EY+TE+SG  G F      V+ S+ F TN  ++GP+G   GTPF+   QD   IVGF
Sbjct  335  GLIEYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGF  394

Query  456  FGRAGFYVDAIGTY  497
            F RAG+YVDA G Y
Sbjct  395  FARAGWYVDAFGIY  408



>ref|NP_001052560.1| Os04g0369100 [Oryza sativa Japonica Group]
 dbj|BAF14474.1| Os04g0369100 [Oryza sativa Japonica Group]
Length=770

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G  EY+TE+SG  G F      V+ S+ F TN  ++GP+G   GTPF+   QD   IVGF
Sbjct  369  GLIEYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGF  428

Query  456  FGRAGFYVDAIGTY  497
            F RAG+YVDA G Y
Sbjct  429  FARAGWYVDAFGIY  442



>ref|XP_009763450.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=1740

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 52/92 (57%), Gaps = 7/92 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG    V+  +T       EYLT I G FG      + V++S+ F TN + +GP+G  
Sbjct  19   GDGGRRDKVVMEET-----PLEYLTCIKGTFGYC--GGYSVVKSLCFITNAKNYGPFGCE  71

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF+   ++G  IVGF GR G Y+DAIG Y
Sbjct  72   AGTPFSLVMKEGGAIVGFHGRCGAYLDAIGVY  103


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 52/146 (36%), Positives = 77/146 (53%), Gaps = 12/146 (8%)
 Frame = +3

Query  66   PLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNET  242
            P G  GG  W+++  + I +I+I  GG  ++      F +  + G+  D    GG G   
Sbjct  151  PWGGTGGSEWNYKLKSPIKEILIAHGGCIDSI----MFKTITEQGTTIDSPKFGGNGGRI  206

Query  243  TVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPFN  419
                N  +  +   E+LT I G  G F    + V++S+ FTTNV+ +GP+G   G TPF+
Sbjct  207  ----NKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFS  260

Query  420  FQAQDGAKIVGFFGRAGFYVDAIGTY  497
               ++G  IVGF GR G Y+DAIG Y
Sbjct  261  LVMKEGVAIVGFHGRCGAYLDAIGVY  286


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 77/148 (52%), Gaps = 14/148 (9%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNE  239
            GP G  GG  W+++  + I +I+I  GG  ++      F +  + G+  D    GG G  
Sbjct  356  GPWGGTGGSEWNYKLKSYIKEILIAHGGCIDSI----MFKTITEQGTTIDSPKFGGNGG-  410

Query  240  TTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TP  413
                R + + I+    EYLT I G FG +      V++S+ F TN   +GP+G + G TP
Sbjct  411  ----RINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTP  464

Query  414  FNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            F+   ++G  IVGF G  G Y+DAIG Y
Sbjct  465  FSLVMKEGVAIVGFHGLCGAYLDAIGIY  492



>gb|EMS51533.1| hypothetical protein TRIUR3_05238 [Triticum urartu]
Length=304

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 53/92 (58%), Gaps = 6/92 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN TT      I +   DE+LT +SG +G        V+RS+ F T   A+GP+G  
Sbjct  158  GAGGNHTT-----QIKLSFPDEHLTAVSGRYGAVAPGGSPVIRSLAFRTERAAYGPFGAA  212

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF F A +G  IVG  GR+G+ +DA+G Y
Sbjct  213  EGTPFEF-AVEGGVIVGLCGRSGWQLDAVGMY  243



>ref|XP_008244753.1| PREDICTED: agglutinin-like [Prunus mume]
Length=179

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 71/146 (49%), Gaps = 9/146 (6%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGG  233
            +  GP G NGG  W     N + +   ++   G+           N    K     G GG
Sbjct  14   IVVGPWGGNGGADWDDGVYNGVRE---ITLVYGHCIDSITVVYDRNGKPVKAETHGGRGG  70

Query  234  NETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTP  413
            N+T  I+     +   DE+L  +SG +   +     ++RS+KF +N R FGPYG   GTP
Sbjct  71   NQTAEIK-----LQYPDEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTP  125

Query  414  FNFQAQDGAKIVGFFGRAGFYVDAIG  491
            F F   DG KIVG  GR G+Y+DAIG
Sbjct  126  FTFTV-DGGKIVGLKGRNGWYLDAIG  150



>ref|XP_004291831.1| PREDICTED: jacalin-related lectin 3 [Fragaria vesca subsp. vesca]
Length=642

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +3

Query  258  DTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDG  437
            DT+ +D  +E+LT   G +G+  +     LRS+ F +N R++GP+G   GT F+     G
Sbjct  72   DTVQLDYPEEFLTSFHGYYGKISEWGTVSLRSITFKSNKRSYGPFGMEQGTYFSLPVTTG  131

Query  438  AKIVGFFGRAGFYVDAIGTY  497
             KIVGF G++G+YVDAIG +
Sbjct  132  NKIVGFHGKSGWYVDAIGAH  151


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            ++D I  D  +E LT I+G FG  +    +V++S+ F T  +  GPYG   GT F+ Q +
Sbjct  307  KSDRIIFDYPNEILTHITGTFGPVMGMGPNVIKSMSFHTTKKKHGPYGEEQGTQFSTQLR  366

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVG  GR G ++DAIG +
Sbjct  367  EG-KIVGIHGRTGLFLDAIGVH  387


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGA  440
            I ++   E L+ ISG +     + R  +++S+ F T+   +GP+G  VGT F     +G 
Sbjct  545  IKLEYPHEVLSCISGYYSCISKNERPQIIKSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  603

Query  441  KIVGFFGRAGFYVDAIGTY  497
            K+VGF GR+  Y+DAIG +
Sbjct  604  KVVGFHGRSSLYLDAIGVH  622



>ref|XP_008677998.1| PREDICTED: mannose/glucose-specific lectin-like isoform X9 [Zea 
mays]
Length=616

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +3

Query  249  IRNDTINID-GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQ  425
            IR  ++ I+ G  E+LT +SG  G F +   +V+ S+ F TN R++GP+G   GTPF+ Q
Sbjct  168  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  226

Query  426  AQDGAKIVGFFGRAGFYVDAIGTY  497
             Q+  +IVGFFGR+G Y+ AIG Y
Sbjct  227  TQNNGRIVGFFGRSGQYLYAIGVY  250


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            N +  + G+ E+LT +SG+ G F +   +V+ S+ F TN R++GP+G   GT F+   Q 
Sbjct  364  NSSFQLAGS-EFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQG  421

Query  435  GAKIVGFFGRAGFYVDAIGTYNA  503
               IVGFFGR+G Y++AIG Y A
Sbjct  422  NGCIVGFFGRSGRYLNAIGVYTA  444



>gb|KDO84683.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=528

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = +3

Query  189  NKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTT  368
            NK GS  C +   GGN  T  + D + +D  DE+LT + G +G   D     +RS+ F +
Sbjct  52   NKGGS--CWSEKHGGNGGT--KFDQVKLDDPDEFLTSVHGHYGATNDRGSVFVRSLTFQS  107

Query  369  NVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSS  530
            N + +GP+G   GT F+F    G KIVGF GR G+Y+DAIG Y   V+  + S+
Sbjct  108  NRKTYGPFGVEQGTYFSF-PMTGGKIVGFHGRCGWYLDAIGIYLKSVVKKVSSN  160


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R+D +  D   E LT+I+G +G  +    +++RS+ F T     GP+G   G  F+ +  
Sbjct  322  RHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIG  381

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVGF GR G ++DAIG Y
Sbjct  382  EG-KIVGFHGRDGLFLDAIGVY  402



>ref|XP_008677994.1| PREDICTED: mannose/glucose-specific lectin-like isoform X6 [Zea 
mays]
Length=684

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +3

Query  249  IRNDTINID-GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQ  425
            IR  ++ I+ G  E+LT +SG  G F +   +V+ S+ F TN R++GP+G   GTPF+ Q
Sbjct  236  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  294

Query  426  AQDGAKIVGFFGRAGFYVDAIGTY  497
             Q+  +IVGFFGR+G Y+ AIG Y
Sbjct  295  TQNNGRIVGFFGRSGQYLYAIGVY  318


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            N +  + G+ E+LT +SG+ G F +   +V+ S+ F TN R++GP+G   GT F+   Q 
Sbjct  432  NSSFQLAGS-EFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQG  489

Query  435  GAKIVGFFGRAGFYVDAIGTYNA  503
               IVGFFGR+G Y++AIG Y A
Sbjct  490  NGCIVGFFGRSGRYLNAIGVYTA  512



>ref|XP_009622524.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Nicotiana 
tomentosiformis]
Length=569

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 54/95 (57%), Gaps = 3/95 (3%)
 Frame = +3

Query  252  RNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQA  428
            R D + I+    EYLT I G FGR     + V++ + F TN + +GP+G   GTPF+   
Sbjct  23   RRDKVVIEATPLEYLTGIKGTFGRC--GSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVM  80

Query  429  QDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSSE  533
            ++G  IVGF GR G Y+DAIG Y   +    LS E
Sbjct  81   KEGGAIVGFHGRCGAYLDAIGVYLRKLTPPTLSKE  115


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = +3

Query  252  RNDTINIDGADE-YLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQA  428
            R D + I  +   YLT I G FGR+    + V++S+ F TN + +GP+G   GTPF+   
Sbjct  206  RRDKVVIKASPLVYLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVI  263

Query  429  QDGAKIVGFFGRAGFYVDAIGTY  497
            ++G  I GF G    Y+DAIG Y
Sbjct  264  KEGGAIEGFHGHCRAYLDAIGVY  286


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFG  461
            E+LT I G F  F      V++S+ F TN   +GP+G   G TPF+   ++G  IVGF G
Sbjct  424  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  481

Query  462  RAGFYVDAIGTY  497
            R+G Y+DAIG Y
Sbjct  482  RSGLYLDAIGVY  493



>ref|XP_008677996.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
 ref|XP_008677997.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
Length=652

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +3

Query  249  IRNDTINID-GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQ  425
            IR  ++ I+ G  E+LT +SG  G F +   +V+ S+ F TN R++GP+G   GTPF+ Q
Sbjct  204  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  262

Query  426  AQDGAKIVGFFGRAGFYVDAIGTY  497
             Q+  +IVGFFGR+G Y+ AIG Y
Sbjct  263  TQNNGRIVGFFGRSGQYLYAIGVY  286


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            N +  + G+ E+LT +SG+ G F +   +V+ S+ F TN R++GP+G   GT F+   Q 
Sbjct  400  NSSFQLAGS-EFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQG  457

Query  435  GAKIVGFFGRAGFYVDAIGTYNA  503
               IVGFFGR+G Y++AIG Y A
Sbjct  458  NGCIVGFFGRSGRYLNAIGVYTA  480



>gb|KDO84682.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=619

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = +3

Query  189  NKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTT  368
            NK GS  C +   GGN  T  + D + +D  DE+LT + G +G   D     +RS+ F +
Sbjct  52   NKGGS--CWSEKHGGNGGT--KFDQVKLDDPDEFLTSVHGHYGATNDRGSVFVRSLTFQS  107

Query  369  NVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSS  530
            N + +GP+G   GT F+F    G KIVGF GR G+Y+DAIG Y   V+  + S+
Sbjct  108  NRKTYGPFGVEQGTYFSF-PMTGGKIVGFHGRCGWYLDAIGIYLKSVVKKVSSN  160


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = +3

Query  216  TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPY  392
            ++  GGN  T      I ++   E LT ISG +G    D R  V+RS+ F T+   +GP+
Sbjct  508  SVKHGGNGGTYTHR--IKLEYPHEVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPF  565

Query  393  GPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            G  VGT F     +G K+VGF GR+ FY+DAIG +
Sbjct  566  GEEVGTFFTSTTTEG-KVVGFHGRSSFYLDAIGVH  599


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R+D +  D   E LT+I+G +G  +    +++RS+ F T     GP+G   G  F+ +  
Sbjct  322  RHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIG  381

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVGF GR G ++DAIG Y
Sbjct  382  EG-KIVGFHGRDGLFLDAIGVY  402



>ref|XP_008677986.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677987.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677988.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677989.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
Length=783

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +3

Query  249  IRNDTINID-GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQ  425
            IR  ++ I+ G  E+LT +SG  G F +   +V+ S+ F TN R++GP+G   GTPF+ Q
Sbjct  335  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  393

Query  426  AQDGAKIVGFFGRAGFYVDAIGTY  497
             Q+  +IVGFFGR+G Y+ AIG Y
Sbjct  394  TQNNGRIVGFFGRSGQYLYAIGVY  417


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            N +  + G+ E+LT +SG+ G F +   +V+ S+ F TN R++GP+G   GT F+   Q 
Sbjct  531  NSSFQLAGS-EFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQG  588

Query  435  GAKIVGFFGRAGFYVDAIGTYNA  503
               IVGFFGR+G Y++AIG Y A
Sbjct  589  NGCIVGFFGRSGRYLNAIGVYTA  611



>gb|EMT18893.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=809

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 62/107 (58%), Gaps = 5/107 (5%)
 Frame = +3

Query  177  FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
            FS  + DG +   T G  G+      ND I+++ + E L E+SG  G +     +V+ S+
Sbjct  704  FSYRDHDGKRH--TAGPWGSHPGE-NNDVIHLEPS-EILKEVSGTVGSY-GALTNVITSL  758

Query  357  KFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
               T+ R +GP+G   G PF+ +A   + I+GFFGR+G+Y+DAIG Y
Sbjct  759  TLVTSARTYGPFGKGDGIPFSMEAASNSSIIGFFGRSGWYLDAIGVY  805



>gb|ACF87628.1| unknown [Zea mays]
Length=122

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            DE LTEISG  G   +   ++++S+KF TN RA+GPYG + GTPF  +  +   + GFFG
Sbjct  48   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHVAGFFG  106

Query  462  RAGFYVDAIGTY  497
            R+G  +DAIG Y
Sbjct  107  RSGDCLDAIGLY  118



>ref|NP_001052399.1| Os04g0295400 [Oryza sativa Japonica Group]
 emb|CAD40444.2| OSJNBa0041M21.2 [Oryza sativa Japonica Group]
 dbj|BAF14313.1| Os04g0295400 [Oryza sativa Japonica Group]
Length=150

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG-PNVGTPFNFQAQDGAKIVG  452
            G  +++ EISG  G ++    +VLRS+K TT  R +GPYG P  G PF+F      +I G
Sbjct  72   GLMDFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPFSFSVDGSDRITG  131

Query  453  FFGRAGFYVDAIGTY  497
            FF RAGF  DAIG Y
Sbjct  132  FFVRAGFITDAIGVY  146



>ref|XP_008677991.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Zea 
mays]
Length=778

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +3

Query  249  IRNDTINID-GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQ  425
            IR  ++ I+ G  E+LT +SG  G F +   +V+ S+ F TN R++GP+G   GTPF+ Q
Sbjct  335  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  393

Query  426  AQDGAKIVGFFGRAGFYVDAIGTY  497
             Q+  +IVGFFGR+G Y+ AIG Y
Sbjct  394  TQNNGRIVGFFGRSGQYLYAIGVY  417


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            N +  + G+ E+LT +SG+ G F +   +V+ S+ F TN R++GP+G   GT F+   Q 
Sbjct  531  NSSFQLAGS-EFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQG  588

Query  435  GAKIVGFFGRAGFYVDAIGTYNA  503
               IVGFFGR+G Y++AIG Y A
Sbjct  589  NGCIVGFFGRSGRYLNAIGVYTA  611



>ref|XP_008677990.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Zea 
mays]
Length=781

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +3

Query  249  IRNDTINID-GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQ  425
            IR  ++ I+ G  E+LT +SG  G F +   +V+ S+ F TN R++GP+G   GTPF+ Q
Sbjct  333  IRVASMMIELGPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQ  391

Query  426  AQDGAKIVGFFGRAGFYVDAIGTY  497
             Q+  +IVGFFGR+G Y+ AIG Y
Sbjct  392  TQNNGRIVGFFGRSGQYLYAIGVY  415


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            N +  + G+ E+LT +SG+ G F +   +V+ S+ F TN R++GP+G   GT F+   Q 
Sbjct  529  NSSFQLAGS-EFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQG  586

Query  435  GAKIVGFFGRAGFYVDAIGTYNA  503
               IVGFFGR+G Y++AIG Y A
Sbjct  587  NGCIVGFFGRSGRYLNAIGVYTA  609



>emb|CDY48032.1| BnaA02g16250D [Brassica napus]
Length=230

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+TT I+     +   +EYL  +SG     + +   V+RS+ F +N + +GPYG  
Sbjct  120  GQGGNKTTEIK-----LQYPEEYLIGVSGYCCPVVHSGTPVIRSMTFKSNKQVYGPYGVE  174

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF+F   +G +IVG  GR+G+Y+D+IG
Sbjct  175  QGTPFSFSV-NGGRIVGMNGRSGWYLDSIG  203



>gb|KJB58185.1| hypothetical protein B456_009G198200 [Gossypium raimondii]
Length=1244

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 8/97 (8%)
 Frame = +3

Query  222   GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
             G GG++T     D + +D  DE+LT I G +G        ++RS+ F +N +A+GP+G  
Sbjct  975   GNGGSKT-----DKVKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPFGIE  1029

Query  402   VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA*VI  512
              GT F   + +  KIVGF GR+G+Y+DAIG Y+  V+
Sbjct  1030  QGTSF---SMNKGKIVGFRGRSGWYLDAIGVYSKPVL  1063



>gb|EAY93469.1| hypothetical protein OsI_15270 [Oryza sativa Indica Group]
Length=150

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG-PNVGTPFNFQAQDGAKIVG  452
            G  +++ EISG  G ++    +VLRS+K TT  R +GPYG P  G PF+F      +I G
Sbjct  72   GLMDFVMEISGTTGMWVSGMRNVLRSLKITTLKRTYGPYGNPEAGIPFSFSVDGSDRITG  131

Query  453  FFGRAGFYVDAIGTY  497
            FF RAGF  DAIG Y
Sbjct  132  FFVRAGFITDAIGVY  146



>gb|KJB58186.1| hypothetical protein B456_009G198200 [Gossypium raimondii]
Length=1512

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 8/97 (8%)
 Frame = +3

Query  222   GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
             G GG++T     D + +D  DE+LT I G +G        ++RS+ F +N +A+GP+G  
Sbjct  975   GNGGSKT-----DKVKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPFGIE  1029

Query  402   VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA*VI  512
              GT F   + +  KIVGF GR+G+Y+DAIG Y+  V+
Sbjct  1030  QGTSF---SMNKGKIVGFRGRSGWYLDAIGVYSKPVL  1063


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 5/92 (5%)
 Frame = +3

Query  222   GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
             GG G      + + I  D   E LT I+G F   +    +V+RS+ F TN    GPYG  
Sbjct  1209  GGTGG----FKTERIMFDYPSEILTHITGTFAPLMYMGPNVIRSLTFYTNKGKHGPYGDE  1264

Query  402   VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              G  F  +  +G KIVGF GR G ++DA+G +
Sbjct  1265  QGPSFTNKMNEG-KIVGFLGREGLFLDAVGVH  1295


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 2/79 (3%)
 Frame = +3

Query  264   INIDGADEYLTEISGAFGRF-IDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGA  440
             + +D   E L  ISG +G    + +  V+RS+ F T+   +GP+G  VGT F      G 
Sbjct  1415  VKLDYPHEVLICISGYYGSINEEEKSKVIRSLTFYTSRGKYGPFGEEVGTYFTSTTTQG-  1473

Query  441   KIVGFFGRAGFYVDAIGTY  497
             K+VGF GR   Y+DAIG +
Sbjct  1474  KVVGFHGRCSSYLDAIGVH  1492



>ref|XP_006473571.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X1 [Citrus sinensis]
Length=619

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = +3

Query  189  NKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTT  368
            NK GS  C +   GGN  T  + D + +D  DE+LT + G +G   D     +RS+ F +
Sbjct  52   NKGGS--CWSEKHGGNGGT--KFDQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQS  107

