BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN034K11

Length=590
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798339.1|  PREDICTED: probable low-specificity L-threon...    174   3e-49   Nicotiana sylvestris
ref|XP_009631531.1|  PREDICTED: probable low-specificity L-threon...    171   6e-48   
emb|CDO99988.1|  unnamed protein product                                169   3e-47   Coffea canephora [robusta coffee]
ref|NP_001275261.1|  L-allo-threonine aldolase-related protein          162   3e-44   Solanum tuberosum [potatoes]
ref|XP_006361420.1|  PREDICTED: uncharacterized protein R102.4 is...    161   3e-44   Solanum tuberosum [potatoes]
ref|XP_004236787.1|  PREDICTED: probable low-specificity L-threon...    161   4e-44   Solanum lycopersicum
ref|XP_010319280.1|  PREDICTED: probable low-specificity L-threon...    161   4e-44   Solanum lycopersicum
emb|CBI22386.3|  unnamed protein product                                157   1e-42   Vitis vinifera
ref|XP_002266992.1|  PREDICTED: probable low-specificity L-threon...    157   1e-42   Vitis vinifera
ref|XP_009795458.1|  PREDICTED: probable low-specificity L-threon...    155   1e-41   Nicotiana sylvestris
ref|XP_007030420.1|  Threonine aldolase 1 isoform 1                     153   4e-41   
ref|XP_011101617.1|  PREDICTED: probable low-specificity L-threon...    152   8e-41   Sesamum indicum [beniseed]
ref|XP_007030422.1|  Threonine aldolase 1 isoform 3                     152   1e-40   
gb|AFK42511.1|  unknown                                                 144   4e-40   Lotus japonicus
ref|XP_002521974.1|  l-allo-threonine aldolase, putative                148   4e-39   Ricinus communis
gb|KCW61508.1|  hypothetical protein EUGRSUZ_H04236                     148   5e-39   Eucalyptus grandis [rose gum]
ref|XP_010024956.1|  PREDICTED: probable low-specificity L-threon...    148   5e-39   
ref|XP_004494746.1|  PREDICTED: L-allo-threonine aldolase-like is...    145   6e-38   Cicer arietinum [garbanzo]
ref|XP_007030424.1|  Threonine aldolase 1 isoform 5                     144   1e-37   
ref|XP_003521772.1|  PREDICTED: uncharacterized protein R102.4-li...    144   2e-37   Glycine max [soybeans]
gb|AFK43649.1|  unknown                                                 143   3e-37   Lotus japonicus
gb|KCW61511.1|  hypothetical protein EUGRSUZ_H04236                     142   8e-37   Eucalyptus grandis [rose gum]
gb|EYU19887.1|  hypothetical protein MIMGU_mgv1a008896mg                142   9e-37   Erythranthe guttata [common monkey flower]
gb|KJB82283.1|  hypothetical protein B456_013G187300                    139   8e-36   Gossypium raimondii
ref|XP_006577318.1|  PREDICTED: uncharacterized protein R102.4-li...    139   1e-35   Glycine max [soybeans]
ref|XP_002325334.2|  L-allo-threonine aldolase-related family pro...    138   2e-35   Populus trichocarpa [western balsam poplar]
gb|KDP23711.1|  hypothetical protein JCGZ_23544                         138   2e-35   Jatropha curcas
gb|KJB44860.1|  hypothetical protein B456_007G276400                    138   2e-35   Gossypium raimondii
ref|XP_011036295.1|  PREDICTED: probable low-specificity L-threon...    137   3e-35   Populus euphratica
gb|KJB44862.1|  hypothetical protein B456_007G276400                    138   3e-35   Gossypium raimondii
gb|KJB46043.1|  hypothetical protein B456_007G345500                    137   4e-35   Gossypium raimondii
gb|KJB44861.1|  hypothetical protein B456_007G276400                    138   4e-35   Gossypium raimondii
gb|AFK40044.1|  unknown                                                 137   5e-35   Medicago truncatula
gb|KEH24599.1|  L-allo-threonine aldolase-like protein                  137   5e-35   Medicago truncatula
ref|XP_007147215.1|  hypothetical protein PHAVU_006G105400g             137   6e-35   Phaseolus vulgaris [French bean]
gb|KHG25609.1|  L-allo-threonine aldolase                               137   7e-35   Gossypium arboreum [tree cotton]
ref|XP_002319106.2|  L-allo-threonine aldolase-related family pro...    136   9e-35   
ref|XP_010102233.1|  L-allo-threonine aldolase                          136   1e-34   Morus notabilis
gb|KHN04944.1|  L-allo-threonine aldolase                               136   1e-34   Glycine soja [wild soybean]
ref|XP_009364444.1|  PREDICTED: probable low-specificity L-threon...    135   3e-34   Pyrus x bretschneideri [bai li]
gb|ACJ83727.1|  unknown                                                 127   8e-34   Medicago truncatula
ref|XP_008388714.1|  PREDICTED: probable low-specificity L-threon...    134   8e-34   
ref|XP_011038517.1|  PREDICTED: LOW QUALITY PROTEIN: probable low...    134   8e-34   Populus euphratica
ref|XP_008388713.1|  PREDICTED: probable low-specificity L-threon...    134   9e-34   
ref|XP_008218319.1|  PREDICTED: probable low-specificity L-threon...    134   9e-34   Prunus mume [ume]
ref|XP_006577317.1|  PREDICTED: uncharacterized protein R102.4-li...    134   1e-33   Glycine max [soybeans]
gb|KJB46045.1|  hypothetical protein B456_007G345500                    133   2e-33   Gossypium raimondii
ref|XP_004170828.1|  PREDICTED: L-allo-threonine aldolase-like          133   2e-33   
ref|XP_003556456.2|  PREDICTED: uncharacterized protein R102.4-li...    134   2e-33   
ref|XP_008456444.1|  PREDICTED: probable low-specificity L-threon...    132   3e-33   Cucumis melo [Oriental melon]
ref|XP_010262337.1|  PREDICTED: probable low-specificity L-threon...    132   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010262335.1|  PREDICTED: probable low-specificity L-threon...    132   4e-33   Nelumbo nucifera [Indian lotus]
gb|KDO44520.1|  hypothetical protein CISIN_1g0182431mg                  127   4e-33   Citrus sinensis [apfelsine]
ref|XP_010694951.1|  PREDICTED: probable low-specificity L-threon...    132   4e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004139254.1|  PREDICTED: L-allo-threonine aldolase-like          131   6e-33   Cucumis sativus [cucumbers]
ref|XP_006606453.1|  PREDICTED: uncharacterized protein R102.4-li...    131   1e-32   
ref|XP_006606452.1|  PREDICTED: uncharacterized protein R102.4-li...    131   1e-32   
ref|XP_011465993.1|  PREDICTED: probable low-specificity L-threon...    130   1e-32   Fragaria vesca subsp. vesca
ref|XP_006606451.1|  PREDICTED: uncharacterized protein R102.4-li...    131   2e-32   
ref|XP_006417664.1|  hypothetical protein EUTSA_v10008026mg             130   2e-32   Eutrema salsugineum [saltwater cress]
gb|ADI24921.1|  L-allo-threonine aldolase                               130   3e-32   Carica papaya [mamon]
emb|CDX93548.1|  BnaA06g05000D                                          130   3e-32   
ref|XP_010246795.1|  PREDICTED: probable low-specificity L-threon...    129   3e-32   Nelumbo nucifera [Indian lotus]
ref|XP_009148115.1|  PREDICTED: probable low-specificity L-threon...    129   4e-32   Brassica rapa
ref|XP_007205422.1|  hypothetical protein PRUPE_ppa007684mg             129   5e-32   Prunus persica
emb|CDX95045.1|  BnaC05g06260D                                          128   1e-31   
ref|XP_006487715.1|  PREDICTED: uncharacterized protein R102.4-li...    128   1e-31   Citrus sinensis [apfelsine]
ref|XP_003590971.1|  L-allo-threonine aldolase                          127   1e-31   
gb|AES61221.2|  L-allo-threonine aldolase-like protein                  127   2e-31   Medicago truncatula