Query  369  NVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSS  530
            N + +GP+G   GT F+F    G KIVGF GR G+Y+DAIG Y   V+  + S+
Sbjct  108  NRKTYGPFGVEQGTYFSF-PMTGGKIVGFHGRCGWYLDAIGIYLKSVVKKVSSN  160


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 55/99 (56%), Gaps = 4/99 (4%)
 Frame = +3

Query  204  KDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRA  380
            +   ++  GGN  T      I ++   E LT ISG +G    D R  V+RS+ F T+   
Sbjct  504  QSIWSVKHGGNGGTYTHR--IKLEFPHEVLTCISGYYGPISRDERPKVIRSLTFDTSRGK  561

Query  381  FGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +GP+G  VGT F     +G K+VGF GR+ FY+DAIG +
Sbjct  562  YGPFGEEVGTFFTSTTTEG-KVVGFHGRSSFYLDAIGVH  599


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R+D +  D   E LT+I+G +G  +    +++RS+ F T     GP+G   G  F+ +  
Sbjct  322  RHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIG  381

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVGF GR G ++DAIG Y
Sbjct  382  EG-KIVGFHGRDGLFLDAIGVY  402



>ref|XP_002467724.1| hypothetical protein SORBIDRAFT_01g033080 [Sorghum bicolor]
 gb|EER94722.1| hypothetical protein SORBIDRAFT_01g033080 [Sorghum bicolor]
Length=153

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = +3

Query  174  TFSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
            +FS  ++DG    L   G    T  ++ +TI + G DE++TE++GA G F +     +  
Sbjct  46   SFSYRDRDGK---LHTAGPWGGTGGLKEETITL-GPDEFVTEVAGAIGPFGELITHAVAW  101

Query  354  VKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +KF TN   +GP+G   GTPFN    +   IVG F RA  Y+DAIG Y
Sbjct  102  LKFVTNRGTYGPFGHGDGTPFNVPVLNNGSIVGMFARADQYLDAIGFY  149



>ref|XP_006435072.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
 gb|ESR48312.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
Length=619

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 65/114 (57%), Gaps = 5/114 (4%)
 Frame = +3

Query  189  NKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTT  368
            NK GS  C +   GGN  T  + D + +D  DE+LT + G +G   D     +RS+ F +
Sbjct  52   NKGGS--CWSEKHGGNGGT--KFDQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQS  107

Query  369  NVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSS  530
            N + +GP+G   GT F+F    G KIVGF GR G+Y+DAIG Y   V+  + S+
Sbjct  108  NRKTYGPFGVEQGTYFSF-PMTGGKIVGFHGRCGWYLDAIGIYLKSVVKKVSSN  160


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = +3

Query  216  TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPY  392
            ++  GGN  T      I ++   E LT ISG +G    D R  V+RS+ F T+   +GP+
Sbjct  508  SVKHGGNGGTYTHR--IKLEYPHEVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPF  565

Query  393  GPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            G  VGT F     +G K+VGF GR+ FY+DAIG +
Sbjct  566  GEEVGTFFTSTTTEG-KVVGFHGRSSFYLDAIGVH  599


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R+D +  D   E LT+I+G +G  +    +++RS+ F T     GP+G   G  F+ +  
Sbjct  322  RHDRVIFDYPYEILTQITGTYGPLMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIG  381

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVGF GR G ++DAIG Y
Sbjct  382  EG-KIVGFHGRDGLFLDAIGVY  402



>ref|XP_009763456.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X4 [Nicotiana sylvestris]
Length=1606

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 52/146 (36%), Positives = 77/146 (53%), Gaps = 12/146 (8%)
 Frame = +3

Query  66   PLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNET  242
            P G  GG  W+++  + I +I+I  GG  ++      F +  + G+  D    GG G   
Sbjct  17   PWGGTGGSEWNYKLKSPIKEILIAHGGCIDSI----MFKTITEQGTTIDSPKFGGNGGRI  72

Query  243  TVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPFN  419
                N  +  +   E+LT I G  G F    + V++S+ FTTNV+ +GP+G   G TPF+
Sbjct  73   ----NKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFS  126

Query  420  FQAQDGAKIVGFFGRAGFYVDAIGTY  497
               ++G  IVGF GR G Y+DAIG Y
Sbjct  127  LVMKEGVAIVGFHGRCGAYLDAIGVY  152


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 77/148 (52%), Gaps = 14/148 (9%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNE  239
            GP G  GG  W+++  + I +I+I  GG  ++      F +  + G+  D    GG G  
Sbjct  222  GPWGGTGGSEWNYKLKSYIKEILIAHGGCIDSI----MFKTITEQGTTIDSPKFGGNGG-  276

Query  240  TTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TP  413
                R + + I+    EYLT I G FG +      V++S+ F TN   +GP+G + G TP
Sbjct  277  ----RINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTP  330

Query  414  FNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            F+   ++G  IVGF G  G Y+DAIG Y
Sbjct  331  FSLVMKEGVAIVGFHGLCGAYLDAIGIY  358



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 52/146 (36%), Positives = 77/146 (53%), Gaps = 12/146 (8%)
 Frame = +3

Query  66   PLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNET  242
            P G  GG  W+++  + I +I+I  GG  ++      F +  + G+  D    GG G   
Sbjct  153  PWGGTGGSEWNYKLKSPIKEILIAHGGCIDSI----MFKTITEQGTTIDSPKFGGNGGRI  208

Query  243  TVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPFN  419
                N  +  +   E+LT I G  G F    + V++S+ FTTNV+ +GP+G   G TPF+
Sbjct  209  ----NKVVFEETPLEHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFS  262

Query  420  FQAQDGAKIVGFFGRAGFYVDAIGTY  497
               ++G  IVGF GR G Y+DAIG Y
Sbjct  263  LVMKEGVAIVGFHGRCGAYLDAIGVY  288


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 77/148 (52%), Gaps = 14/148 (9%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSK-DCLTIGGGGNE  239
            GP G  GG  W+++  + I +I+I  GG  ++      F +  + G+  D    GG G  
Sbjct  358  GPWGGTGGSEWNYKLKSYIKEILIAHGGCIDSI----MFKTITEQGTTIDSPKFGGNGG-  412

Query  240  TTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TP  413
                R + + I+    EYLT I G FG +      V++S+ F TN   +GP+G + G TP
Sbjct  413  ----RINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTP  466

Query  414  FNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            F+   ++G  IVGF G  G Y+DAIG Y
Sbjct  467  FSLVMKEGVAIVGFHGLCGAYLDAIGIY  494


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 58/110 (53%), Gaps = 10/110 (9%)
 Frame = +3

Query  177  FSSTNKDGSK-DCLTIGGGGNETTVIRNDTINIDGA-DEYLTEISGAFGRFIDTRFDVLR  350
            F +  + G+  D    GG G      R D + I  +  EYLT I G F R       V+ 
Sbjct  2    FRTITEQGTTIDSPMFGGDGG-----RRDKVVIKASPSEYLTGIKGTF-RGCGIHL-VIN  54

Query  351  SVKFTTNVRAFGPYGP-NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+ F TN + +GP+G  + GTPF+F  ++G  I GF GR G Y+DAIG Y
Sbjct  55   SLCFITNAKNYGPFGSKDGGTPFSFAMKEGGAIEGFQGRCGAYLDAIGVY  104



>ref|XP_008244775.1| PREDICTED: LOW QUALITY PROTEIN: agglutinin-like [Prunus mume]
Length=343

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 56/93 (60%), Gaps = 11/93 (12%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRF---IDTRFDVLRSVKFTTNVRAFGPY  392
            G GGN+T     D I +   DE+L  +SG +      I  R  ++RS+KF +N R FGPY
Sbjct  230  GRGGNQT-----DEIKLQYPDEFLVGVSGHYCPMMFGIGPR--LIRSLKFQSNRRTFGPY  282

Query  393  GPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            G   GTPF F   DG KIVG  GR+G+Y+DAIG
Sbjct  283  GIEEGTPFTFTV-DGGKIVGLKGRSGWYLDAIG  314


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 47/80 (59%), Gaps = 8/80 (10%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDV----LRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            I +   DEYL    GA G +    F +    +RS+KF +N R FGPYG   GTPF F   
Sbjct  83   IKLQYPDEYLV---GASGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-  138

Query  432  DGAKIVGFFGRAGFYVDAIG  491
            DG +IVG  GR G+Y++AIG
Sbjct  139  DGGQIVGLKGRDGWYLNAIG  158



>ref|XP_004490606.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Cicer 
arietinum]
Length=605

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 55/92 (60%), Gaps = 6/92 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T     D + +D  DE+LT I G +G       +++RS+ F +N + +GP+G  
Sbjct  69   GSGGNKT-----DKVKLDYPDEFLTSIHGYYGSLNQWGHNLVRSLSFESNKKTYGPFGVE  123

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GT F+     GAKIVGF G  G+Y+DAIG Y
Sbjct  124  HGTFFSV-PMTGAKIVGFHGSCGWYLDAIGVY  154


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            +ND I  D   E LT ISG +G  +     V+RS+ F T  R +GP+G   GT F  + +
Sbjct  308  KNDKIVFDFPYEVLTHISGYYGPLMYMGPAVVRSLTFHTTKRKYGPFGEEQGTYFTTKVK  367

Query  432  DGAKIVGFFGRAGFYVDAIG  491
            +G KIVG  G+ G ++DA G
Sbjct  368  EG-KIVGIHGKKGLFLDAFG  386


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 6/93 (6%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGP  398
            GG G +T       I ++   E LT ISG +G    D    +++S+ F T+   +GPYG 
Sbjct  499  GGNGGDTM----HRIQLEYPHEVLTCISGYYGSITKDENQTIIKSLTFHTSRGQYGPYGE  554

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             VG  F     +G K+VGF GR+  Y+DAIG +
Sbjct  555  EVGKFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  586



>ref|XP_006426466.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
 ref|XP_006466099.1| PREDICTED: agglutinin-like [Citrus sinensis]
 gb|ESR39706.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
Length=190

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 6/92 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN T  I+     +   +E+L  +SG +   +     V+RS+ F +N R FGP+G  
Sbjct  68   GVGGNRTAEIK-----LRFPEEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGVE  122

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF F + DG  +VGF GR+G+YVDAIG Y
Sbjct  123  EGTPFTF-SMDGGLVVGFKGRSGWYVDAIGFY  153



>ref|XP_004490607.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Cicer 
arietinum]
Length=600

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 55/92 (60%), Gaps = 6/92 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T     D + +D  DE+LT I G +G       +++RS+ F +N + +GP+G  
Sbjct  64   GSGGNKT-----DKVKLDYPDEFLTSIHGYYGSLNQWGHNLVRSLSFESNKKTYGPFGVE  118

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GT F+     GAKIVGF G  G+Y+DAIG Y
Sbjct  119  HGTFFSV-PMTGAKIVGFHGSCGWYLDAIGVY  149


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            +ND I  D   E LT ISG +G  +     V+RS+ F T  R +GP+G   GT F  + +
Sbjct  303  KNDKIVFDFPYEVLTHISGYYGPLMYMGPAVVRSLTFHTTKRKYGPFGEEQGTYFTTKVK  362

Query  432  DGAKIVGFFGRAGFYVDAIG  491
            +G KIVG  G+ G ++DA G
Sbjct  363  EG-KIVGIHGKKGLFLDAFG  381


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 6/93 (6%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGP  398
            GG G +T       I ++   E LT ISG +G    D    +++S+ F T+   +GPYG 
Sbjct  494  GGNGGDTM----HRIQLEYPHEVLTCISGYYGSITKDENQTIIKSLTFHTSRGQYGPYGE  549

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             VG  F     +G K+VGF GR+  Y+DAIG +
Sbjct  550  EVGKFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  581



>gb|AAB72098.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 7/86 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+ T +        GA E++ E+SG FG +     +++ S+KF TNV+ +GP+G  
Sbjct  216  GSGGNQNTFVL-------GASEFVKEVSGTFGIYDKDLHNIITSLKFITNVKTYGPFGEA  268

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYV  479
             GTPF    Q  + IVGFF R G+ +
Sbjct  269  KGTPFTIAVQKNSSIVGFFARTGYIL  294



>ref|XP_010092355.1| hypothetical protein L484_023733 [Morus notabilis]
 gb|EXB51031.1| hypothetical protein L484_023733 [Morus notabilis]
Length=185

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = +3

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRF--IDTRFDVLRSVKFTTNVRAFGPYGPNV  404
            GNE T  +   I +D  +E+L  +SG  G    + T  DV+RS+ F TN + +GPYG   
Sbjct  94   GNEPTY-KTVKITLDFPNEFLVSVSGHTGVLPRLATGKDVIRSLTFKTNQKTYGPYGKEE  152

Query  405  GTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            GTPF+   ++G  IVGF GR+GF VDAIG
Sbjct  153  GTPFSLPIENGL-IVGFKGRSGFVVDAIG  180



>ref|NP_001106057.1| PL3K2 [Zea mays]
 gb|ABR68026.1| PL3K2 [Zea mays]
 gb|ACF80462.1| unknown [Zea mays]
 gb|ACG30569.1| hypothetical protein [Zea mays]
Length=151

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            DE LTEISG  G   +   ++++S+KF TN RA+GPYG + GTPF  +  +   + GFFG
Sbjct  77   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHVAGFFG  135

Query  462  RAGFYVDAIGTY  497
            R+G  +DAIG Y
Sbjct  136  RSGDCLDAIGLY  147



>gb|EMS58273.1| hypothetical protein TRIUR3_17900 [Triticum urartu]
Length=304

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 59/109 (54%), Gaps = 9/109 (8%)
 Frame = +3

Query  177  FSSTNKDGSKDCLTI--GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLR  350
            FS  ++ G K  +    G GG + T +        G  E++ E SG F  +     +++ 
Sbjct  199  FSYVDQAGQKRTVGPWGGSGGKQNTFVL-------GTSEFVKEFSGTFSLYGRDNHNIIT  251

Query  351  SVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+KF TN++ +GP+G   GT F    Q  + IVGFFGR+G Y+DA+G Y
Sbjct  252  SLKFVTNMKTYGPFGQAKGTTFTIPVQKNSNIVGFFGRSGIYLDALGVY  300



>ref|XP_008677992.1| PREDICTED: mannose/glucose-specific lectin-like isoform X4 [Zea 
mays]
Length=760

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G  E+LT +SG  G F +   +V+ S+ F TN R++GP+G   GTPF+ Q Q+  +IVGF
Sbjct  322  GPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGF  380

Query  456  FGRAGFYVDAIGTY  497
            FGR+G Y+ AIG Y
Sbjct  381  FGRSGQYLYAIGVY  394


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            N +  + G+ E+LT +SG+ G F +   +V+ S+ F TN R++GP+G   GT F+   Q 
Sbjct  508  NSSFQLAGS-EFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQG  565

Query  435  GAKIVGFFGRAGFYVDAIGTYNA  503
               IVGFFGR+G Y++AIG Y A
Sbjct  566  NGCIVGFFGRSGRYLNAIGVYTA  588



>ref|XP_006473572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X2 [Citrus sinensis]
Length=1252

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 60/103 (58%), Gaps = 5/103 (5%)
 Frame = +3

Query  189  NKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTT  368
            NK GS  C +   GGN  T  + D + +D  DE+LT + G +G   D     +RS+ F +
Sbjct  685  NKGGS--CWSEKHGGNGGT--KFDQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQS  740

Query  369  NVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            N + +GP+G   GT F+F    G KIVGF GR G+Y+DAIG Y
Sbjct  741  NRKTYGPFGVEQGTYFSF-PMTGGKIVGFHGRCGWYLDAIGIY  782


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 4/95 (4%)
 Frame = +3

Query  216   TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPY  392
             ++  GGN  T      I ++   E LT ISG +G    D R  V+RS+ F T+   +GP+
Sbjct  1141  SVKHGGNGGTYTHR--IKLEFPHEVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPF  1198

Query  393   GPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             G  VGT F     +G K+VGF GR+ FY+DAIG +
Sbjct  1199  GEEVGTFFTSTTTEG-KVVGFHGRSSFYLDAIGVH  1232


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query  252   RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
             R+D +  D   E LT+I+G +G  +    +++RS+ F T     GP+G   G  F+ +  
Sbjct  955   RHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIG  1014

Query  432   DGAKIVGFFGRAGFYVDAIGTY  497
             +G KIVGF GR G ++DAIG Y
Sbjct  1015  EG-KIVGFHGRDGLFLDAIGVY  1035



>gb|KFK41744.1| hypothetical protein AALP_AA2G166700 [Arabis alpina]
Length=176

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 6/88 (7%)
 Frame = +3

Query  228  GGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            GGN+T+ I+     +   +EYL  +SG +   I +   V+RS+ F +N + +GPYG   G
Sbjct  68   GGNKTSEIK-----LQYPEEYLIGVSGYYCPVIHSGTPVIRSMTFKSNKQVYGPYGIEQG  122

Query  408  TPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            TPF F   +G +IVG  GR+G+Y+D+IG
Sbjct  123  TPFTFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_007024409.1| Mannose-binding lectin superfamily protein [Theobroma cacao]
 gb|EOY27031.1| Mannose-binding lectin superfamily protein [Theobroma cacao]
Length=298

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T  I+     ++  +E+L  +SG +   +     V+RS+ F +N R FGPYG  
Sbjct  180  GMGGNKTAEIK-----LNFPEEFLISVSGHYCPVVHGGGPVIRSLTFKSNQRTFGPYGVE  234

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F + +G +I GF GR+G+Y+D+IG
Sbjct  235  EGTPFTF-SMEGGRIAGFNGRSGWYLDSIG  263



>gb|AAL10685.1| mannose-binding lectin [Morus nigra]
Length=161

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +3

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRF--IDTRFDVLRSVKFTTNVRAFGPYGPNV  404
            GNE +  +   I +D  +E+L  +SG  G    + T  DV+RS+ F TN + +GPYG   
Sbjct  70   GNEPS-FKTVKITLDFPNEFLVSVSGYTGVLPRLATGKDVIRSLTFKTNKKTYGPYGKEE  128

Query  405  GTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            GTPF+   ++G  IVGF GR+GF VDAIG +
Sbjct  129  GTPFSLPIENGL-IVGFKGRSGFVVDAIGVH  158



>ref|XP_010232946.1| PREDICTED: uncharacterized protein LOC104583002 [Brachypodium 
distachyon]
Length=250

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            DE+LT + G  G     ++ V++S+ F +N R +GPYG + G PF   A  G +IVGF G
Sbjct  154  DEHLTCVKGLLGNH--AQWFVVKSLTFVSNRRTYGPYGEDHGVPFELPAPAGGRIVGFHG  211

Query  462  RAGFYVDAIGTY  497
            R+G  +DAIGTY
Sbjct  212  RSGGLLDAIGTY  223



>ref|XP_004297619.2| PREDICTED: agglutinin [Fragaria vesca subsp. vesca]
Length=525

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFG--RFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDG  437
            I ++  DE+L  ISG +    +I     VLRS+KF +N R FGP+G   GTPF F+ +D 
Sbjct  295  IKLECPDEFLVSISGYYCGVTWIVGAPVVLRSLKFESNKRTFGPFGNQFGTPFTFKVKDS  354

Query  438  AKIVGFFGRAGFYVDAIGTYN  500
             +IVGF GR G Y+DAIG ++
Sbjct  355  DRIVGFKGRKGRYLDAIGFHS  375


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGR---FIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            + ++  +E++  +SG          TR  V+RS+KF +N R +GP+G  VGTPF+F+ +D
Sbjct  446  VKLEYPNEFMVTVSGHISWVPWMSGTR--VVRSLKFDSNRRTYGPFGVQVGTPFSFRVKD  503

Query  435  GAKIVGFFGRAGFYVDAIGTY  497
            G +IVG  GR+G+Y+ AIG Y
Sbjct  504  GDQIVGLRGRSGWYLYAIGFY  524



>sp|P83304.1|LEC_PARPC RecName: Full=Mannose/glucose-specific lectin, partial [Parkia 
platycephala]
 pdb|1ZGR|A Chain A, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGR|B Chain B, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGS|A Chain A, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
 pdb|1ZGS|B Chain B, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
Length=447

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 83/154 (54%), Gaps = 12/154 (8%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGS-KDCLT  218
            +   ++ GP G +GGD WS+     I+QIII +G +          S   KD S  D  T
Sbjct  297  VEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIK--------SVAFKDTSGLDSAT  348

Query  219  IGGGGNETTVIRNDTINIDGADEYLTEISGAFGRF-IDTRFDVLRSVKFTTNVRAFGPYG  395
             GG   + T  +N T++I+   EYLT ISG +G++     F  + S+ FTTN+  +GP+G
Sbjct  349  FGGVNPKDTGEKN-TVSINWPSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFG  407

Query  396  PNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
                T F+    +   +VGF GRAG Y+DAIG +
Sbjct  408  KASATSFSIPIHNNM-VVGFHGRAGDYLDAIGIF  440


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 79/151 (52%), Gaps = 14/151 (9%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGG  233
            ++ GP G +GG++WSF+  + I +I+I    +          S + KD S D     GG 
Sbjct  6    ISVGPWGGSGGNYWSFKANHAITEIVIHVKDNIK--------SISFKDASGDISGTFGGK  57

Query  234  NETTVIRND--TINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            +     + D   I I    EYL  ISG++G +      V+RS+ F TN+  +GP+G   G
Sbjct  58   DPRENEKGDEKKIKIHWPTEYLKSISGSYGDYNGVL--VIRSLSFITNLTTYGPFGSTSG  115

Query  408  -TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
               F+    D + +VGF GRAG+Y+DA+G +
Sbjct  116  GESFSIPIAD-SVVVGFHGRAGYYLDALGIF  145


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (56%), Gaps = 3/102 (3%)
 Frame = +3

Query  192  KDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTN  371
            KD +  C    GG +   +     + IDG  E+L  ISG +G +    F+V+ S+ F TN
Sbjct  193  KDANGHCYGKFGGQDPNDIGVEKKVEIDGNLEHLKSISGTYGNY--KGFEVVTSLSFITN  250

Query  372  VRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            V   GP+G   GT F+   + G+ + GF G++G+Y+D+IG Y
Sbjct  251  VTKHGPFGIASGTSFSIPIE-GSLVTGFHGKSGYYLDSIGIY  291



>ref|XP_010932970.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Elaeis 
guineensis]
Length=200

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 77/152 (51%), Gaps = 13/152 (9%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTI  221
            I + VA GP G +GG  WSF     I +I I  G   ++     TF   + + ++     
Sbjct  56   IQSPVAVGPWGGSGGTAWSFETAWTITKIKISVGDVVDSI----TFQYMDGETTRWSSRY  111

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GG G + T I        G +  L  ISG +G +      V++S+ F T    +GPYGP 
Sbjct  112  GGAGGKPTEIDL------GTNNNLEAISGHYGNYYGK--TVIKSLTFVTTTGTYGPYGPE  163

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GT F+   + G K+VGFFGRAG ++DA+G Y
Sbjct  164  EGTTFSLPVKAG-KVVGFFGRAGQWLDALGFY  194



>ref|XP_010060992.1| PREDICTED: jacalin-related lectin 3 [Eucalyptus grandis]
 gb|KCW67893.1| hypothetical protein EUGRSUZ_F01603 [Eucalyptus grandis]
Length=598

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +3

Query  258  DTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDG  437
            DT+ +D  DE+L  + G +G+  D    ++RS+ F +N + +GPYG   G  F+F +  G
Sbjct  71   DTVKLDFPDEFLISVHGHYGKINDWGPILVRSLTFESNRKTYGPYGVQQGGSFSFPSTTG  130

Query  438  AKIVGFFGRAGFYVDAIGTY  497
             KIVGF G+AG+Y+DAIG Y
Sbjct  131  -KIVGFHGKAGWYLDAIGVY  149


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R+D I +D  DE LT I+G  G  +     ++RS+ F TN    GP+G   G  F  +++
Sbjct  304  RHDKIVLDYPDEVLTHITGTCGPLMSMGPTIIRSIAFHTNRGKHGPFGEERGASFTSKSK  363

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KI+GF GR G ++DAIG +
Sbjct  364  EG-KIIGFHGRGGLFIDAIGIH  384


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 51/95 (54%), Gaps = 8/95 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRF---DVLRSVKFTTNVRAFGPY  392
            GG G  TT      I ++  +E LT ISG +G      +     +RS+ F T+   +GP+
Sbjct  489  GGNGGLTT----HRIKLEYPNEVLTCISGYYGPVGKDEWPQPQFIRSLTFHTSRGKYGPF  544

Query  393  GPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            G  VGT F     +G K+VGF GR+  Y+DAIG +
Sbjct  545  GEEVGTFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  578



>ref|XP_004961357.1| PREDICTED: agglutinin-like [Setaria italica]
Length=208

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 54/94 (57%), Gaps = 6/94 (6%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN TT IR     +   DE+LT +SG +         V+RS+ F +N RA+GP+G  
Sbjct  68   GAGGNHTTQIR-----LGFPDEHLTGVSGHYSPIAAGGSPVIRSLAFRSNQRAYGPFGVA  122

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA  503
             G  F F   DG  IVGF GR+G+ +DA+G Y A
Sbjct  123  EGAAFTFPV-DGGVIVGFCGRSGWQLDAVGLYVA  155



>ref|XP_006372713.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
 gb|ERP50510.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
Length=173

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 76/152 (50%), Gaps = 11/152 (7%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTI  221
            I   ++ GP G  GG+ WS+     I+QI+I  G +          S + +D +      
Sbjct  26   IEGTISIGPWGGQGGNPWSYMTNQGINQIVINVGSNIK--------SISFRDTTDLDSAT  77

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
             GG N   +    T+ I+   E+L  ISG +G F  +    + S+ FTTN   +GP+G  
Sbjct  78   FGGNNPNDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTG  135

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF+    +   +VGF GRAG Y+DAIG +
Sbjct  136  SGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  166



>ref|XP_002450764.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
 gb|EES09752.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
Length=1080

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 48/139 (35%), Positives = 71/139 (51%), Gaps = 5/139 (4%)
 Frame = +3

Query  81    GGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGGNETTVIRND  260
             GGD  S R +    Q +             I+FS  ++ G +  +   GG     +IR  
Sbjct  941   GGDRGSTRDIMVAPQSLKSVKICSAAVVDAISFSYLDRYGREHSMPFWGGVG--GMIR--  996

Query  261   TINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGA  440
             TI++    EY+ E+SG +G        V+ S+   TN+ ++GP+G   GTPF+ +    A
Sbjct  997   TIDL-APSEYVKEVSGTYGLCSPHPDVVITSLTLVTNLCSYGPFGQPTGTPFHTRVDKTA  1055

Query  441   KIVGFFGRAGFYVDAIGTY  497
              IVGFFGR+G Y+DAIG Y
Sbjct  1056  SIVGFFGRSGIYLDAIGVY  1074



>emb|CDX82115.1| BnaC02g21750D [Brassica napus]
Length=250

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+TT I+     +   +EYL  +SG +   + +   V+RS+ F +N + +GPYG  
Sbjct  140  GQGGNKTTQIK-----LQYPEEYLIGVSGYYCPVVHSGTPVIRSMTFKSNKQVYGPYGVE  194

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF+F   +G +IVG  GR+ +Y+D+IG
Sbjct  195  QGTPFSFSV-NGGRIVGMNGRSSWYLDSIG  223



>emb|CDP17400.1| unnamed protein product [Coffea canephora]
Length=317

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 4/92 (4%)
 Frame = +3

Query  225  GGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG-PN  401
            GG N   + + + I I    EYLT I+G +G F      V+ S+ F TN +A+GP+G P+
Sbjct  79   GGNNPNNIGKEEKITIQWPSEYLTSITGTYGDF--NGLLVIYSLSFVTNQKAYGPFGSPS  136

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             G  F+    DG  IVGF GR+G+Y+DAIG Y
Sbjct  137  SGQAFS-SPPDGNVIVGFHGRSGWYIDAIGIY  167


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 73/153 (48%), Gaps = 21/153 (14%)
 Frame = +3

Query  57   AYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTN-----KDGSKDCLTI  221
            + GP G   G+ WS+ P + I +II+  G +        +F+  N     K G KD   I
Sbjct  175  SLGPWGGPVGNPWSYIPTDGIKEIIMDVGRNIRAI----SFADANGFISGKFGGKDPNNI  230

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG-P  398
            G         + + I I    EYLT I G FG F      V+ S+ F TN + +GP+G  
Sbjct  231  G---------KEEKITIQWPSEYLTSIKGTFGNFNGDV--VIYSLSFITNNKTYGPFGSA  279

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            N G  F      G  +VGF G +G+++DA+G Y
Sbjct  280  NSGQAFTASPPAGNVVVGFHGMSGWFIDALGIY  312



>ref|NP_001148739.1| LOC100282355 [Zea mays]
 gb|ACG32703.1| agglutinin [Zea mays]
Length=207

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            I +   DEYLT +SG +         V+RS+ F TN  A+GP+G   GTPF F   DG  
Sbjct  78   IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  136

Query  444  IVGFFGRAGFYVDAIGTYNA  503
            IVGF GR+G+ +DA+G Y A
Sbjct  137  IVGFCGRSGWQLDAVGLYVA  156



>ref|XP_004960459.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=149

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            GA E++ EISG +G F      V+RS+ F TNV   GP+G    TPF+   QD A++VGF
Sbjct  75   GAGEFVKEISGTYGPF--GGHTVVRSLTFVTNVGKHGPFGNPGQTPFSVPVQDDARVVGF  132

Query  456  FGRAGFYVDAIGTY  497
            FGR+G  +DA+G Y
Sbjct  133  FGRSGSLLDAVGVY  146



>ref|XP_009622525.1| PREDICTED: agglutinin-like isoform X2 [Nicotiana tomentosiformis]
Length=546

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGR  464
            EYLT I G FGR     + V++ + F TN + +GP+G   GTPF+   ++G  IVGF GR
Sbjct  12   EYLTGIKGTFGRC--GSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  69

Query  465  AGFYVDAIGTYNA*VIISLLSSE  533
             G Y+DAIG Y   +    LS E
Sbjct  70   CGAYLDAIGVYLRKLTPPTLSKE  92


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = +3

Query  252  RNDTINIDGADE-YLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQA  428
            R D + I  +   YLT I G FGR+    + V++S+ F TN + +GP+G   GTPF+   
Sbjct  183  RRDKVVIKASPLVYLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVI  240

Query  429  QDGAKIVGFFGRAGFYVDAIGTY  497
            ++G  I GF G    Y+DAIG Y
Sbjct  241  KEGGAIEGFHGHCRAYLDAIGVY  263


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFG  461
            E+LT I G F  F      V++S+ F TN   +GP+G   G TPF+   ++G  IVGF G
Sbjct  401  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  458

Query  462  RAGFYVDAIGTY  497
            R+G Y+DAIG Y
Sbjct  459  RSGLYLDAIGVY  470



>ref|XP_008348483.1| PREDICTED: agglutinin-like isoform X1 [Malus domestica]
Length=194

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 8/92 (9%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRF--DVLRSVKFTTNVRAFGPYG  395
            G GG +T  I+     +   DEY+  ++G +   +D      ++RS+KF +N R FGP+G
Sbjct  74   GHGGTQTAEIK-----LLYPDEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFG  128

Query  396  PNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             + GTPF +   DG KIVG  GR G Y+DAIG
Sbjct  129  RDQGTPFTY-TLDGGKIVGLKGRDGLYIDAIG  159



>ref|XP_010428208.1| PREDICTED: jacalin-related lectin 19-like isoform X3 [Camelina 
sativa]
Length=177

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T  I+     +   +EYL  +SG +   +++   V+RS+ F +N + +GPYG  
Sbjct  66   GVGGNKTAEIK-----LQYPEEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVE  120

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   +G +IVG  GR+G+Y+D+IG
Sbjct  121  QGTPFTFSV-NGGRIVGMNGRSGWYLDSIG  149



>ref|XP_008654961.1| PREDICTED: LOC100282355 isoform X1 [Zea mays]
Length=238

 Score = 68.6 bits (166),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            I +   DEYLT +SG +         V+RS+ F TN  A+GP+G   GTPF F   DG  
Sbjct  111  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  169

Query  444  IVGFFGRAGFYVDAIGTYNA  503
            IVGF GR+G+ +DA+G Y A
Sbjct  170  IVGFCGRSGWQLDAVGLYVA  189



>ref|XP_009391787.1| PREDICTED: agglutinin-like [Musa acuminata subsp. malaccensis]
Length=256

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 55/94 (59%), Gaps = 8/94 (9%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG  + V+ +D       DEYL  +SG +G  I   + V++S+ F TN R +GP+G  
Sbjct  171  GRGGQLSEVVLDDE-----RDEYLACLSGRYG--ICGGYLVIKSLTFATNKRTYGPFGVE  223

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA  503
             G PF   A  G +IVGFF RAG ++DAIG Y A
Sbjct  224  DGAPFKLDA-GGQRIVGFFARAGQFLDAIGVYTA  256



>ref|XP_002439182.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
 gb|EES17612.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
Length=304

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            I++D A EY+ E+SG +G F      VL S K  TNVR +GP+    GTPF+  A   + 
Sbjct  228  IDLDDA-EYVKEVSGTYGTF--EGITVLTSFKLVTNVRTWGPWAIENGTPFSITAPTNSS  284

Query  444  IVGFFGRAGFYVDAIGTYNA  503
            IVGF+GRAG  +DAIG Y A
Sbjct  285  IVGFYGRAGRLIDAIGVYFA  304



>ref|XP_008348484.1| PREDICTED: agglutinin-like isoform X2 [Malus domestica]
Length=174

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 54/92 (59%), Gaps = 8/92 (9%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRF--DVLRSVKFTTNVRAFGPYG  395
            G GG +T  I+     +   DEY+  ++G +   +D      ++RS+KF +N R FGP+G
Sbjct  54   GHGGTQTAEIK-----LLYPDEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFG  108

Query  396  PNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             + GTPF +   DG KIVG  GR G Y+DAIG
Sbjct  109  RDQGTPFTYTL-DGGKIVGLKGRDGLYIDAIG  139



>ref|XP_008654965.1| PREDICTED: LOC100282355 isoform X4 [Zea mays]
Length=211

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            I +   DEYLT +SG +         V+RS+ F TN  A+GP+G   GTPF F   DG  
Sbjct  84   IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  142

Query  444  IVGFFGRAGFYVDAIGTYNA  503
            IVGF GR+G+ +DA+G Y A
Sbjct  143  IVGFCGRSGWQLDAVGLYVA  162



>gb|KDP38566.1| hypothetical protein JCGZ_04491 [Jatropha curcas]
Length=545

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 1/83 (1%)
 Frame = +3

Query  249  IRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQA  428
            IR + + +D  DEYL  I G +G  +D    ++RS+ F +N R +GP+G  +GT F+F  
Sbjct  70   IRTNKVKLDFPDEYLVTIIGHYGSVVDYGPILVRSLVFESNRRKYGPFGIQMGTDFSFPL  129

Query  429  QDGAKIVGFFGRAGFYVDAIGTY  497
              G K++GF GR  +Y+D+IG Y
Sbjct  130  T-GGKVIGFHGRCSWYLDSIGVY  151


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = +3

Query  249  IRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQ-  425
            +R D I  D   E LT I+G +G  I     V++S+ F TN R +GP+G   G  F+   
Sbjct  264  VRIDKIAFDYPSEILTRITGYYGSTILRGPTVVKSLTFHTNKRKYGPFGDEQGISFSSAG  323

Query  426  AQDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSSEA  536
            + +   IVGF GR G+++D+IG ++  +++S   +EA
Sbjct  324  SNNNEMIVGFHGRKGWFIDSIGVHSRPLVLSNAINEA  360


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = +3

Query  225  GGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGPN  401
            GGG+E +   +  I ++   E LT + G +G    D    V+RS+ F TN   +GP+G  
Sbjct  432  GGGSEAS---SHLIKLEYPYEILTSVCGYYGSLTGDDCNTVIRSLTFYTNKGKYGPFGEE  488

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            VG+ F     +G KIVGF GR+G Y++AIG +
Sbjct  489  VGSFFTSAKTEG-KIVGFHGRSGCYLNAIGVH  519



>ref|XP_008654963.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
 ref|XP_008654964.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
Length=231

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            I +   DEYLT +SG +         V+RS+ F TN  A+GP+G   GTPF F   DG  
Sbjct  104  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  162

Query  444  IVGFFGRAGFYVDAIGTYNA  503
            IVGF GR+G+ +DA+G Y A
Sbjct  163  IVGFCGRSGWQLDAVGLYVA  182



>ref|XP_004980504.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=128

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            IN+ G  E++ E+SG +GRF     +V+ S    TN+ ++GP+G   GTPF+ +      
Sbjct  47   INL-GPSEFVKEVSGTYGRFSHLP-NVITSFTLVTNLCSYGPFGQPSGTPFHTRVDRTGS  104

Query  444  IVGFFGRAGFYVDAIGTY  497
            IVGFFGR+G Y+DAIG Y
Sbjct  105  IVGFFGRSGKYLDAIGVY  122



>ref|XP_008654962.1| PREDICTED: LOC100282355 isoform X2 [Zea mays]
 gb|AFW80927.1| hypothetical protein ZEAMMB73_478294 [Zea mays]
Length=237

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            I +   DEYLT +SG +         V+RS+ F TN  A+GP+G   GTPF F   DG  
Sbjct  110  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  168

Query  444  IVGFFGRAGFYVDAIGTYNA  503
            IVGF GR+G+ +DA+G Y A
Sbjct  169  IVGFCGRSGWQLDAVGLYVA  188



>ref|XP_009400545.1| PREDICTED: agglutinin alpha chain [Musa acuminata subsp. malaccensis]
Length=200

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG+ TT I+     ++  +EYLT ISG +         V+RS+ F +N R FGP+G  
Sbjct  67   GNGGSMTTKIK-----LEHPEEYLTTISGHYCPMAYGGSPVIRSLTFKSNQRTFGPFGVQ  121

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             G PF     +G  IVGF GR G+Y+DAIG
Sbjct  122  DGIPFTL-PMEGGMIVGFSGRCGWYLDAIG  150



>ref|XP_004986922.1| PREDICTED: horcolin-like [Setaria italica]
Length=132

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGR  464
            E+LTE+SG F        D + S+ F TN+R  GP+G   GTPF+   +DG +IV  FGR
Sbjct  55   EFLTEVSGTFAYIGTQPTDAVTSLTFVTNLRKHGPFGDVDGTPFSVPVRDGGRIVALFGR  114

Query  465  AGFYVDAIGTY  497
               Y+DAIG Y
Sbjct  115  GWDYIDAIGVY  125



>ref|XP_009768586.1| PREDICTED: jacalin-related lectin 3-like [Nicotiana sylvestris]
Length=225

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 15/100 (15%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GGGG    V+   T       EYLT I+G FG   D    V++S+ F TN +++GP+G +
Sbjct  109  GGGGRRAKVVFEAT-----PLEYLTGINGTFGH--DGSDLVIKSLCFITNAKSYGPFGSS  161

Query  402  VG--------TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             G        TPF+   ++G  IVGF GR+G Y+DAIG Y
Sbjct  162  YGPFGSMVGGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  201



>ref|XP_010428207.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Camelina 
sativa]
Length=218

 Score = 68.2 bits (165),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T  I+     +   +EYL  +SG +   +++   V+RS+ F +N + +GPYG  
Sbjct  107  GVGGNKTAEIK-----LQYPEEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVE  161