gb|AFK38526.1|  unknown                                                 128   2e-31   Medicago truncatula
ref|XP_003590972.1|  L-allo-threonine aldolase                          127   2e-31   Medicago truncatula
ref|XP_009118358.1|  PREDICTED: probable low-specificity L-threon...    127   2e-31   
emb|CDY06323.1|  BnaA09g48800D                                          127   2e-31   
ref|XP_010906811.1|  PREDICTED: probable low-specificity L-threon...    127   2e-31   
ref|XP_003590973.1|  L-allo-threonine aldolase                          127   2e-31   
ref|XP_006442676.1|  hypothetical protein CICLE_v10020798mg             127   2e-31   Citrus clementina [clementine]
ref|XP_010906812.1|  PREDICTED: probable low-specificity L-threon...    127   2e-31   Elaeis guineensis
ref|XP_010906810.1|  PREDICTED: probable low-specificity L-threon...    127   3e-31   
ref|XP_010906809.1|  PREDICTED: probable low-specificity L-threon...    127   3e-31   
gb|ACJ85157.1|  unknown                                                 127   3e-31   Medicago truncatula
ref|XP_004495577.1|  PREDICTED: L-allo-threonine aldolase-like is...    126   6e-31   Cicer arietinum [garbanzo]
ref|XP_004495576.1|  PREDICTED: L-allo-threonine aldolase-like is...    126   7e-31   Cicer arietinum [garbanzo]
emb|CDY22672.1|  BnaC08g43060D                                          125   1e-30   Brassica napus [oilseed rape]
ref|XP_007144017.1|  hypothetical protein PHAVU_007G122200g             125   1e-30   Phaseolus vulgaris [French bean]
ref|XP_010489194.1|  PREDICTED: probable low-specificity L-threon...    125   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010475669.1|  PREDICTED: probable low-specificity L-threon...    124   2e-30   Camelina sativa [gold-of-pleasure]
ref|NP_566228.1|  threonine aldolase 2                                  124   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305180.1|  hypothetical protein CARUB_v10009546mg             124   3e-30   Capsella rubella
ref|XP_006408182.1|  hypothetical protein EUTSA_v10021036mg             124   3e-30   Eutrema salsugineum [saltwater cress]
ref|XP_003590970.1|  L-allo-threonine aldolase                          125   4e-30   
ref|XP_009123981.1|  PREDICTED: probable low-specificity L-threon...    123   6e-30   Brassica rapa
ref|XP_010553776.1|  PREDICTED: probable low-specificity L-threon...    122   1e-29   Tarenaya hassleriana [spider flower]
ref|XP_010553775.1|  PREDICTED: probable low-specificity L-threon...    122   1e-29   Tarenaya hassleriana [spider flower]
emb|CDY42933.1|  BnaC05g47180D                                          122   1e-29   Brassica napus [oilseed rape]
emb|CDY49330.1|  BnaA05g32920D                                          122   1e-29   Brassica napus [oilseed rape]
ref|XP_002884450.1|  hypothetical protein ARALYDRAFT_896488             122   2e-29   Arabidopsis lyrata subsp. lyrata
tpg|DAA36971.1|  TPA: putative threonine aldolase family protein ...    122   3e-29   
gb|KGN66766.1|  hypothetical protein Csa_1G681120                       116   3e-29   Cucumis sativus [cucumbers]
ref|XP_010415759.1|  PREDICTED: probable low-specificity L-threon...    121   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006298023.1|  hypothetical protein CARUB_v10014068mg             121   3e-29   Capsella rubella
ref|XP_008661960.1|  PREDICTED: L-allo-threonine aldolase isoform X1    121   4e-29   
gb|ACG34432.1|  L-allo-threonine aldolase                               121   4e-29   Zea mays [maize]
ref|XP_010458106.1|  PREDICTED: probable low-specificity L-threon...    120   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010463930.1|  PREDICTED: probable low-specificity L-threon...    120   7e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008443794.1|  PREDICTED: probable low-specificity L-threon...    120   8e-29   