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   +G +IVG  GR+G+Y+D+IG
Sbjct  162  QGTPFTFSV-NGGRIVGMNGRSGWYLDSIG  190



>ref|XP_010428206.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Camelina 
sativa]
Length=224

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 56/90 (62%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T  I+     +   +EYL  +SG +   +++   V+RS+ F +N + +GPYG  
Sbjct  113  GVGGNKTAEIK-----LQYPEEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVE  167

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   +G +IVG  GR+G+Y+D+IG
Sbjct  168  QGTPFTFSV-NGGRIVGMNGRSGWYLDSIG  196



>gb|KDO58671.1| hypothetical protein CISIN_1g037526mg, partial [Citrus sinensis]
Length=200

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 56/98 (57%), Gaps = 7/98 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDT------INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAF  383
            G GGN T  I +        I +   +E+L  +SG +   +     V+RS+ F +N R F
Sbjct  67   GVGGNRTAEICSIPTLLSFPIKLRFPEEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTF  126

Query  384  GPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            GP+G   GTPF F + DG  +VGF GR+G+YVDAIG Y
Sbjct  127  GPFGVEEGTPFTF-SMDGGLVVGFKGRSGWYVDAIGFY  163



>gb|EMT33809.1| hypothetical protein F775_16156 [Aegilops tauschii]
Length=177

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 73/150 (49%), Gaps = 6/150 (4%)
 Frame = +3

Query  48   TDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGG  227
            T V YGP G NGG     R  + +   +        +    +TFS ++  G    +   G
Sbjct  12   TFVTYGPWGGNGGTAHDIRAASSLR--LKSVTIPYGDIIDSLTFSYSDHSGHVHRVGPWG  69

Query  228  GGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            G   T      TIN+D  D ++ EISG FG +  +R +V+ S+K  T+   +GP+G   G
Sbjct  70   G---TGGANKYTINLDPTD-FVKEISGKFGPYPLSRSNVITSLKLVTHEDTYGPFGFVEG  125

Query  408  TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            TPF    + G  IVGFF RA  YV  IG Y
Sbjct  126  TPFCATLESGWAIVGFFARAERYVHKIGVY  155



>ref|XP_010654564.1| PREDICTED: jacalin-related lectin 19-like [Vitis vinifera]
Length=198

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T  ++     +   +E L  +SG +   +     V+RS+ F +N R FGP+G  
Sbjct  68   GVGGNKTAEVK-----LQYPEEILISVSGHYCPVVYGGSPVIRSLTFKSNRRTFGPFGVE  122

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF+  + DG +IVGF GR+G+Y+DAIG
Sbjct  123  EGTPFSL-SMDGGRIVGFQGRSGWYLDAIG  151



>gb|AHW81907.1| mannose-binding lectin [Morus alba var. atropurpurea]
Length=161

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = +3

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRF--IDTRFDVLRSVKFTTNVRAFGPYGPNV  404
            GNE T  +   I +D  +E+L  +SG  G    + T  DV+RS+ F TN + +GPYG   
Sbjct  70   GNEPT-FKTVKITLDFPNEFLVSVSGYTGVLPRLATGKDVIRSLTFKTNKKTYGPYGTEE  128

Query  405  GTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            GTPF+   ++G  IVGF GR+G+ VDAIG
Sbjct  129  GTPFSLPIENGL-IVGFKGRSGYVVDAIG  156



>ref|XP_009398855.1| PREDICTED: protein GOS9-like [Musa acuminata subsp. malaccensis]
Length=143

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 9/94 (10%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GGGG + +       N+D  DE L  I G +GRF      +LRS+ F +N R +GP+G  
Sbjct  59   GGGGGQMS-----EFNLD-DDETLRSIRGHYGRFDGV--SILRSLTFVSNKRTYGPFGRE  110

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA  503
             G  F  +A  G++IVGF GR+G Y+DA+G Y A
Sbjct  111  EGVAFTLEAP-GSRIVGFTGRSGLYLDALGIYVA  143



>ref|XP_010232948.1| PREDICTED: jacalin-related lectin 19-like [Brachypodium distachyon]
Length=266

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/154 (36%), Positives = 75/154 (49%), Gaps = 12/154 (8%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTI  221
            +S+ VA GP G  GG  W    M+      +L     + + I        +DG ++  T 
Sbjct  119  VSSVVAMGPCGGIGGAPWE---MDLHGVGRVLKLVVRHGSAIDAMSVCYERDGREEQSTR  175

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVR-AFGPYGP  398
             GG       R   I +   DEYL  + G  G + +    V+RS+ F TN R +FGPYG 
Sbjct  176  WGGPGG----RRSEICLQ-PDEYLAGVKGHVGHYDNCL--VVRSLTFVTNARRSFGPYGK  228

Query  399  NVGTPFNFQAQ-DGAKIVGFFGRAGFYVDAIGTY  497
              G PF   A   G +I+GFFG +G Y+DAIGTY
Sbjct  229  EEGVPFALPAAVAGGRIIGFFGSSGLYLDAIGTY  262



>emb|CBI35988.3| unnamed protein product [Vitis vinifera]
Length=210

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T  ++     +   +E L  +SG +   +     V+RS+ F +N R FGP+G  
Sbjct  80   GVGGNKTAEVK-----LQYPEEILISVSGHYCPVVYGGSPVIRSLTFKSNRRTFGPFGVE  134

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF+  + DG +IVGF GR+G+Y+DAIG
Sbjct  135  EGTPFSL-SMDGGRIVGFQGRSGWYLDAIG  163



>ref|XP_010932961.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Elaeis 
guineensis]
Length=292

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 78/153 (51%), Gaps = 15/153 (10%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTI  221
            I + VA GP G +GG  WSF     I +I I  G   ++     TF   + + ++     
Sbjct  148  IQSPVAVGPWGGSGGTAWSFETAWTITKIKISVGDVVDSI----TFQYMDGETTRWSSRY  203

Query  222  GGGGNETTVIRNDTINID-GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGP  398
            GG G + T        ID G +  L  ISG +G +      V++S+ F T    +GPYGP
Sbjct  204  GGAGGKPT-------EIDLGTNNNLEAISGHYGNYYGK--TVIKSLTFVTTTGTYGPYGP  254

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              GT F+   + G K+VGFFGRAG ++DA+G Y
Sbjct  255  EEGTTFSLPVKAG-KVVGFFGRAGQWLDALGFY  286


 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 75/155 (48%), Gaps = 13/155 (8%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGGNET  242
            GP G +GG  WSF     I +I I  G   ++     TF   +   ++     GG G + 
Sbjct  12   GPWGGSGGSAWSFENALAITKIKISVGDVIDSL----TFQYMDGTTARWSPRYGGTGGQP  67

Query  243  TVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNF  422
            T I        G  E++  I G +G ++  R  ++ S+ F T +R +GPYG   GT F F
Sbjct  68   TEIEL------GPAEFIISIKGYYGPYV--RKTMIYSLTFVTTIREYGPYGQEKGTQF-F  118

Query  423  QAQDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLS  527
              +    I GFFGR+G  +DAIG Y   +I S ++
Sbjct  119  VPKGTGLISGFFGRSGDQLDAIGVYIKTLIQSPVA  153



>ref|XP_010932865.1| PREDICTED: jacalin-related lectin 3-like isoform X2 [Elaeis guineensis]
Length=223

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +3

Query  246  VIRNDTINID-GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNF  422
            V +  +  ID G + YLT ISG +G + D    V+ S+ F T +  +GPYGPN GT F+ 
Sbjct  133  VYKKTSFEIDLGNNHYLTAISGYYGNYHDCI--VITSLTFVTTMSTYGPYGPNEGTAFSL  190

Query  423  QAQDGAKIVGFFGRAGFYVDAIGTY  497
              + G KIVGFFG AG ++DA+G Y
Sbjct  191  PMRAG-KIVGFFGYAGQWLDALGFY  214


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 67/146 (46%), Gaps = 13/146 (9%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGGNET  242
            GP G +GG  WSF     I +I I  GG  ++     TF   + + ++     GG G E 
Sbjct  3    GPWGGSGGTAWSFENAQTITKIKISVGGVVDSI----TFQYMDGETARWSPRYGGEGGEP  58

Query  243  TVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNF  422
            T I  +        E++  I G +  + +    ++ S+ F T +R +GPYG   GT F+ 
Sbjct  59   TEIELE------PAEFIISIKGYYSTYAE--MIIIYSLTFVTTIREYGPYGQEQGTQFSV  110

Query  423  QAQDGAKIVGFFGRAGFYVDAIGTYN  500
                G  I GF G +   +DAIG Y 
Sbjct  111  PKGTGW-ISGFHGCSDTLLDAIGVYK  135



>emb|CAE76026.1| B1292H11.12 [Oryza sativa Japonica Group]
 gb|EAZ29534.1| hypothetical protein OsJ_13607 [Oryza sativa Japonica Group]
Length=183

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = +3

Query  279  ADEYLTEISGAFGRFIDTRFDVLRSVKFTTNV-RAFGPYG----PNVGTPFNFQAQDGAK  443
            ADE +T + G  GRF D    V+ S+ F TN  + +GPYG       GTPF+    +G  
Sbjct  102  ADEQVTSVEGTIGRFRDVDEPVITSLTFRTNAGKTYGPYGGASDKQAGTPFSIPVDNGGV  161

Query  444  IVGFFGRAGFYVDAIGTY  497
            +VGF+GRAG+ +DAIG Y
Sbjct  162  VVGFWGRAGWLIDAIGVY  179



>gb|EAY80990.1| hypothetical protein OsI_36172 [Oryza sativa Indica Group]
Length=1081

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 10/109 (9%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGG-GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRF-DVLR  350
             FS  +K+G +    + GG G    +I  D        E +TE+SG  G F  ++F  V+ 
Sbjct  978   FSYLDKNGKQHTTPLWGGVGGSVRMIHLD------PSEIVTEVSGTCGPF--SQFPSVVT  1029

Query  351   SVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             S++  TN+R++GP+G   GT F  + +    IVGFFGR+  Y+DAIG Y
Sbjct  1030  SLQLVTNLRSYGPFGQAKGTKFRTRVKQNGSIVGFFGRSTIYLDAIGVY  1078



>ref|XP_008677993.1| PREDICTED: mannose/glucose-specific lectin-like isoform X5 [Zea 
mays]
Length=703

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 39/94 (41%), Positives = 57/94 (61%), Gaps = 7/94 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GG G +     N +  + G+ E+LT +SG+ G F +   +V+ S+ F TN R++GP+G  
Sbjct  445  GGHGGD-----NSSFQLAGS-EFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRG  497

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA  503
             GT F+   Q    IVGFFGR+G Y++AIG Y A
Sbjct  498  RGTSFHIPVQGNGCIVGFFGRSGRYLNAIGVYTA  531



>gb|KHN46147.1| Agglutinin [Glycine soja]
Length=597

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (61%), Gaps = 6/92 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG +T     D + +D  +E+LT+I G +G       + +RS+ F +N + +GP+G  
Sbjct  64   GSGGRKT-----DKVKLDCPNEFLTKIHGYYGSSNQRGPNFVRSLSFESNKKTYGPFGVE  118

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +GT F+     GAKIVGF GR G+YVDAIG Y
Sbjct  119  LGTYFSVPL-TGAKIVGFHGRCGWYVDAIGVY  149


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            +ND I  D   E LT ISG +G  +     V+RS+ F T  R +GPYG   GT F  + +
Sbjct  300  KNDKIVFDFPYEALTHISGYYGPLMYMGPSVIRSLTFHTTKRKYGPYGEEQGTYFTTKVK  359

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVG  GR G ++DA G +
Sbjct  360  EG-KIVGIHGRKGLFLDAFGVH  380


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 6/93 (6%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGP  398
            GG G +T       I ++  +E LT ISG +G    D +  +++S+ F T+   +GP+G 
Sbjct  491  GGSGGDTM----HRIQLEYPNEVLTCISGYYGPIAKDEQHIIMKSLTFNTSRGKYGPFGE  546

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             VG  F     +G K+VGF GR+  Y+DAIG +
Sbjct  547  EVGKFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  578



>pdb|1XXQ|A Chain A, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXQ|B Chain B, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXQ|C Chain C, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXQ|D Chain D, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXR|A Chain A, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
 pdb|1XXR|B Chain B, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
 pdb|1XXR|C Chain C, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
 pdb|1XXR|D Chain D, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
Length=161

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = +3

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRF--IDTRFDVLRSVKFTTNVRAFGPYGPNV  404
            GNE +  +   I +D  +E+L  +SG  G    + T  DV+RS+ F TN + +GPYG   
Sbjct  70   GNEPS-FKTVKITLDFPNEFLVSVSGYTGVLARLATGKDVIRSLTFKTNKKTYGPYGKEE  128

Query  405  GTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            GTPF+   ++G  IVGF GR+GF VDAIG
Sbjct  129  GTPFSLPIENGL-IVGFKGRSGFVVDAIG  156



>ref|XP_011081586.1| PREDICTED: jacalin-related lectin 19-like [Sesamum indicum]
Length=308

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query  246  VIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQ  425
            VIR   + +   DEYLTE+SG           ++RS+KF +N R +GP+G    TPF F 
Sbjct  19   VIRLQ-VKLQFPDEYLTEVSGHCSPLGRRGNAMVRSLKFRSNWRTYGPFGVESETPFCF-  76

Query  426  AQDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSSE  533
              +G  IVGF GR G YVDAIG +    I ++++ E
Sbjct  77   PMEGGMIVGFRGRCGLYVDAIGFHITQTICTIMAKE  112


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 75/150 (50%), Gaps = 9/150 (6%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGG  233
            +  GP G NGG  W     + + +I ++     ++  +    +     G K     GG G
Sbjct  157  IVVGPWGGNGGTAWDDGSYSGVREITLVYARCIDSIRVVYDKNGVPVSGEKH----GGVG  212

Query  234  NETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTP  413
              TT      I +   +E+LT ++G     +     V+RS+ F +N R FGP+G   G P
Sbjct  213  GNTTA----QIKLKFPEEFLTTVTGHCSPVVCGGSPVIRSLTFKSNRRTFGPFGVEEGVP  268

Query  414  FNFQAQDGAKIVGFFGRAGFYVDAIGTYNA  503
            F+F   +G +IVGF GRAG+Y+DAIG + A
Sbjct  269  FSF-PMEGGQIVGFKGRAGWYLDAIGFHIA  297



>ref|XP_009588771.1| PREDICTED: agglutinin-like [Nicotiana tomentosiformis]
Length=345

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 76/147 (52%), Gaps = 13/147 (9%)
 Frame = +3

Query  66   PLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGS-KDCLTIGGGGNET  242
            P G  GG  W+++  + I +I+I  G   ++      F +  K+ +  D    GG G   
Sbjct  17   PWGGKGGSEWNYKLKSPIKEIVIAHGSIIDSI----MFRTVTKESTIVDSPKFGGNGGG-  71

Query  243  TVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPF  416
               R D +NI+    EYLT I G  G        V++S+ F TN + +GP+G   G TPF
Sbjct  72   ---RRDKVNIEATPLEYLTGIKGTLGHH--GSHLVVKSLSFITNAKNYGPFGTEGGGTPF  126

Query  417  NFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +   ++G  IVGF GR+G Y+DAIG Y
Sbjct  127  SLVMKEGGAIVGFHGRSGLYLDAIGVY  153


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 6/92 (7%)
 Frame = +3

Query  225  GGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTR-FDVLRSVKFTTNVRAFGPYGPN  401
            G GN+T  IR   I+IDG  E L  I G +    D    D +R + F TN   +GPYG  
Sbjct  255  GAGNDT--IRK--IHIDGESEILVGIEGFYSPVDDNGGLDTIRQIAFYTNKGKYGPYGTE  310

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +GT F+  A  G KIVGF G++G +++AIG +
Sbjct  311  IGTYFSSSAARG-KIVGFHGKSGVFLNAIGVH  341



>gb|ACG29554.1| hypothetical protein [Zea mays]
 gb|ACG44268.1| hypothetical protein [Zea mays]
Length=151

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            DE LTEISG  G   +   ++++S+KF TN R +GPYG + GTPF  +  +   + GFFG
Sbjct  77   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRTYGPYGRDEGTPFRVKVMNNGHVAGFFG  135

Query  462  RAGFYVDAIGTY  497
            R+G  +DAIG Y
Sbjct  136  RSGDCLDAIGLY  147



>ref|XP_009768640.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1339

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 59/110 (54%), Gaps = 10/110 (9%)
 Frame = +3

Query  177  FSSTNKDGSK-DCLTIGGGGNETTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLR  350
            F +  + G+  D    GG G      R D + I+    EYLT I G FG  +     V++
Sbjct  53   FRTVTEQGTTIDSPKFGGDGG-----RRDKVVIEATLLEYLTGIKGTFG--LCGSHSVIK  105

Query  351  SVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+ F TN + +GP+G   G TPF+   ++G  IVGF GR G Y+DAIG Y
Sbjct  106  SLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHGRCGAYLDAIGVY  155



>ref|XP_009768636.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768638.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768639.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1355

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 59/110 (54%), Gaps = 10/110 (9%)
 Frame = +3

Query  177  FSSTNKDGSK-DCLTIGGGGNETTVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLR  350
            F +  + G+  D    GG G      R D + I+    EYLT I G FG  +     V++
Sbjct  69   FRTVTEQGTTIDSPKFGGDGG-----RRDKVVIEATLLEYLTGIKGTFG--LCGSHSVIK  121

Query  351  SVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+ F TN + +GP+G   G TPF+   ++G  IVGF GR G Y+DAIG Y
Sbjct  122  SLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHGRCGAYLDAIGVY  171



>ref|XP_004979669.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Setaria 
italica]
Length=844

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN      N+T  + G  E+LT +SG+ G F +T  +V+ S+ F TNVR +GP+G  
Sbjct  602  GHGGN------NNTFKL-GPSEFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKG  653

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             G  F+   +    IVGFFGRAG Y+DAIG Y
Sbjct  654  RGPHFHIPMESNGCIVGFFGRAGRYLDAIGVY  685


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G  E+L  +SG+ G F   +  V+ S+ F TN R++GP+G   G PF+ Q Q    IVGF
Sbjct  399  GPSEFLIGVSGSIGSFNGLK-KVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGF  457

Query  456  FGRAGFYVDAIGTY  497
            FG +  Y++AIG Y
Sbjct  458  FGHSRRYLEAIGFY  471


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNV-RAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            E++ ++SG F  +   + +VL S+   TN  R++GPYG   GT F+   Q  ++IVGFF 
Sbjct  770  EFIVKVSGTFCAWHGVK-NVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFA  828

Query  462  RAGFYVDAIGTY  497
                Y++AIG Y
Sbjct  829  HGEDYIEAIGAY  840



>gb|ABA94728.1| Jacalin-like lectin domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ12138.1| hypothetical protein OsJ_02021 [Oryza sativa Japonica Group]
Length=837

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G+ E+L  + G  G F  +R  V+ SV F TNVR++GP+G   GTPF+   Q   KIVGF
Sbjct  761  GSSEFLVRVFGTIGPFRASRC-VVTSVTFVTNVRSYGPFGQGGGTPFDVPMQSNGKIVGF  819

Query  456  FGRAGFYVDAIGTY  497
            FG A  YV+A+G Y
Sbjct  820  FGHARSYVEALGVY  833


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G  E+L E+SG  GRF ++R +V+ S+   TN   +G +G   G PF    Q    IVGF
Sbjct  441  GPSEFLLEVSGTIGRFANSRSNVITSLTLVTNEDRYGHFGTERGDPFCTTLQTNCSIVGF  500

Query  456  FGRAGFYVDAIGTY  497
            F RA  Y+ AIG Y
Sbjct  501  FARASRYMHAIGVY  514



>ref|XP_004979670.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Setaria 
italica]
Length=823

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN      N+T  + G  E+LT +SG+ G F +T  +V+ S+ F TNVR +GP+G  
Sbjct  581  GHGGN------NNTFKL-GPSEFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKG  632

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             G  F+   +    IVGFFGRAG Y+DAIG Y
Sbjct  633  RGPHFHIPMESNGCIVGFFGRAGRYLDAIGVY  664


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G  E+L  +SG+ G F   +  V+ S+ F TN R++GP+G   G PF+ Q Q    IVGF
Sbjct  399  GPSEFLIGVSGSIGSFNGLK-KVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGF  457

Query  456  FGRAGFYVDAIGTY  497
            FG +  Y++AIG Y
Sbjct  458  FGHSRRYLEAIGFY  471


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNV-RAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            E++ ++SG F  +   + +VL S+   TN  R++GPYG   GT F+   Q  ++IVGFF 
Sbjct  749  EFIVKVSGTFCAWHGVK-NVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFA  807

Query  462  RAGFYVDAIGTY  497
                Y++AIG Y
Sbjct  808  HGEDYIEAIGAY  819



>ref|XP_008804539.1| PREDICTED: mannose/glucose-specific lectin-like [Phoenix dactylifera]
Length=149

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 78/148 (53%), Gaps = 13/148 (9%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGG  233
            +A GP G +GG  WSF+    I +I I SG   ++     TF   + +  +   T GG G
Sbjct  9    IALGPWGGSGGTAWSFQNARAITKIKISSGDVVDSI----TFQYIDGELVRWSPTYGGTG  64

Query  234  NETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTP  413
             ++T I        G D YLT ISG +G + D    V++S+ F +    +GP+G   GT 
Sbjct  65   GKSTEIDL------GTDSYLTAISGHYGNYDDIV--VIKSLTFVSTKGTYGPFGTKEGTA  116

Query  414  FNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            F+    +G   VGFFGRAG ++DA+G Y
Sbjct  117  FSVPV-NGGNFVGFFGRAGEWLDALGFY  143



>ref|XP_004979671.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Setaria 
italica]
Length=793

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN      N+T  + G  E+LT +SG+ G F +T  +V+ S+ F TNVR +GP+G  
Sbjct  551  GHGGN------NNTFKL-GPSEFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKG  602

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             G  F+   +    IVGFFGRAG Y+DAIG Y
Sbjct  603  RGPHFHIPMESNGCIVGFFGRAGRYLDAIGVY  634


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G  E+L  +SG+ G F   +  V+ S+ F TN R++GP+G   G PF+ Q Q    IVGF
Sbjct  348  GPSEFLIGVSGSIGSFNGLK-KVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGF  406

Query  456  FGRAGFYVDAIGTY  497
            FG +  Y++AIG Y
Sbjct  407  FGHSRRYLEAIGFY  420


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNV-RAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            E++ ++SG F  +   + +VL S+   TN  R++GPYG   GT F+   Q  ++IVGFF 
Sbjct  719  EFIVKVSGTFCAWHGVK-NVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFA  777

Query  462  RAGFYVDAIGTY  497
                Y++AIG Y
Sbjct  778  HGEDYIEAIGAY  789



>ref|XP_006372325.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
 gb|ERP50122.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
Length=446

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 71/150 (47%), Gaps = 10/150 (7%)
 Frame = +3

Query  51   DVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGG  230
            DV  GP G  GGD W +R  + I             N   I+F  T    S    T GG 
Sbjct  7    DVKLGPWGGLGGDRWCYRASDGI----TGIVLRVEGNIKSISFKDTRGLVSG---TFGGT  59

Query  231  GNETT-VIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            GN+         I I    EYL  ISG +GR+      V+ S+ FTTN+   GP+G   G
Sbjct  60   GNDPNDRGEEKKIAIQWPTEYLKSISGTYGRYKGV-LAVITSLSFTTNLTTHGPFGTAPG  118

Query  408  TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             PF+    DG  +VGF GR G+Y+DA+G +
Sbjct  119  EPFSIPIADGV-VVGFHGRCGYYLDALGVF  147


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 77/152 (51%), Gaps = 11/152 (7%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTI  221
            I   ++ GP G  GG  WS+     I+QI+I  G +  +     +F  T      D  T 
Sbjct  299  IEGTISIGPWGGRGGSPWSYMTNRGINQIVIHVGSNIKSI----SFRDTT---GLDSATF  351

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GG  N   +    T+ I+   E+L  ISG +G+F  +    + S+ FTTN   +GP+G  
Sbjct  352  GGE-NPNDIGERKTVLINWPSEHLISISGTYGKF--STLLTITSLSFTTNRATYGPFGTG  408

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF+    +   +VGF GRAG Y+DAIG +
Sbjct  409  SGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  439


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 76/149 (51%), Gaps = 11/149 (7%)
 Frame = +3

Query  51   DVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGG  230
             ++ G  G  GGD +SFR  + I +II+  G +          S + KDG+       GG
Sbjct  156  SISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTNIK--------SLSFKDGNGQEYGKFGG  207

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGT  410
             N         I IDG  E+LT I+G +G +      V+ S+ F TN+  +GP+G   GT
Sbjct  208  KNANDTGEERRIEIDGLSEHLTSITGTYGDYAG--MVVITSLAFQTNLTTYGPFGNATGT  265

Query  411  PFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             F+   + G+ ++GF GR G Y+DAIG +
Sbjct  266  SFSIPIE-GSVVIGFHGRGGHYLDAIGIH  293



>gb|AGT16237.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
 gb|AGT16239.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
Length=461

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 56/108 (52%), Gaps = 7/108 (6%)
 Frame = +3

Query  177  FSSTNKDGSKDCL-TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
            FS   +DG K  +   GG G  + +I        G  E+L    G  G F ++  DV+ S
Sbjct  326  FSYHGQDGQKHTVGPWGGTGGSSCLIEL------GPSEFLMGAYGTRGPFTNSPADVVTS  379

Query  354  VKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +   TN R++GP+G   G PF    Q  + IVGFFG AG Y+DAIG Y
Sbjct  380  LTLVTNARSYGPFGHGGGRPFQVPMQGNSSIVGFFGCAGSYIDAIGVY  427



>gb|EMS65594.1| hypothetical protein TRIUR3_06346 [Triticum urartu]
Length=314

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 5/108 (5%)
 Frame = +3

Query  177  FSSTNKDGSKDCLT-IGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
            FS  ++DG +   T +G GG + +    +TIN+    EY+ E+SG++  + D    VL S
Sbjct  206  FSYIDQDGVRRTETRLGEGGGDGS---TNTINL-APKEYVKELSGSYTMWADFSQIVLTS  261

Query  354  VKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +K  TN   +GP+G   GTPF     + + +VGF GRA  +V+AIG Y
Sbjct  262  LKLVTNFNTYGPFGKGAGTPFKADIPENSIVVGFHGRAARFVNAIGVY  309



>ref|XP_010088386.1| hypothetical protein L484_008121 [Morus notabilis]
 gb|EXB34860.1| hypothetical protein L484_008121 [Morus notabilis]
Length=193

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 74/149 (50%), Gaps = 9/149 (6%)
 Frame = +3

Query  45   STDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIG  224
            S  +A GP G NGG+ W     + + +I +      ++  +       +K+G        
Sbjct  13   SKGIAVGPWGGNGGNSWDDGAYSGVREITLFYDRCIDSIRVVY-----DKNGKPVAAEKH  67

Query  225  GGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNV  404
            GG   +   R   I ++  +EYL  +SG +   +     V+RS+   +N R FGPYG   
Sbjct  68   GGIGGS---RTAEIKLNYPEEYLVSVSGYYCPVVHGGSPVIRSLTLKSNKRTFGPYGVEE  124

Query  405  GTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            GTPF+F  Q G  IVGF GR G+Y+DAIG
Sbjct  125  GTPFSFPIQGGL-IVGFKGRNGWYLDAIG  152



>ref|XP_003597652.1| Agglutinin alpha chain [Medicago truncatula]
Length=761

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 51/147 (35%), Positives = 71/147 (48%), Gaps = 11/147 (7%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGG-G  230
            V  GP G NGG  W       I +  I        + I + +    K  + D    GG G
Sbjct  590  VIVGPWGGNGGTSWDDGTFTGIRE--ITLVYDRCIDSIRVVYDKNGKPFTAD--KHGGVG  645

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGT  410
            GN+T  I+     +   +EYL  +SG +   +     V+RS+ F +N R FGPYG   GT
Sbjct  646  GNKTAEIK-----LQYPNEYLISVSGHYYPVVRGGTPVIRSLTFKSNQRTFGPYGVEEGT  700

Query  411  PFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            PF F   DG ++VGF GR  +Y+D+I 
Sbjct  701  PFTFSI-DGGQVVGFKGRGDWYLDSIA  726



>ref|XP_009338132.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338133.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
Length=764

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 52/90 (58%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG +T  I+     ++  DEYL  ++G +         ++RS+KF +N R FGP+G  
Sbjct  649  GRGGTQTAEIK-----LEYPDEYLVSVTGNYCLLAYGGTAIIRSLKFQSNRRTFGPFGIQ  703

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GT F +  + G KIVG  GR G+Y+DAIG
Sbjct  704  EGTTFTYNVE-GGKIVGLKGRNGWYIDAIG  732



>gb|AFW60405.1| putative protein kinase superfamily protein [Zea mays]
Length=634

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G  E+LT +SG  G F +   +V+ S+ F TN R++GP+G   GTPF+ Q Q+  +IVGF
Sbjct  223  GPSEFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGF  281

Query  456  FGRAGFYVDAIG  491
            FGR+G Y+ AIG
Sbjct  282  FGRSGQYLYAIG  293


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            N +  + G+ E+LT +SG+ G F +   +V+ S+ F TN R++GP+G   GT F+   Q 
Sbjct  382  NSSFQLAGS-EFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQG  439

Query  435  GAKIVGFFGRAGFYVDAIGTYNA  503
               IVGFFGR+G Y++AIG Y A
Sbjct  440  NGCIVGFFGRSGRYLNAIGVYTA  462



>gb|KHG26998.1| Agglutinin [Gossypium arboreum]
Length=600

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 8/97 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG++T     D + +D  DE+LT I G +G        ++RS+ F +N +A+GP+G  
Sbjct  63   GNGGSKT-----DKVKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPFGIE  117

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA*VI  512
             GT F+    +  KIVGF GR+G+Y+DAIG Y+  V+
Sbjct  118  QGTSFSM---NKGKIVGFRGRSGWYLDAIGVYSKPVL  151


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            + + I  D   E LT I+G F   +    +V+RS+ F TN    GPYG   G  F  +  
Sbjct  303  KTERIMFDYPSEILTHITGTFAPLMYMGPNVIRSLTFYTNKGKHGPYGDEQGPSFTNKMN  362

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVGF GR G ++DA+G +
Sbjct  363  EG-KIVGFLGREGLFLDAVGVH  383


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDT-RFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGA  440
            + +D   E L  ISG +G   D  +F V+RS+ F T+   +GP+G  VGT F      G 
Sbjct  503  VKLDYPHEVLICISGYYGSINDEEKFKVIRSLTFYTSRGKYGPFGEEVGTYFTSTTTQG-  561

Query  441  KIVGFFGRAGFYVDAIGTY  497
            K+VGF GR   Y+DAIG +
Sbjct  562  KVVGFHGRCSSYLDAIGVH  580



>ref|XP_002461768.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
 gb|EER98289.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
Length=361

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 52/92 (57%), Gaps = 9/92 (10%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN  T+   ++       E +TE+SG  G F D    V+ S+KF TN++ +GP+G  
Sbjct  219  GSGGNPETIQLAES-------EVVTEVSGTVGNFYDN--TVITSIKFVTNLQTYGPWGDG  269

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
               PF    Q G+ IVGFF RAG  +DAIG Y
Sbjct  270  QDAPFTIPVQPGSGIVGFFARAGDCLDAIGVY  301



>gb|ADV38315.1| mannose/glucose-specific lectin [Litchi chinensis]
Length=155

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 69/149 (46%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   STDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIG  224
            S  +  GP G NGG  WS+ P   +  I  +         I I F STN        +  
Sbjct  3    SNSIKLGPWGGNGGSSWSYNPSGSV--ITGVFVRFSAGRLISIYFKSTNVSSGTSTYSDK  60

Query  225  GGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNV  404
             GG ++       + +D  +EY T ISG          + ++S+ F T      P G   
Sbjct  61   FGGYDSNTADYTEVLVDWPEEYFTSISGT--AVTSNGLETVQSLTFHTTKGTRSPNGNTN  118

Query  405  GTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            GTPF+    +GA+IVGFFGRAG YVDAIG
Sbjct  119  GTPFSI-PMEGAQIVGFFGRAGEYVDAIG  146



>ref|XP_008778289.1| PREDICTED: mannose/glucose-specific lectin-like [Phoenix dactylifera]
Length=302

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 7/86 (8%)
 Frame = +3

Query  258  DTINID-GADEYLTEISGAFGRFIDTR-----FDVLRSVKFTTNVRAFGPYGPNVGTPFN  419
             T  ID G + YLT ISG +G F   R     + V+RS+ F + +   GPYGP  GT F+
Sbjct  212  STAEIDLGTNHYLTAISGYYGIFHGNRGNYYGYTVIRSLTFVSTMGTHGPYGPKAGTAFS  271

Query  420  FQAQDGAKIVGFFGRAGFYVDAIGTY  497
            F  + G K+V FFGRAG ++DA+G Y
Sbjct  272  FPVKVG-KVVAFFGRAGQWLDALGFY  296


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 64/145 (44%), Gaps = 13/145 (9%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGGNET  242
            GP G +GG  WSF     I +I I  G   N+     TF   + + ++     GG G   
Sbjct  12   GPWGGSGGTAWSFEKAQAITKIKICVGDVINSI----TFQYMDGETARWSPRYGGAGGTP  67

Query  243  TVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNF  422
              I        G  E++  I G +G +      ++ S+ F T VR +GPYG   GT F  
Sbjct  68   VEIE------LGPAEFILSIKGYYGAYAG--MTIIYSLTFVTTVREYGPYGREHGTQFYV  119

Query  423  QAQDGAKIVGFFGRAGFYVDAIGTY  497
                G  I  F GR+G  +DAIG Y
Sbjct  120  PKGTGW-INSFHGRSGDLLDAIGVY  143



>ref|XP_002510454.1| hypothetical protein RCOM_1595950 [Ricinus communis]
 gb|EEF52641.1| hypothetical protein RCOM_1595950 [Ricinus communis]
Length=540

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +3

Query  240  TTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVL-RSVKFTTNVRAFGPYGPNVGTPF  416
            T  I+ + +  D  DEYL  +SG +G  ++    VL RS+ F TN R +GP+G   GT F
Sbjct  69   TGCIKINKVKFDYPDEYLVSVSGHYGSVVEYYGPVLVRSLMFQTNRRKYGPFGIQQGTQF  128

Query  417  NFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +F    G ++VGF GR+ +Y+D+IG Y
Sbjct  129  SFPLT-GGQVVGFHGRSSWYLDSIGVY  154


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = +3

Query  249  IRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQA  428
            IR D I  D   E LT ++G +G  I     V++S+ F TN R +GP+G   G  F+   
Sbjct  265  IRLDKIAFDYPSEILTHVTGYYGSTILRGPTVVKSLTFHTNKRKYGPFGDEQGISFSSGP  324

Query  429  QDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSS  530
             +G  +VGF GR G+++D+IG + A   I L +S
Sbjct  325  NNGI-VVGFHGRKGWFIDSIGVHVAEKPIPLNTS  357


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = +3

Query  225  GGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGPN  401
            GGG+E +   +  I ++   E LT I G +G F  +    V++S+ F TN   +GP+G  
Sbjct  430  GGGSEGS---SHLIKLEYPHETLTSICGYYGSFTGEDSNSVIKSLTFYTNKGKYGPFGEE  486

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            VGT F     +G KIVGF GR+G Y++AIG +
Sbjct  487  VGTFFTSSNTEG-KIVGFHGRSGCYLNAIGVH  517



>ref|NP_001148448.1| jasmonate-induced protein [Zea mays]
 gb|ACG31498.1| jasmonate-induced protein [Zea mays]
Length=184

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 53/95 (56%), Gaps = 10/95 (11%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGP-  398
            GG G ET       I + G  E LTE+SG  G  I     V+ S+KF T+++ +GP+G  
Sbjct  93   GGSGGET----EPVIQL-GDSEVLTELSGTIG--IVDGHTVITSIKFVTSLKTYGPFGAW  145

Query  399  --NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
                 TPF    Q G+ IVGFF RAG Y+DA+G Y
Sbjct  146  GDGSDTPFAIPVQQGSAIVGFFARAGVYLDALGVY  180



>gb|AEQ30064.1| mannose/glucose-specific lectin [Litchi chinensis]
 gb|AEQ30065.1| mannose/glucose-specific lectin [Litchi chinensis]
Length=155

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 68/149 (46%), Gaps = 5/149 (3%)
 Frame = +3

Query  45   STDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIG  224
            S  +  GP G N G  WS+ P   +  I  +         I I F STN        +  
Sbjct  3    SNSIKLGPWGGNAGSAWSYNPSGSV--ITGVFVRFSAGRLISIYFKSTNVSSGTSTYSDK  60

Query  225  GGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNV  404
             GG ++       + +D  +EY T ISG          D ++S+ F T      P G   
Sbjct  61   FGGYDSNTADYTEVLVDWPEEYFTSISGT--AVTSNGLDTVQSLTFHTTKGTRAPNGNTN  118

Query  405  GTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            GTPF+    +GA+IVGFFGRAG YVDAIG
Sbjct  119  GTPFSIP-MEGAQIVGFFGRAGEYVDAIG  146



>ref|XP_009608039.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=1307

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFG  461
            EYLT I G FGR       V++S+ F TN + +GP+G   G TPF+   ++G  IVGF G
Sbjct  54   EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  111

Query  462  RAGFYVDAIGTY  497
            R G Y+DAIG Y
Sbjct  112  RCGAYLDAIGVY  123



>ref|XP_009608038.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1338

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFG  461
            EYLT I G FGR       V++S+ F TN + +GP+G   G TPF+   ++G  IVGF G
Sbjct  85   EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  142

Query  462  RAGFYVDAIGTY  497
            R G Y+DAIG Y
Sbjct  143  RCGAYLDAIGVY  154



>ref|XP_009608035.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608036.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608037.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1354

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFG  461
            EYLT I G FGR       V++S+ F TN + +GP+G   G TPF+   ++G  IVGF G
Sbjct  101  EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  158

Query  462  RAGFYVDAIGTY  497
            R G Y+DAIG Y
Sbjct  159  RCGAYLDAIGVY  170



>gb|AGT16242.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
Length=561

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 56/108 (52%), Gaps = 7/108 (6%)
 Frame = +3

Query  177  FSSTNKDGSKDCL-TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
            FS   +DG K  +   GG G  + +I        G  E+L    G  G F ++  DV+ S
Sbjct  426  FSYHGQDGQKHTVGPWGGTGGSSCLIEL------GPSEFLMGAYGTRGPFTNSPADVVTS  479

Query  354  VKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +   TN R++GP+G   G PF    Q  + IVGFFG AG Y+DAIG Y
Sbjct  480  LTLVTNARSYGPFGHGGGRPFQVPMQGNSSIVGFFGCAGSYIDAIGVY  527



>ref|XP_010533565.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Tarenaya hassleriana]
Length=601

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 60/115 (52%), Gaps = 11/115 (10%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN     + D + ++  DEYLT + G +G F       +RS+ F +N R +GP+G  
Sbjct  67   GKGGN-----KFDKVKLEYPDEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSE  121

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSSEA*CSIGTPLCF  566
             GT F+    + AKIVGF G+ G+Y+DAIG +     I  L  E    I  P  +
Sbjct  122  SGTYFSLPKSE-AKIVGFHGKTGWYLDAIGVH-----IQPLHKENSSKIALPAQY  170