ref|XP_008802139.1|  PREDICTED: probable low-specificity L-threon...    120   1e-28   Phoenix dactylifera
emb|CDY31134.1|  BnaA08g26840D                                          120   1e-28   Brassica napus [oilseed rape]
ref|XP_009110878.1|  PREDICTED: probable low-specificity L-threon...    120   1e-28   Brassica rapa
ref|XP_010485829.1|  PREDICTED: probable low-specificity L-threon...    120   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_003580135.1|  PREDICTED: probable low-specificity L-threon...    119   2e-28   Brachypodium distachyon [annual false brome]
ref|XP_002448187.1|  hypothetical protein SORBIDRAFT_06g022630          119   2e-28   Sorghum bicolor [broomcorn]
dbj|BAK03835.1|  predicted protein                                      118   4e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF86035.1|  unknown                                                 116   5e-28   Zea mays [maize]
gb|AAM63785.1|  unknown                                                 118   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189807.1|  threonine aldolase 2                               118   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563822.1|  threonine aldolase                                    117   8e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CAE05443.2|  OSJNBa0073E02.3                                        117   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053314.1|  Os04g0516600                                       117   1e-27   
ref|XP_008453666.1|  PREDICTED: probable low-specificity L-threon...    117   1e-27   Cucumis melo [Oriental melon]
ref|XP_008453667.1|  PREDICTED: probable low-specificity L-threon...    117   1e-27   Cucumis melo [Oriental melon]
tpg|DAA45471.1|  TPA: hypothetical protein ZEAMMB73_239903              113   2e-27   
ref|XP_002892465.1|  hypothetical protein ARALYDRAFT_470930             116   2e-27   
ref|NP_001241763.1|  L-allo-threonine aldolase                          116   3e-27   
ref|XP_008655940.1|  PREDICTED: probable low-specificity L-threon...    113   3e-27   
ref|NP_001149239.1|  L-allo-threonine aldolase                          116   3e-27   Zea mays [maize]
ref|XP_008655935.1|  PREDICTED: probable low-specificity L-threon...    113   4e-27   
ref|XP_008667491.1|  PREDICTED: putative threonine aldolase famil...    115   5e-27   
ref|NP_001242307.1|  uncharacterized protein LOC100790890               115   5e-27   
ref|XP_006588445.1|  PREDICTED: uncharacterized protein LOC100790...    115   6e-27   Glycine max [soybeans]
gb|EMS67121.1|  L-allo-threonine aldolase                               115   7e-27   Triticum urartu
ref|XP_004155692.1|  PREDICTED: L-allo-threonine aldolase-like          114   9e-27   
ref|XP_009389078.1|  PREDICTED: probable low-specificity L-threon...    114   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS52584.1|  L-allo-threonine aldolase                               114   1e-26   Triticum urartu
ref|XP_007030423.1|  L-allo-threonine aldolase isoform 4                114   1e-26   
gb|AAF63783.1|  L-allo-threonine aldolase, putative                     114   1e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDY54493.1|  BnaCnng27100D                                          113   2e-26   Brassica napus [oilseed rape]
ref|XP_010906817.1|  PREDICTED: probable low-specificity L-threon...    113   2e-26   Elaeis guineensis
ref|XP_010906814.1|  PREDICTED: probable low-specificity L-threon...    113   3e-26   Elaeis guineensis