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            ++D +  D   E LT I+G +G  +    +V+RS+ F TN    GPYG   G  F  +  
Sbjct  302  KHDKVVFDFPSEVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIG  361

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVGF GR G ++DAIG +
Sbjct  362  EG-KIVGFLGREGLFLDAIGVH  382


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  KDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDT-RFDVLRSVKFTTNVRA  380
            +   ++  GGN    +    I ++   E LT +SG +G   ++    V++SV F T+   
Sbjct  485  QSVWSVKHGGNNNGGVATHRIKLECPHEVLTCLSGYYGPVSNSDTTKVVKSVSFYTSRGK  544

Query  381  FGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +GPYG   GT +     +G K+VGF GR+  Y+DAIG +
Sbjct  545  YGPYGEENGTYYTSTKTEG-KVVGFHGRSSSYLDAIGVH  582



>ref|XP_010533571.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Tarenaya hassleriana]
Length=598

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 60/115 (52%), Gaps = 11/115 (10%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN     + D + ++  DEYLT + G +G F       +RS+ F +N R +GP+G  
Sbjct  64   GKGGN-----KFDKVKLEYPDEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSE  118

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA*VIISLLSSEA*CSIGTPLCF  566
             GT F+    + AKIVGF G+ G+Y+DAIG +     I  L  E    I  P  +
Sbjct  119  SGTYFSLPKSE-AKIVGFHGKTGWYLDAIGVH-----IQPLHKENSSKIALPAQY  167


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            ++D +  D   E LT I+G +G  +    +V+RS+ F TN    GPYG   G  F  +  
Sbjct  299  KHDKVVFDFPSEVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIG  358

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVGF GR G ++DAIG +
Sbjct  359  EG-KIVGFLGREGLFLDAIGVH  379


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  204  KDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDT-RFDVLRSVKFTTNVRA  380
            +   ++  GGN    +    I ++   E LT +SG +G   ++    V++SV F T+   
Sbjct  482  QSVWSVKHGGNNNGGVATHRIKLECPHEVLTCLSGYYGPVSNSDTTKVVKSVSFYTSRGK  541

Query  381  FGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +GPYG   GT +     +G K+VGF GR+  Y+DAIG +
Sbjct  542  YGPYGEENGTYYTSTKTEG-KVVGFHGRSSSYLDAIGVH  579



>gb|KCW69704.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
 gb|KCW69705.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
Length=230

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 57/92 (62%), Gaps = 7/92 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG+++  I+     +   DEYL  +SG     +     V+RS+ F +N R FGP+G  
Sbjct  106  GHGGDQSAEIK-----LQFPDEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGME  160

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF+F + DG +IVGF GR+G+Y+D+IG +
Sbjct  161  HGTPFSFPS-DG-RIVGFKGRSGWYLDSIGFH  190



>ref|XP_009784520.1| PREDICTED: uncharacterized protein LOC104232941, partial [Nicotiana 
sylvestris]
Length=1047

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 8/93 (9%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGP-  398
            GGGG    V+   T       EYLT I+G FG        V++S+ F TN +++GP+G  
Sbjct  78   GGGGRRAKVVFEAT-----PLEYLTGINGTFG--YGGSHLVIKSLCFITNAKSYGPFGSK  130

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            + GTPF+   ++G  IVGF G +G Y+DAIG Y
Sbjct  131  DGGTPFSLVMKEGVAIVGFHGCSGLYLDAIGVY  163



>ref|XP_004964114.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=118

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
             E++ EIS  FG F      V+ S+KF TNVR FGP+   +GTPF+   Q  + IVGFF 
Sbjct  45   SEFVKEISRTFGTFDGA--IVVTSLKFVTNVRTFGPWSRGIGTPFSVPVQSRSGIVGFFA  102

Query  462  RAGFYVDAIGTY  497
              G Y+DAIG +
Sbjct  103  HVGKYLDAIGVH  114



>ref|XP_004974871.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=242

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 53/90 (59%), Gaps = 8/90 (9%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            DE+LT + G  G F +  F V+RS+ F +N RA+GPYG   G PF   A  G +IVGF  
Sbjct  67   DEHLTSVEGHCGEF-EGNF-VVRSLTFVSNRRAYGPYGRPDGVPFALPAA-GGRIVGFHA  123

Query  462  RAGFYVDAIGTYNA*VIISLLSSEA*CSIG  551
            R+G ++DAIGTY     + L      C+IG
Sbjct  124  RSGRHLDAIGTY-----VKLCWRTTRCNIG  148



>gb|EYU45843.1| hypothetical protein MIMGU_mgv1a014002mg [Erythranthe guttata]
Length=204

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            I +   DE LT ++G +   +     V+RS+ F TN R FGP+G   GTPF+    +G +
Sbjct  78   IKLQFPDEILTTVTGYYSPVVHGGSPVIRSLTFKTNRRTFGPFGVEEGTPFSL-PMEGGQ  136

Query  444  IVGFFGRAGFYVDAIG  491
            IVGF GR G+Y+DAIG
Sbjct  137  IVGFKGRGGWYLDAIG  152



>tpg|DAA60181.1| TPA: hypothetical protein ZEAMMB73_326702 [Zea mays]
Length=297

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 10/100 (10%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGP-  398
            GG G ET     + +   G  E LTE+SG  G  +D    V+ S+KF T+++ +GP+G  
Sbjct  155  GGSGGET-----EPVIQLGDSEVLTELSGTIGN-VDGH-TVITSIKFVTSLKTYGPFGAW  207

Query  399  --NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA*VI  512
                 TPF    Q G+ IVGFF RAG Y+DA+G Y+A ++
Sbjct  208  GDGSDTPFAIPVQQGSAIVGFFARAGVYLDALGVYDANIL  247



>gb|EAY90359.1| hypothetical protein OsI_11939 [Oryza sativa Indica Group]
Length=150

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 59/108 (55%), Gaps = 5/108 (5%)
 Frame = +3

Query  174  TFSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRS  353
            +FS  +KD  K   T+G  G +  V   +TI ++   EY+ E+ G+ G   D    V+ S
Sbjct  44   SFSYLDKD--KTLHTVGPWGGQGGV-SEETITLE-PSEYVKEVHGSVGPIGDYT-HVVTS  98

Query  354  VKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +K  TN R  GP+G   GTPF     +   +VGFF RAG Y+++IG Y
Sbjct  99   LKLVTNQRTIGPFGNGAGTPFAVPVLNNGSVVGFFARAGPYLESIGIY  146



>ref|XP_007216928.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
 gb|EMJ18127.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
Length=351

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 11/93 (12%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRF---IDTRFDVLRSVKFTTNVRAFGPY  392
            G GGN+T  I+     +   DE+L  +SG +      I  R  ++RS+KF +N R FGPY
Sbjct  238  GRGGNQTAEIK-----LQYPDEFLVGVSGHYCPMMFGIGPR--LIRSLKFQSNRRTFGPY  290

Query  393  GPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            G   GTPF F   DG KIVG  GR G+Y+DAIG
Sbjct  291  GIEEGTPFTFTV-DGGKIVGLKGRDGWYLDAIG  322


 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 69/149 (46%), Gaps = 14/149 (9%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGG  233
            +  GP G NGG  W     N + +   +                 N    K     G GG
Sbjct  30   IVIGPWGGNGGADWDDGIYNGVRE---IKIAYCLCIDSITVVYDRNGKPVKAETHGGRGG  86

Query  234  NETTVIRNDTINIDGADEYLTEISGAFGRF---IDTRFDVLRSVKFTTNVRAFGPYGPNV  404
            N+T  I+     +   DE+L  +SG +      I  R  ++RS+KF +N R FGPYG   
Sbjct  87   NQTAEIK-----LQYPDEHLVGVSGHYCPMMFGIGPR--LIRSLKFQSNRRTFGPYGIEE  139

Query  405  GTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            GTPF F   DG +IVG  GR G+Y+DAIG
Sbjct  140  GTPFTFTV-DGGQIVGLKGRDGWYLDAIG  167



>gb|EEE52450.1| hypothetical protein OsJ_34606 [Oryza sativa Japonica Group]
Length=370

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNV-RAFGPYGPNVGTPFNFQAQDGAKIVG  452
            GA E++  +SG  G F     +V+ S+KFTTN+ R +GPYG   GTPF    +D A IVG
Sbjct  292  GAFEHIKGLSGTVGSF-GMLQNVITSLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVG  350

Query  453  FFGRAGFYVDAIGTY  497
            FFGRAG  V+A+G Y
Sbjct  351  FFGRAGPCVEAVGVY  365



>ref|XP_006663456.1| PREDICTED: disease resistance protein RPM1-like [Oryza brachyantha]
Length=1102

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 36/107 (34%), Positives = 58/107 (54%), Gaps = 6/107 (6%)
 Frame = +3

Query  177   FSSTNKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSV  356
             FS  +K G +    + GG   T  +    +++    E++ E+SG +G F      V+ S+
Sbjct  999   FSYLDKSGKQHTTPLWGGAGGTVRM----VHL-APSEFVKEVSGTYGPFFSFP-SVITSL  1052

Query  357   KFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             +  TN+R++GP+G   GT F  + +    IVGFFG +  Y+DAIG Y
Sbjct  1053  QLRTNIRSYGPFGEPKGTTFRTRVKQNGSIVGFFGHSTVYIDAIGVY  1099



>ref|XP_004984089.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=151

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 59/109 (54%), Gaps = 5/109 (5%)
 Frame = +3

Query  177  FSSTNKDGSKDCLTIG--GGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLR  350
             S T +DG  +  T G  GG  +     ++ I +D A EY+TE++G  G   D     + 
Sbjct  42   ISFTYRDGDGNLHTAGPWGGAAKGQGEGDENITLD-ASEYVTEVAGTIGPIGDAPH-TIS  99

Query  351  SVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            S+KF TN   +GP+G   GTPFN    D A +V  F RAG Y+DAIG Y
Sbjct  100  SLKFVTNRATYGPFGRGAGTPFNVP-LDNASVVAMFARAGDYLDAIGFY  147



>ref|XP_010231090.1| PREDICTED: jacalin-related lectin 19-like isoform X3 [Brachypodium 
distachyon]
Length=224

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 11/99 (11%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPY--G  395
            G GGN+TT ++     +   DE+LT +SG +G        V+RS+ F T+  A+GP+  G
Sbjct  72   GAGGNQTTQVK-----LRFPDEHLTAVSGRYGPVAQGGAAVIRSLAFRTDRAAYGPFGAG  126

Query  396  PNVG---TPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA  503
            P      TPF F A DG  IVGF GR+G+ +DA+G Y A
Sbjct  127  PTADGGTTPFEF-AVDGGVIVGFCGRSGWQLDAVGVYLA  164



>ref|XP_009768641.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1282

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +3

Query  285  EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPFNFQAQDGAKIVGFFG  461
            EYLT I G FG  +     V++S+ F TN + +GP+G   G TPF+   ++G  IVGF G
Sbjct  29   EYLTGIKGTFG--LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHG  86

Query  462  RAGFYVDAIGTY  497
            R G Y+DAIG Y
Sbjct  87   RCGAYLDAIGVY  98



>ref|XP_010932856.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Elaeis 
guineensis]
Length=271

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G + YLT ISG +G + D    V+ S+ F T +  +GPYGPN GT F+   + G KIVGF
Sbjct  192  GNNHYLTAISGYYGNYHDCI--VITSLTFVTTMSTYGPYGPNEGTAFSLPMRAG-KIVGF  248

Query  456  FGRAGFYVDAIGTY  497
            FG AG ++DA+G Y
Sbjct  249  FGYAGQWLDALGFY  262


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 67/146 (46%), Gaps = 13/146 (9%)
 Frame = +3

Query  63   GPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGGNET  242
            GP G +GG  WSF     I +I I  GG  ++     TF   + + ++     GG G E 
Sbjct  3    GPWGGSGGTAWSFENAQTITKIKISVGGVVDSI----TFQYMDGETARWSPRYGGEGGEP  58

Query  243  TVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNF  422
            T I  +        E++  I G +  + +    ++ S+ F T +R +GPYG   GT F+ 
Sbjct  59   TEIELE------PAEFIISIKGYYSTYAE--MIIIYSLTFVTTIREYGPYGQEQGTQFSV  110

Query  423  QAQDGAKIVGFFGRAGFYVDAIGTYN  500
                G  I GF G +   +DAIG Y 
Sbjct  111  PKGTGW-ISGFHGCSDTLLDAIGVYK  135



>ref|XP_006838698.1| hypothetical protein AMTR_s00002p00248970 [Amborella trichopoda]
 gb|ERN01267.1| hypothetical protein AMTR_s00002p00248970 [Amborella trichopoda]
Length=149

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 7/81 (9%)
 Frame = +3

Query  249  IRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQA  428
            +R   + +D  DE +  +SG F         ++RS  F+TN R  GPYG  +GTPF+F  
Sbjct  10   LRMCKVKLDYLDETIMSLSGHF------EPKLMRSPSFSTNRRTSGPYGLQIGTPFSFSM  63

Query  429  QDGAKIVGFFGRAGFYVDAIG  491
             DG K+VGF GRA  Y++A+G
Sbjct  64   TDG-KVVGFHGRASDYLNAMG  83



>ref|XP_010062570.1| PREDICTED: jacalin-related lectin 19 [Eucalyptus grandis]
Length=279

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 7/90 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG+++  I+     +   DEYL  +SG     +     V+RS+ F +N R FGP+G  
Sbjct  155  GHGGDQSAEIK-----LQFPDEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGME  209

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF+F + DG +IVGF GR+G+Y+D+IG
Sbjct  210  HGTPFSFPS-DG-RIVGFKGRSGWYLDSIG  237



>ref|XP_009760249.1| PREDICTED: agglutinin-like [Nicotiana sylvestris]
Length=345

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 77/147 (52%), Gaps = 13/147 (9%)
 Frame = +3

Query  66   PLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGS-KDCLTIGGGGNET  242
            P G  GG  W+++  + I +I+I  G   ++      F +  K+G+  D    GG G   
Sbjct  17   PWGGKGGLEWNYKLKSPIKEIVIAHGSIIDSI----MFRTITKEGTIVDSPKFGGNGGG-  71

Query  243  TVIRNDTINIDGAD-EYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG-TPF  416
               R D +NI+    EYLT I G  G +      V++S+ F TN + +GP+G   G T F
Sbjct  72   ---RRDKVNIEATPLEYLTGIKGTLGHYGSNL--VVKSLSFITNGKNYGPFGTEAGGTLF  126

Query  417  NFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +   ++G  IVGF GR+G Y+DAIG Y
Sbjct  127  SLVMKEGGAIVGFHGRSGLYLDAIGVY  153


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 6/92 (7%)
 Frame = +3

Query  225  GGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTR-FDVLRSVKFTTNVRAFGPYGPN  401
            G GN+T       IN+DG +E L  I G +    D    D +R + F TN   +GPYG  
Sbjct  255  GAGNDTV----RKINVDGENELLIGIEGFYSPVDDNGGLDAIRQIAFYTNKGKYGPYGTE  310

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +GT F+  A  G KIVGF G++G +++AIG +
Sbjct  311  IGTYFSSSAARG-KIVGFHGKSGVFLNAIGVH  341



>ref|XP_008466548.1| PREDICTED: agglutinin-like [Cucumis melo]
Length=476

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 55/92 (60%), Gaps = 6/92 (7%)
 Frame = +3

Query  228  GGNETTVIRNDTINIDGADEYLTEISGAFGRF--IDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GGNE +   +  + +D  +EYL  I G +G         +V+RS+ F TN + +GP+G  
Sbjct  66   GGNEGS---SSKVVLDYPNEYLISIYGYYGYIGKWGLAHNVIRSLTFQTNRKTYGPFGKE  122

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             G  F+F    GAKIVGF GR+G+Y+DAIG Y
Sbjct  123  EGVKFSFPIM-GAKIVGFHGRSGWYLDAIGLY  153


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 68/151 (45%), Gaps = 19/151 (13%)
 Frame = +3

Query  63   GPLGHNGGDFWS--FRPMNK--IDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGG  230
            GP G  GG  W   FR + +  +D    +                + K G  +      G
Sbjct  168  GPFGGKGGHPWEYVFRSIRRFVVDHEQWIHSIQFEYEDKNGKLLWSKKHGDTN------G  221

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFG--RFIDTRFDVLRSVKFTTNVRAFGPYGPNV  404
             +++ V+      ++  DEY   + G +   R ++    V+RS+ F TN R +GP+G   
Sbjct  222  SSKSEVV------LEFPDEYFVSVHGYYSHIRVLEDSATVIRSLTFKTNRRTYGPFGIED  275

Query  405  GTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            GT F+     G  IVG +GR+G ++DAIG Y
Sbjct  276  GTRFSCPIL-GTDIVGVYGRSGLFLDAIGLY  305


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 9/96 (9%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFG--RFIDTRFDVLRSVKFTTNVRAFGPYG  395
            G GG+ + V+      ++  DEYL  I G +   R       V+RS+   TN +++GP+G
Sbjct  384  GDGGSRSEVV------LEFPDEYLVSIRGYYSDIRRWGLATTVIRSLTLETNKKSYGPFG  437

Query  396  PNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA  503
               G+ F+F    G K+VG  GR+G ++ AIG + A
Sbjct  438  VEDGSKFSFPTV-GLKVVGIHGRSGLFLYAIGLHVA  472



>gb|ABA94732.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=597

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNV-RAFGPYGPNVGTPFNFQAQDGAKIVG  452
            GA E++  +SG  G F   + +V+ S+KFTTN+ R +GPYG   GTPF    +D A IVG
Sbjct  519  GAFEHIKGLSGTVGSFGMLQ-NVITSLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVG  577

Query  453  FFGRAGFYVDAIGTY  497
            FFGRAG  V+A+G Y
Sbjct  578  FFGRAGPCVEAVGVY  592


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 1/74 (1%)
 Frame = +3

Query  276  GADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGF  455
            G  E+LTEISG  G ++    DV++S+   TN  ++GP+G   GT F+    +G+ IVGF
Sbjct  359  GPSEFLTEISGTTGPYVCAVADVVKSLTLVTNSGSYGPFGQGGGTAFHTSQSNGS-IVGF  417

Query  456  FGRAGFYVDAIGTY  497
            FGRAG ++ +IG Y
Sbjct  418  FGRAGGFLHSIGVY  431



>ref|XP_010110011.1| hypothetical protein L484_021900 [Morus notabilis]
 gb|EXC25029.1| hypothetical protein L484_021900 [Morus notabilis]
Length=826

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R D I +D  DE+LT+ISG +G  I     V++S+ F TN + +GP+G   G PF    +
Sbjct  437  RLDKITLDYPDEFLTQISGYYGSTIFRGPIVVKSLTFYTNKKKYGPFGDEQGIPFTSTQK  496

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            DG  IVGF GR G+++D IG +
Sbjct  497  DGI-IVGFHGRKGWFLDCIGVH  517


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 1/83 (1%)
 Frame = +3

Query  249  IRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQA  428
            ++ D + +D  +EYL  ISG +G   +    V+RS+   +N + +GP+G   GT F+F A
Sbjct  66   VKTDKVKLDYPEEYLISISGYYGEISECGPVVVRSLLLESNKKRYGPFGFQKGTHFSF-A  124

Query  429  QDGAKIVGFFGRAGFYVDAIGTY  497
              G KIVGF GR+G  +D+IG +
Sbjct  125  LTGGKIVGFHGRSGHPLDSIGVH  147


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = +3

Query  225  GGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGPN  401
            GG N+ +      I  +   E LT ISG +G    D    V++S+ F TN   +GPYG  
Sbjct  621  GGNNDGSC---HVIQFEYPREVLTCISGYYGTIRGDEYKKVVKSLTFHTNRGRYGPYGEE  677

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            +GT F     +G KIVGF G++G Y+ AIG +
Sbjct  678  IGTYFTSAKTEG-KIVGFHGKSGCYLYAIGVH  708



>ref|XP_010231088.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Brachypodium 
distachyon]
Length=259

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 57/99 (58%), Gaps = 11/99 (11%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPY--G  395
            G GGN+TT      + +   DE+LT +SG +G        V+RS+ F T+  A+GP+  G
Sbjct  107  GAGGNQTT-----QVKLRFPDEHLTAVSGRYGPVAQGGAAVIRSLAFRTDRAAYGPFGAG  161

Query  396  PNVG---TPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA  503
            P      TPF F A DG  IVGF GR+G+ +DA+G Y A
Sbjct  162  PTADGGTTPFEF-AVDGGVIVGFCGRSGWQLDAVGVYLA  199



>ref|XP_010231089.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Brachypodium 
distachyon]
Length=225

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 11/99 (11%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPY--G  395
            G GGN+TT ++     +   DE+LT +SG +G        V+RS+ F T+  A+GP+  G
Sbjct  73   GAGGNQTTQVK-----LRFPDEHLTAVSGRYGPVAQGGAAVIRSLAFRTDRAAYGPFGAG  127

Query  396  PNVG---TPFNFQAQDGAKIVGFFGRAGFYVDAIGTYNA  503
            P      TPF F A DG  IVGF GR+G+ +DA+G Y A
Sbjct  128  PTADGGTTPFEF-AVDGGVIVGFCGRSGWQLDAVGVYLA  165



>ref|NP_001141303.1| uncharacterized protein LOC100273394 [Zea mays]
 gb|ACF86025.1| unknown [Zea mays]
Length=306

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 54/95 (57%), Gaps = 10/95 (11%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGP-  398
            GG G ET     + +   G  E LTE+SG  G  +D    V+ S+KF T+++ +GP+G  
Sbjct  215  GGSGGET-----EPVIQLGDSEVLTELSGTIGN-VD-GLTVITSIKFVTSLKTYGPFGAW  267

Query  399  --NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
                 TPF    Q G+ IVGFF RAG Y+DA+G Y
Sbjct  268  GDGSDTPFTIPVQQGSAIVGFFARAGIYLDAVGVY  302



>emb|CDO97947.1| unnamed protein product [Coffea canephora]
Length=276

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 77/148 (52%), Gaps = 9/148 (6%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGG  233
            +A GP G NGG  W     N + +I ++     ++  +    +     G K     G GG
Sbjct  89   IAVGPWGGNGGSAWDDGSYNGVREITLVHARCIDSMRVVYDKNGKPFVGEKHG---GVGG  145

Query  234  NETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTP  413
            ++T+ I+     +   DE+LT +SG     +     V+R++ F +N R FGPYG   G P
Sbjct  146  SKTSEIK-----LQFPDEFLTSVSGFVAPVVHGGSPVIRALTFKSNKRTFGPYGVEEGAP  200

Query  414  FNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            F+    +G +IVGF GR+G+Y+D++G +
Sbjct  201  FSLPI-EGGQIVGFKGRSGWYLDSLGCH  227



>ref|XP_010064569.1| PREDICTED: jacalin-related lectin 4-like [Eucalyptus grandis]
Length=989

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 2/79 (3%)
 Frame = +3

Query  261  TINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGA  440
            T+ +D  +EYLT ISG      D    V++S+KF TN + +GP+G   G  F+F   DGA
Sbjct  168  TVKLDYPNEYLTSISGHIRD--DQTPIVIQSLKFHTNRKTYGPFGSEQGESFHFPQVDGA  225

Query  441  KIVGFFGRAGFYVDAIGTY  497
            KIVGF G+ G ++D+IG +
Sbjct  226  KIVGFHGKCGKHLDSIGAH  244


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 48/92 (52%), Gaps = 11/92 (12%)
 Frame = +3

Query  231  GNETTVIRN---DTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GN   + RN    TI I   DEYLT ISG        R   +RS+ F TN R  GP G  
Sbjct  628  GNTLNIGRNVKIHTIEIHDPDEYLTSISGV-------RLGGIRSLTFQTNKRMIGPIGKE  680

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             G  F+  A  G KIVGF+G +G  ++AIG Y
Sbjct  681  WGKHFSSPAT-GGKIVGFYGTSGEQLEAIGAY  711



>ref|XP_008221341.1| PREDICTED: uncharacterized protein LOC103321320 [Prunus mume]
Length=622

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            + DT+ +   +E+LT I G +G+  +     +RS+KF +N + +GP+G   GT F+  A 
Sbjct  71   KTDTVKLAYPEEFLTSIEGHYGKISEWGPVSIRSLKFKSNKKTYGPFGIEQGTYFSLPAA  130

Query  432  DG--AKIVGFFGRAGFYVDAIGTY  497
                +KIVGFFG++G+++D+IG Y
Sbjct  131  RAGSSKIVGFFGKSGWFLDSIGAY  154


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            ++D I  D  +E LT I+G FG  +    +V++S+ F T  +  GPYG   GTPF  + +
Sbjct  312  KSDKIVFDFPNEILTHITGTFGAAMMMGPNVIKSLTFHTTKKKHGPYGEEQGTPFTTKLR  371

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVG  GR G ++DA+G +
Sbjct  372  EG-KIVGIHGRKGLFLDALGVH  392


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGA  440
            I ++   E LT ISG +G    + R  +++S+ F T+   +GP+G  VGT F     +G 
Sbjct  525  IKLEYPHEVLTCISGYYGCISKNERPQIIKSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  583

Query  441  KIVGFFGRAGFYVDAIGTY  497
            K+VG  GR+  Y+DAIG +
Sbjct  584  KVVGLHGRSSLYLDAIGVH  602



>ref|XP_007222058.1| hypothetical protein PRUPE_ppa003185mg [Prunus persica]
 gb|EMJ23257.1| hypothetical protein PRUPE_ppa003185mg [Prunus persica]
Length=595

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 54/84 (64%), Gaps = 2/84 (2%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            + DT+ +   +E+LT I G +G+  +     +RS+KF +N + +GP+G   GT F+  A 
Sbjct  70   KTDTVKLAYPEEFLTSIEGHYGKISEWGPVSIRSLKFKSNKKTYGPFGIEQGTYFSLPAA  129

Query  432  DG--AKIVGFFGRAGFYVDAIGTY  497
                +KIVGFFG++G+++D+IG Y
Sbjct  130  RAGSSKIVGFFGKSGWFLDSIGAY  153


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            ++D I  D  +E LT I+G FG  +     V++S+ F T  +  GPYG   GTPF  + +
Sbjct  285  KSDKIVFDFPNEILTHITGTFGAAMMMGPIVIKSLTFHTTKKKHGPYGEEQGTPFTTKLR  344

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G KIVG  GR G ++DA+G +
Sbjct  345  EG-KIVGIHGRKGLFLDALGVH  365


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGA  440
            I ++   E LT ISG +G    + R  +++S+ F T+   +GP+G  VGT F     +G 
Sbjct  498  IKLEYPHEVLTCISGYYGCISKNERPQIIKSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  556

Query  441  KIVGFFGRAGFYVDAIGTY  497
            K+VG  GR+ FY+DAIG +
Sbjct  557  KVVGLHGRSSFYLDAIGVH  575



>gb|AAM46813.1| hessian fly response gene 1 protein [Triticum aestivum]
Length=345

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 48/82 (59%), Gaps = 3/82 (4%)
 Frame = +3

Query  258  DTINIDGADEYLTEISGAFGRFID--TRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            DTI +    E +TE+SG  G F +    ++ + S+  TTN R +GP+G    TPF+   Q
Sbjct  258  DTIEL-APSEIVTEVSGTVGIFAEDNVEYNAIASLTITTNHRPYGPFGETQSTPFSVPVQ  316

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            D   IVGFF  AG YV+A+G Y
Sbjct  317  DNNNIVGFFACAGKYVEALGVY  338



>ref|XP_007142198.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
 gb|ESW14192.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
Length=507

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 6/92 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG +T     D +  D   E LT+I G  G F     +++RS+ F +N + +GP+G  
Sbjct  64   GSGGRKT-----DKVKFDYPKEILTKIHGYCGSFNQLGPNLVRSLSFESNKKTYGPFGVE  118

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GT F+     GAKIVGF GR G+Y+DAIG Y
Sbjct  119  QGTYFSVPL-TGAKIVGFHGRCGWYIDAIGVY  149



>gb|KHG23822.1| Agglutinin alpha chain [Gossypium arboreum]
Length=183

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 73/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  51   DVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGG  230
             V  GP G NGG  W     N + +I ++     ++  +    +       K     G G
Sbjct  15   SVVVGPWGGNGGTAWDDGIYNGVREITLVYDRCIDSIRVVYDKNGKPVTAEKHG---GVG  71

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGT  410
            GN+T       I +   +E+L  ++G +   +     V+RS+ F +N R FGPYG   GT
Sbjct  72   GNKTA-----EIKLKFPEEFLISVTGYYCPVVYGGSPVIRSLTFKSNRRTFGPYGVEEGT  126

Query  411  PFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            PF F   +GA+I GF GR+G+YVD+IG
Sbjct  127  PFAFSV-EGARIAGFNGRSGWYVDSIG  152



>ref|XP_011001798.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 77/152 (51%), Gaps = 11/152 (7%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTI  221
            I   ++ GP G  GG+ WS+     I+QI+I  G +  +     +F  T      D  T 
Sbjct  298  IEGTISIGPWGGQGGNPWSYITNRGINQIVINVGLNIKSI----SFRDTTD---LDSATF  350

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GG  N   +    T+ I+   E+L  ISG +G F  +    + S+ FTTN   +GP+G  
Sbjct  351  GGN-NPNDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTG  407

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF+    +   +VGF GRAG Y+DAIG +
Sbjct  408  SGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  438


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 75/150 (50%), Gaps = 13/150 (9%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCL-TIGGG  230
            ++ GP G  GGD WS+R    I +I++   G+          S + KD S     T GG 
Sbjct  8    ISLGPWGGLGGDHWSYRASGGITEIVLRVEGNIK--------SISFKDASGLVSGTFGGR  59

Query  231  GNETT-VIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            GN+         I I    EYL  ISG +G +      V+ S+ F TN+  +GP+G  +G
Sbjct  60   GNDPNDRGEQKKIEIQWPSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGTALG  117

Query  408  TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F+    D A +VGF GR G+Y+DA+G +
Sbjct  118  ETFSIPIADSA-VVGFHGRCGYYLDALGIF  146


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 75/149 (50%), Gaps = 11/149 (7%)
 Frame = +3

Query  51   DVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGG  230
             ++ G  G  GGD +SFR  + I +II+  G +          S + KDG+       GG
Sbjct  155  SISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTNIK--------SLSFKDGNGQEYGNFGG  206

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGT  410
             N         I IDG  E+LT I+G +G +      V+ S+ F TN+   GP+G   GT
Sbjct  207  NNANDTGEERRIEIDGLSEHLTSITGTYGNY--AGMVVITSLSFITNLTTHGPFGTATGT  264

Query  411  PFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             F+   + G+ ++GF GR G Y+DAIG +
Sbjct  265  SFSIPIE-GSVVIGFHGRGGHYLDAIGIH  292



>ref|XP_007142199.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
 gb|ESW14193.1| hypothetical protein PHAVU_008G260500g [Phaseolus vulgaris]
Length=598

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 6/92 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG +T     D +  D   E LT+I G  G F     +++RS+ F +N + +GP+G  
Sbjct  64   GSGGRKT-----DKVKFDYPKEILTKIHGYCGSFNQLGPNLVRSLSFESNKKTYGPFGVE  118

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GT F+     GAKIVGF GR G+Y+DAIG Y
Sbjct  119  QGTYFSVPL-TGAKIVGFHGRCGWYIDAIGVY  149


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 48/94 (51%), Gaps = 7/94 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI--DTRFDVLRSVKFTTNVRAFGPYG  395
            GG G +T       I ++   E LT ISG +G     D +  +++S+   T+   +GP+G
Sbjct  491  GGNGGDTM----HRIQLEHPHEVLTCISGYYGSITKDDQQHIIIKSLTLNTSRGKYGPFG  546

Query  396  PNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
               G  F     +G K+VGF G +  Y+DAIG +
Sbjct  547  EEAGKFFTSTTTEG-KVVGFHGSSSLYLDAIGVH  579



>ref|XP_008677995.1| PREDICTED: mannose/glucose-specific lectin-like isoform X7 [Zea 
mays]
Length=680

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +3

Query  255  NDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            N +  + G+ E+LT +SG+ G F +   +V+ S+ F TN R++GP+G   GT F+   Q 
Sbjct  428  NSSFQLAGS-EFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQG  485

Query  435  GAKIVGFFGRAGFYVDAIGTYNA  503
               IVGFFGR+G Y++AIG Y A
Sbjct  486  NGCIVGFFGRSGRYLNAIGVYTA  508



>ref|XP_011001797.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
Length=445

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 77/152 (51%), Gaps = 11/152 (7%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTI  221
            I   ++ GP G  GG+ WS+     I+QI+I  G +  +     +F  T      D  T 
Sbjct  298  IEGTISIGPWGGQGGNPWSYITNRGINQIVINVGLNIKSI----SFRDTTD---LDSATF  350

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GG  N   +    T+ I+   E+L  ISG +G F  +    + S+ FTTN   +GP+G  
Sbjct  351  GGN-NPNDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTG  407

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF+    +   +VGF GRAG Y+DAIG +
Sbjct  408  SGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  438


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 75/150 (50%), Gaps = 13/150 (9%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCL-TIGGG  230
            ++ GP G  GGD WS+R    I +I++   G+          S + KD S     T GG 
Sbjct  8    ISLGPWGGLGGDHWSYRASGGITEIVLRVVGNIK--------SISFKDASGLVSGTFGGR  59

Query  231  GNETT-VIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            GN+         I I    EYL  ISG +G +      V+ S+ F TN+  +GP+G  +G
Sbjct  60   GNDPNDRGEQKKIEIQWPSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGTALG  117

Query  408  TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F+    D A +VGF GR G+Y+DA+G +
Sbjct  118  ETFSIPIADSA-VVGFHGRCGYYLDALGIF  146


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 75/149 (50%), Gaps = 11/149 (7%)
 Frame = +3

Query  51   DVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGG  230
             ++ G  G  GGD +SFR  + I +II+  G +          S + KDG+       GG
Sbjct  155  SISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTNIK--------SLSFKDGNGQEYGKFGG  206

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGT  410
             N         I IDG  E+LT I+G +G +      V+ S+ F TN+   GP+G   GT
Sbjct  207  KNANDTGEERRIEIDGLSEHLTSITGTYGNY--AGMVVITSLSFITNLTTHGPFGTATGT  264

Query  411  PFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             F+   + G+ ++GF GR G Y+DAIG +
Sbjct  265  SFSIPIE-GSVVIGFHGRGGHYLDAIGIH  292



>ref|XP_006372328.1| hypothetical protein POPTR_0017s00620g, partial [Populus trichocarpa]
 gb|ERP50125.1| hypothetical protein POPTR_0017s00620g, partial [Populus trichocarpa]
Length=151

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 75/148 (51%), Gaps = 11/148 (7%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGG  233
            ++ G  G  GGD +SFR  + I +II+  G +          S + KDG+       GG 
Sbjct  15   ISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTNIK--------SLSFKDGNDQEYGKFGGN  66

Query  234  NETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTP  413
            N         I IDG  E+LT I+G +G +      V+ S+ F TN+   GP+G   GT 
Sbjct  67   NANDTGEERRIEIDGLSEHLTSITGTYGNY--AGIVVITSLSFITNLTTHGPFGTATGTS  124

Query  414  FNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            F+   + G+ ++GF GR+G Y DAIG +
Sbjct  125  FSVPIE-GSVVIGFHGRSGHYFDAIGIH  151



>pdb|4MQ0|A Chain A, Crystal Structure Of Parkia Biglobosa Seed Lectin (pbl) 
In Complex With Methyl Alpha D-mannopyranoside
Length=446

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 81/154 (53%), Gaps = 12/154 (8%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGS-KDCLT  218
            +   ++ GP G +GGD WS+     I+QIII +G +          S   KD S  D  T
Sbjct  296  VEGSISIGPWGGSGGDPWSYTANEGINQIIIYAGSNIK--------SIAFKDTSGLDSAT  347

Query  219  IGGGGNETTVIRNDTINIDGADEYLTEISGAFGRF-IDTRFDVLRSVKFTTNVRAFGPYG  395
             GG   + T  +N T++I    EYLT I G +G++     F  + S+ FTTN+  +GP+G
Sbjct  348  FGGVNPKDTGEKN-TVSIKWPSEYLTSIDGTYGQYKFKDVFTTVTSLSFTTNLATYGPFG  406

Query  396  PNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
                T F+    +   +VGF GRAG Y+DAIG +
Sbjct  407  KASLTSFSIPIHNNM-VVGFHGRAGDYLDAIGIF  439


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 4/102 (4%)
 Frame = +3

Query  192  KDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTN  371
            KD    C   GG  +   +   + + IDG  E+LT ISG +G +    F+VL S+ F TN
Sbjct  193  KDADGHCEKFGGQ-DPNDIGVEEKVEIDGNLEHLTSISGTYGNY--KGFEVLTSLSFITN  249

Query  372  VRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
            V   GP+G   GT F+ +  +G+ + GF G+ G+Y+D+IG Y
Sbjct  250  VTKHGPFGIASGTSFS-RPIEGSLVTGFHGKGGYYLDSIGIY  290


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 76/151 (50%), Gaps = 14/151 (9%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGGG  233
            ++ GP G +GGD WSF+  + I +I+I    +          S + KD   D     GG 
Sbjct  6    ISVGPWGGSGGDHWSFKANHAITEILIHVKDNIK--------SISFKDAGGDISGTFGGK  57

Query  234  N--ETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            +  E        I I    EYL  ISG++G +      V+RS+ F TN+  +GP+G   G
Sbjct  58   DPRENKKGEEKKIGIRWPTEYLKSISGSYGDY--NGILVIRSLSFITNLTTYGPFGSTSG  115

Query  408  -TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
               F+    D + +VGF GRAG+Y+DA+G +
Sbjct  116  GESFSIPIAD-SVVVGFHGRAGYYLDALGIF  145



>emb|CAJ38387.1| jacalin-domain protein [Plantago major]
Length=197

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            +   I +   DE LT +SG     +     V+RS+ F +N R FGP+G   G+PF+F   
Sbjct  82   KTTEIKLQFPDEVLTSVSGHCCPVVHGGSPVIRSLTFKSNKRTFGPFGVEEGSPFSF-PM  140

Query  432  DGAKIVGFFGRAGFYVDAIG  491
            +G +IVGF GR G++VDAIG
Sbjct  141  EGGQIVGFKGRNGWFVDAIG  160



>ref|NP_001104964.1| beta-glucosidase aggregating factor precursor [Zea mays]
 gb|AAF71261.2|AF232008_1 beta-glucosidase aggregating factor precursor [Zea mays]
Length=306

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 54/95 (57%), Gaps = 10/95 (11%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGP-  398
            GG G ET     + +   G  E LTE+SG  G  +D    V+ S+KF T+++ +GP+G  
Sbjct  215  GGSGGET-----EPVIQLGDSEVLTELSGTIGN-VD-GLTVITSIKFVTSLKTYGPFGAW  267

Query  399  --NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
                 TPF    Q G+ IVGFF RAG Y+DA+G Y
Sbjct  268  GNGSDTPFAIPVQQGSAIVGFFARAGVYLDALGVY  302



>gb|ABJ97445.1| beta-glucosidase aggregating factor 1 [Zea mays]
Length=306

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 54/95 (57%), Gaps = 10/95 (11%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGP-  398
            GG G ET     + +   G  E LTE+SG  G  +D    V+ S+KF T+++ +GP+G  
Sbjct  215  GGSGGET-----EPVIQLGDSEVLTELSGTIGN-VD-GLTVITSIKFVTSLKTYGPFGAW  267