dbj|BAJ93201.1|  predicted protein                                      113   4e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004142582.1|  PREDICTED: L-allo-threonine aldolase-like          112   5e-26   
ref|XP_006857300.1|  hypothetical protein AMTR_s00067p00056150          112   5e-26   Amborella trichopoda
ref|XP_006652519.1|  PREDICTED: uncharacterized protein R102.4-like     112   9e-26   Oryza brachyantha
ref|XP_008802138.1|  PREDICTED: probable low-specificity L-threon...    111   1e-25   Phoenix dactylifera
ref|XP_004976222.1|  PREDICTED: uncharacterized protein R102.4-like     111   2e-25   Setaria italica
ref|XP_008667492.1|  PREDICTED: putative threonine aldolase famil...    110   3e-25   Zea mays [maize]
gb|AAF99780.1|AC003981_30  F22O13.11                                    106   9e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KHG00003.1|  ltaA                                                    104   4e-23   Gossypium arboreum [tree cotton]
gb|ABR18450.1|  unknown                                                 104   4e-23   Picea sitchensis
ref|XP_004976228.1|  PREDICTED: uncharacterized protein R102.4-li...    104   4e-23   Setaria italica
gb|KHG00004.1|  ltaA                                                    104   5e-23   Gossypium arboreum [tree cotton]
gb|EPS60604.1|  hypothetical protein M569_14199                         103   5e-23   Genlisea aurea
ref|XP_006605267.1|  PREDICTED: uncharacterized protein LOC102668529  99.0    1e-22   
gb|KJB44863.1|  hypothetical protein B456_007G276400                  98.6    4e-21   Gossypium raimondii
ref|XP_004976227.1|  PREDICTED: uncharacterized protein R102.4-li...  98.6    5e-21   
ref|XP_008802141.1|  PREDICTED: probable low-specificity L-threon...  95.1    7e-20   
ref|XP_010520652.1|  PREDICTED: probable low-specificity L-threon...  94.4    2e-19   Tarenaya hassleriana [spider flower]
ref|WP_020877756.1|  aromatic amino acid beta-eliminating lyase/t...  92.8    5e-19   Desulfococcus multivorans
ref|NP_001077492.1|  threonine aldolase                               92.4    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001768407.1|  predicted protein                                92.4    8e-19   
emb|CDY59150.1|  BnaC08g13650D                                        90.1    1e-17   Brassica napus [oilseed rape]
ref|WP_011697570.1|  threonine aldolase                               87.8    3e-17   Syntrophobacter fumaroxidans
ref|XP_008453668.1|  PREDICTED: probable low-specificity L-threon...  87.4    5e-17   Cucumis melo [Oriental melon]
ref|XP_004976226.1|  PREDICTED: uncharacterized protein R102.4-like   85.1    2e-16   Setaria italica
ref|WP_027408853.1|  threonine aldolase                               85.5    2e-16   Anoxybacillus tepidamans
dbj|BAK01917.1|  predicted protein                                    84.3    4e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002975719.1|  hypothetical protein SELMODRAFT_103881           84.3    5e-16   
ref|XP_002973664.1|  hypothetical protein SELMODRAFT_99781            84.3    5e-16   
ref|XP_008655946.1|  PREDICTED: probable low-specificity L-threon...  82.4    7e-16   
gb|KGN66765.1|  hypothetical protein Csa_1G680120                     83.2    1e-15   Cucumis sativus [cucumbers]
ref|XP_005854754.1|  threonine aldolase                               82.8    1e-15   Nannochloropsis gaditana CCMP526
tpg|DAA45470.1|  TPA: hypothetical protein ZEAMMB73_239903            84.0    2e-15   
ref|XP_004170415.1|  PREDICTED: L-allo-threonine aldolase-like        82.0    2e-15   
gb|EEG77367.1|  Threonine aldolase                                    81.6    3e-15   Dethiobacter alkaliphilus AHT 1
ref|WP_040378796.1|  threonine aldolase                               81.6    4e-15   