Query  399  --NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
                 TPF    Q G+ IVGFF RAG Y+DA+G Y
Sbjct  268  GNGSDTPFAIPVQQGSAIVGFFARAGVYLDALGVY  302



>ref|XP_002515891.1| hypothetical protein RCOM_1485780 [Ricinus communis]
 gb|EEF46311.1| hypothetical protein RCOM_1485780 [Ricinus communis]
Length=514

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 53/90 (59%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG + T I+     +   +EYL   SG +   +     V+RS+ F +N R FGP+G  
Sbjct  390  GVGGTKRTEIK-----LQYPEEYLVSASGNYCPVVYGGSPVIRSITFKSNRRTFGPFGIE  444

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF   + DG ++VGF GR+G+Y+DAIG
Sbjct  445  EGTPFTL-SMDGRRVVGFTGRSGWYLDAIG  473



>ref|XP_010110012.1| hypothetical protein L484_021901 [Morus notabilis]
 gb|EXC25030.1| hypothetical protein L484_021901 [Morus notabilis]
Length=650

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            I +D  DE+L  I+G +G+  +    ++RS+   +N R +GP+G   GT F+F    G K
Sbjct  97   IKLDYPDEFLIAINGYYGKLSEWGPAIVRSLTLKSNKRTYGPFGAEQGTCFSF-PMSGVK  155

Query  444  IVGFFGRAGFYVDAIGTY  497
            IVGF+G AG++VD+IG +
Sbjct  156  IVGFYGMAGWFVDSIGVH  173


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            R + I  D  +E LT I+G F   +    +V++S+ F T     GP+G   G PF  + +
Sbjct  346  RTEKIIFDYPNEILTHITGTFSPAMIMGPNVIKSLTFHTTKGKHGPFGDQQGCPFTSKLK  405

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G +I GF GR G ++DA+G Y
Sbjct  406  EG-RIAGFHGRKGLFLDALGVY  426


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 7/93 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGP  398
            G GGN T  I+     ++   E L  I+G +G    D +  VL+S+ F T+   +GP+G 
Sbjct  545  GNGGNTTHRIK-----LEYPHEILVCITGFYGGITKDEKAQVLKSLTFYTSRGKYGPFGD  599

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             +GT F     +G K+VG  GR  FY+DAIG +
Sbjct  600  EIGTYFTSTTTEG-KVVGLHGRCSFYLDAIGVH  631



>gb|EMS53468.1| hypothetical protein TRIUR3_21407 [Triticum urartu]
Length=135

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
            DE+ T + G +G F D  F V+RS+ F +N R+FGPYG   G PF   A  G KI+GF  
Sbjct  54   DEHFTGVVGHYGEF-DGSF-VVRSLTFVSNARSFGPYGQEDGVPFALPAA-GGKILGFHA  110

Query  462  RAGFYVDAIGTY  497
            R+G  +DA+GTY
Sbjct  111  RSGRRLDALGTY  122



>ref|NP_001068257.2| Os11g0607900 [Oryza sativa Japonica Group]
 dbj|BAF28620.2| Os11g0607900, partial [Oryza sativa Japonica Group]
Length=107

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 39/72 (54%), Gaps = 2/72 (3%)
 Frame = +3

Query  282  DEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAKIVGFFG  461
             EYLT ISG           ++ S+   TN R +GPYG   GTPF    Q    IVGFFG
Sbjct  23   SEYLTGISGTIAS--SPYGVIITSLTLVTNTRTYGPYGQVGGTPFQIPIQIKGSIVGFFG  80

Query  462  RAGFYVDAIGTY  497
            R G+YVDA G Y
Sbjct  81   RVGWYVDAFGIY  92



>gb|KJB70346.1| hypothetical protein B456_011G068300 [Gossypium raimondii]
Length=183

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 73/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  51   DVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGG  230
             V  GP G NGG  W     N + +I ++     ++  +    +       K     G G
Sbjct  15   SVVVGPWGGNGGAAWDDGIYNGVREITLVYDRCIDSIRVVYDKNGKPVTAEKHG---GVG  71

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGT  410
            GN+T       I +   +E+L  ++G +   +     V+RS+ F +N R FGPYG   GT
Sbjct  72   GNKTA-----EIKLKFPEEFLISVTGYYCPVVYGGSPVIRSLTFKSNRRTFGPYGVEEGT  126

Query  411  PFNFQAQDGAKIVGFFGRAGFYVDAIG  491
            PF F   +GA++ GF GR+G+YVD+IG
Sbjct  127  PFAFSV-EGARVAGFNGRSGWYVDSIG  152



>ref|XP_006416472.1| hypothetical protein EUTSA_v10007145mg [Eutrema salsugineum]
 gb|ESQ34825.1| hypothetical protein EUTSA_v10007145mg [Eutrema salsugineum]
Length=594

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  258  DTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDG  437
            D + +D   EYLT + G +G F       +RS+ F +N + +GP+G   GT F     D 
Sbjct  68   DKVKLDYPHEYLTSVRGTYGSFDVWGHLCVRSLTFESNRKKYGPFGVESGTYFALPKLD-  126

Query  438  AKIVGFFGRAGFYVDAIGTY  497
            +KI+GF G+AG+YVDAIG +
Sbjct  127  SKIIGFHGKAGWYVDAIGVH  146


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            ++D I  D   E LT ++G +G  +    +V++S+ F TN+   GP+G   G  F  +  
Sbjct  293  KHDKIVFDYPSEVLTHVTGTYGPLMYMGPNVIKSLTFHTNLGKHGPFGEEQGPSFAHKID  352

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G K+VGF GR G ++D+IG +
Sbjct  353  EG-KVVGFLGREGLFLDSIGVH  373


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDT-RFDVLRSVKFTTNVRAFGPYGP  398
            GGG N     R   I ++  +E LT ISG +G   ++ R +V++S+ F T+   +GPYG 
Sbjct  485  GGGNNGVATHR---IKLEYPNEMLTCISGYYGPLNNSDRSNVVKSLCFFTSRGKYGPYGE  541

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              GT F   A +G K++G  GR+  Y+DAIG +
Sbjct  542  ETGTFFTSTATEG-KVLGLHGRSSSYLDAIGVH  573



>ref|XP_006597181.1| PREDICTED: agglutinin-like isoform X1 [Glycine max]
 ref|XP_006597182.1| PREDICTED: agglutinin-like isoform X2 [Glycine max]
Length=671

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/90 (40%), Positives = 51/90 (57%), Gaps = 6/90 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GGN+T  I+     +   DE+L  +SG +   +     V+ S+ F +N + FGPYG  
Sbjct  553  GVGGNKTAEIK-----LQFPDEFLVSVSGHYCPVVRGGTPVILSLTFKSNRKTFGPYGVE  607

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIG  491
             GTPF F   DG  +VGF GR+ +Y+DAI 
Sbjct  608  EGTPFTFSI-DGGCVVGFKGRSDWYLDAIA  636



>ref|XP_007017646.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007017647.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14871.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14872.1| Mannose-binding lectin superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=598

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 7/93 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GGGG   T    D + +D  DE+LT + G +G   +    ++RS+ F +N +A+GPYG  
Sbjct  62   GGGGGSMT----DKVKLDYPDEFLTSVHGYYGILHERGPILVRSLTFFSNRKAYGPYGIE  117

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTYN  500
             GT F+       KIVGF GR G ++DAIGT++
Sbjct  118  QGTSFSMTR---GKIVGFHGRCGCFLDAIGTHS  147


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            + D I  D   E LT I+G FG  +    +V++S+ F TN    GPYG   G  F  +  
Sbjct  301  KTDRIIFDYPSEILTHITGTFGPLMYMGPNVIKSLTFHTNKGKHGPYGDEQGPSFTNKMN  360

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
            +G +I+GF GR G ++DA+G Y
Sbjct  361  EG-RIIGFHGREGLFLDAVGVY  381


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGA  440
            + +D   E L  ISG +G    + +  V+RS+ F ++   +GP+G  +GT F     +G 
Sbjct  501  VKLDHPHEVLICISGYYGPINNEEKSKVVRSLTFYSSRGKYGPFGEEIGTYFTSTTTEG-  559

Query  441  KIVGFFGRAGFYVDAIGTY  497
            K+VGF GR   Y+DAIG +
Sbjct  560  KVVGFHGRNSSYLDAIGVH  578



>ref|XP_010664949.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 
[Vitis vinifera]
Length=1593

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 4/103 (4%)
 Frame = +3

Query  189   NKDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTT  368
             +K+GS       GG   T   R + + +D  DE+LT I G +G  ++     +RS+   +
Sbjct  1004  DKNGSSVWSEKHGGSGGT---RTNRVKLDSPDEFLTSIHGHYGSLLERGPVFVRSLTLES  1060

Query  369   NVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             N R +GP+G   G  F+     G KI+GF G++G+Y+DAIG +
Sbjct  1061  NKRTYGPFGIEQGIYFSLPTT-GGKIIGFHGKSGWYLDAIGVH  1102


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 9/100 (9%)
 Frame = +3

Query  198   GSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVR  377
             GSK+    GG G      RND I ID   E LT I+G +   +    ++++S+ F T   
Sbjct  1278  GSKN----GGTGG----FRNDKIVIDYPYEVLTHITGYYAPTMVMGPNIIKSLTFHTTKT  1329

Query  378   AFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              +GP+G   GTPF+   ++G  IVGF GR G ++DAIG +
Sbjct  1330  KYGPFGEEQGTPFSSNIKEGV-IVGFHGRTGLFIDAIGVH  1368


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 5/103 (5%)
 Frame = +3

Query  192   KDGSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRF-IDTRFDVLRSVKFTT  368
             ++G     T  GG   TT  R   + ++   E ++ I G +G   I+  ++ ++S+ F T
Sbjct  1475  RNGQSIWSTKHGGDYGTTTHR---VKLEYPHEVVSCICGYYGPISINEPWNAIKSLTFYT  1531

Query  369   NVRAFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             +   +GP+G  +GT F     +G K+VGF GR+  Y+DAIG +
Sbjct  1532  SRGKYGPFGEEIGTYFTSTRTEG-KVVGFHGRSSLYLDAIGVH  1573



>ref|XP_010312054.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Solanum lycopersicum]
Length=674

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 6/92 (7%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GGGG +T     D I +   DE+L  ++G +G   +     +RS+ F +N R +GPYG  
Sbjct  64   GGGGAKT-----DKIILSYPDEFLISMNGYYGSLYERGSVFVRSLTFESNKRTYGPYGVE  118

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GT F      G KIVGF G+ G+Y+DAIG Y
Sbjct  119  QGTYFTLPISRG-KIVGFHGKCGWYLDAIGVY  149


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = +3

Query  258  DTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQD  434
            + + ++   E LT I+G +G    D    V++S+ F T  R FGP+G  +GT F     +
Sbjct  575  NKVKLEFPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSSTTE  634

Query  435  GAKIVGFFGRAGFYVDAIGTY  497
            G K+VGF GR G YVDAIG +
Sbjct  635  G-KVVGFHGRCGVYVDAIGVH  654


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = +3

Query  198  GSKDCLTIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVR  377
            GSK+    GG G      + + I  D   E LT I+G +G  +    +++ S+ F T  R
Sbjct  330  GSKN----GGTGG----FKTEKIIFDYPSEILTHITGYYGPTMIMGPNIIHSLTFHTTKR  381

Query  378  AFGPYGPNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              GPYG   G  F+ +  DG  IVGF GR G ++DA+G +
Sbjct  382  KHGPYGEEQGQQFSTKLSDGM-IVGFHGRRGMFLDALGVH  420



>ref|XP_011001796.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Populus 
euphratica]
Length=591

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 77/152 (51%), Gaps = 11/152 (7%)
 Frame = +3

Query  42   ISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTI  221
            I   ++ GP G  GG+ WS+     I+QI+I  G +  +     +F  T      D  T 
Sbjct  444  IEGTISIGPWGGQGGNPWSYITNRGINQIVINVGLNIKSI----SFRDTTD---LDSATF  496

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            GG  N   +    T+ I+   E+L  ISG +G F  +    + S+ FTTN   +GP+G  
Sbjct  497  GGN-NPNDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTG  553

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GTPF+    +   +VGF GRAG Y+DAIG +
Sbjct  554  SGTPFSIPINNNT-VVGFHGRAGHYLDAIGIF  584


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 75/150 (50%), Gaps = 13/150 (9%)
 Frame = +3

Query  54   VAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCL-TIGGG  230
            ++ GP G  GGD WS+R    I +I++   G+          S + KD S     T GG 
Sbjct  8    ISLGPWGGLGGDHWSYRASGGITEIVLRVVGNIK--------SISFKDASGLVSGTFGGR  59

Query  231  GNETT-VIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVG  407
            GN+         I I    EYL  ISG +G +      V+ S+ F TN+  +GP+G  +G
Sbjct  60   GNDPNDRGEQKKIEIQWPSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGTALG  117

Query  408  TPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
              F+    D A +VGF GR G+Y+DA+G +
Sbjct  118  ETFSIPIADSA-VVGFHGRCGYYLDALGIF  146


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 76/149 (51%), Gaps = 11/149 (7%)
 Frame = +3

Query  51   DVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGG  230
             ++ G  G  GGD +SFR  + I +II+  G +          S + KDG+       GG
Sbjct  155  SISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTNIK--------SLSFKDGNGQEYGKFGG  206

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGT  410
             N         I IDG  E+LT I+G +G +      V+ S+ F TN+   GP+G   GT
Sbjct  207  KNANDTGEERRIEIDGLSEHLTSITGTYGNY--AGMVVITSLSFITNLTTHGPFGTATGT  264

Query  411  PFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             F+   + G+ ++GF GR G+Y+DA+G +
Sbjct  265  SFSIPIE-GSVVIGFHGRGGYYLDALGIF  292


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 75/149 (50%), Gaps = 11/149 (7%)
 Frame = +3

Query  51   DVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCLTIGGG  230
             ++ G  G  GGD +SFR  + I +II+  G +          S + KDG+       GG
Sbjct  301  SISVGQWGGPGGDPFSFRVGSWIKEIIVHEGTNIK--------SLSFKDGNGQEYGNFGG  352

Query  231  GNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGT  410
             N         I IDG  E+LT I+G +G +      V+ S+ F TN+   GP+G   GT
Sbjct  353  NNANDTGEERRIEIDGLSEHLTSITGTYGNY--AGMVVITSLSFITNLTTHGPFGTATGT  410

Query  411  PFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             F+   + G+ ++GF GR G Y+DAIG +
Sbjct  411  SFSIPIE-GSVVIGFHGRGGHYLDAIGIH  438



>gb|EYU45162.1| hypothetical protein MIMGU_mgv1a025414mg, partial [Erythranthe 
guttata]
Length=333

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 81/154 (53%), Gaps = 9/154 (6%)
 Frame = +3

Query  36   MAISTDVAYGPLGHNGGDFWSFRPMNKIDQiiilsggsgnnnpigiTFSSTNKDGSKDCL  215
            M    +++ GP G  GG  +S++  + I QI+++   +   + +    S +  + SK   
Sbjct  4    MVCDGEISIGPFGGPGGTAFSYKAKHAIKQIVVVCSKNNVESIMFKGDSGSTSEYSK---  60

Query  216  TIGGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYG  395
            T GG  N    IR D INID   ++LT +SG +G         ++S+KF T +  +GP+G
Sbjct  61   TFGGAFNSG--IRTDKINIDFPLDFLTGVSGTYGSPGQMY---MQSLKFHTKLTEYGPFG  115

Query  396  PNVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
               GT F+F+   G+ I GF GRAG  +D IG Y
Sbjct  116  NTTGTSFSFRPI-GSLITGFHGRAGGCIDCIGFY  148


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +3

Query  246  VIRNDTINIDGADEYLTEISGAFGRF--IDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFN  419
            +++   I++DG  EYL  I G  G    I     V+RS+ F TN   +GP G  +GT F 
Sbjct  245  IVKKIEIDVDGG-EYLVGIEGFHGPIEGITGGVSVMRSITFHTNKFKYGPSGNEIGTFFT  303

Query  420  FQAQDGAKIVGFFGRAGFYVDAIGTYN  500
                   KIVGFFG++G Y+ AIG +N
Sbjct  304  SSKGCDGKIVGFFGKSGAYLSAIGVHN  330



>ref|XP_006838705.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
 gb|ERN01274.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
Length=610

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 52/82 (63%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            + D + ++  +E LT +SG +G        ++RS+ F TN++ +GP+G   GT F+F   
Sbjct  70   KTDKVKLEYPEEVLTWLSGHYGPMSSGCPTIIRSLTFQTNLKKYGPFGVQQGTHFSF-TM  128

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
             G K+VGF GR+G+++D+IG +
Sbjct  129  SGGKVVGFHGRSGWHLDSIGLH  150


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 54/93 (58%), Gaps = 6/93 (6%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFI-DTRFDVLRSVKFTTNVRAFGPYGP  398
            GG G ETT      I  +  +E LT I+G +G    D R +V++S+ F T+   +GPYG 
Sbjct  501  GGRGGETT----HRIKFEYPNEVLTCITGYYGAVARDDRLEVIKSLTFCTSRGKYGPYGE  556

Query  399  NVGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             +GT F     +G K+VGF GR+G Y+ AIG +
Sbjct  557  ELGTYFTSNRTEG-KVVGFHGRSGSYLYAIGVH  588


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (59%), Gaps = 1/82 (1%)
 Frame = +3

Query  252  RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
            ++D +  D   E LT I+G +G        V++S+ F T    +GPYG   G  F+ Q+ 
Sbjct  310  KSDKVVFDYPFEILTYITGNYGAAFLMGPMVIKSLTFHTTKGQYGPYGDQQGMSFSSQSV  369

Query  432  DGAKIVGFFGRAGFYVDAIGTY  497
             G +IVGF GR+G+Y+DAIG +
Sbjct  370  AG-RIVGFHGRSGWYLDAIGVH  390



>gb|KDP40814.1| hypothetical protein JCGZ_24813 [Jatropha curcas]
Length=203

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +3

Query  264  INIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQDGAK  443
            I +   +E+L   SG +   +     V+RS+   +N R FGPYG   GTPF   + DG  
Sbjct  80   IKLQYPEEFLVSASGHYCPVVYGGSPVIRSLTLKSNRRTFGPYGVEEGTPFTL-SMDGGS  138

Query  444  IVGFFGRAGFYVDAIG  491
            IVGF GR+G+Y+D+IG
Sbjct  139  IVGFMGRSGWYLDSIG  154



>ref|XP_011028924.1| PREDICTED: uncharacterized protein LOC105128794 isoform X2 [Populus 
euphratica]
Length=1277

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 7/92 (8%)
 Frame = +3

Query  222  GGGGNETTVIRNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPN  401
            G GG +TTV       +D  DE+LT + G +G         +RS+ F +N + +GP+G  
Sbjct  698  GNGGMKTTV------KLDCPDEFLTSVHGYYGSLDGWGPVFVRSLTFRSNKKTYGPFGVE  751

Query  402  VGTPFNFQAQDGAKIVGFFGRAGFYVDAIGTY  497
             GT F+     G KIVGF G++G+Y+DAIG Y
Sbjct  752  QGTYFSL-PMSGGKIVGFHGKSGWYLDAIGIY  782


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +3

Query  252   RNDTINIDGADEYLTEISGAFGRFIDTRFDVLRSVKFTTNVRAFGPYGPNVGTPFNFQAQ  431
             ++D I  D   E LT ++G +G  +    ++++S+ F TN    GP+G   G  F  +  
Sbjct  978   KSDKIIFDYPYEILTRVTGTYGPLMYMGPNIIKSLTFYTNKGKHGPFGEEQGPTFTNKID  1037

Query  432   DGAKIVGFFGRAGFYVDAIGTY  497
             +G KI+GF GR GF +DAIG +
Sbjct  1038  EG-KIIGFHGREGFLLDAIGLH  1058



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750