ref|WP_018706849.1|  hypothetical protein                             81.6    4e-15   Bacillus fordii
ref|WP_026677955.1|  threonine aldolase                               81.3    5e-15   Fictibacillus gelatini
ref|XP_007030425.1|  Threonine aldolase 1 isoform 6                   81.3    5e-15   
ref|XP_008675991.1|  PREDICTED: probable low-specificity L-threon...  79.0    7e-15   
ref|NP_001140767.1|  putative threonine aldolase family protein       80.5    7e-15   
ref|WP_009609982.1|  threonine aldolase                               80.9    8e-15   Caldanaerobacter subterraneus
ref|WP_011024735.1|  threonine aldolase                               80.9    9e-15   Caldanaerobacter subterraneus
ref|XP_008657658.1|  PREDICTED: probable low-specificity L-threon...  79.0    1e-14   Zea mays [maize]
gb|EWM22625.1|  threonine aldolase                                    82.4    1e-14   Nannochloropsis gaditana
gb|KIG16688.1|  Low-specificity L-threonine aldolase                  80.1    2e-14   Enhygromyxa salina
gb|EGU57937.1|  L-allo-threonine aldolase                             77.8    2e-14   Vibrio nigripulchritudo ATCC 27043
ref|WP_014394185.1|  threonine aldolase                               79.3    2e-14   Corallococcus coralloides
ref|WP_038146243.1|  threonine aldolase                               77.4    3e-14   
ref|WP_027877883.1|  threonine aldolase                               79.3    3e-14   Meiothermus cerbereus
ref|WP_037564212.1|  threonine aldolase                               79.3    3e-14   Alkalispirochaeta odontotermitis
ref|WP_014645330.1|  threonine aldolase                               79.0    3e-14   Halobacillus halophilus
ref|WP_027883536.1|  threonine aldolase                               79.0    3e-14   Meiothermus rufus
ref|XP_008671569.1|  PREDICTED: probable low-specificity L-threon...  78.2    4e-14   Zea mays [maize]
ref|WP_011551549.1|  threonine aldolase                               79.0    4e-14   Myxococcus xanthus
ref|WP_014100459.1|  threonine aldolase                               79.0    4e-14   Chloracidobacterium thermophilum
ref|WP_013296780.1|  threonine aldolase                               78.6    5e-14   Thermoanaerobacterium thermosaccharolyticum
ref|WP_015310760.1|  threonine aldolase                               78.6    6e-14   Thermoanaerobacterium thermosaccharolyticum
ref|WP_034427809.1|  threonine aldolase                               78.6    6e-14   
dbj|GAL33596.1|  low-specificity L-threonine aldolase                 75.1    6e-14   Vibrio maritimus
ref|WP_024050701.1|  hypothetical protein                             78.2    7e-14   Meiothermus ruber
ref|WP_014062139.1|  threonine aldolase                               78.2    7e-14   Thermoanaerobacter wiegelii
ref|WP_025322967.1|  threonine aldolase                               78.2    8e-14   
ref|WP_004400281.1|  MULTISPECIES: Threonine aldolase                 78.2    8e-14   Thermoanaerobacter
ref|WP_034132280.1|  threonine aldolase                               77.8    9e-14   
ref|XP_008671685.1|  PREDICTED: uncharacterized protein LOC103649121  78.6    9e-14   
ref|WP_022597498.1|  Low specificity L-threonine aldolase             77.4    1e-13   Vibrio nigripulchritudo
ref|WP_027888175.1|  MULTISPECIES: threonine aldolase                 77.4    1e-13   Meiothermus
ref|WP_020265088.1|  hypothetical protein                             77.4    1e-13   
ref|WP_022601443.1|  Low specificity L-threonine aldolase             77.4    1e-13   Vibrio nigripulchritudo
ref|WP_022592526.1|  Low specificity L-threonine aldolase             77.0    1e-13   Vibrio nigripulchritudo
ref|WP_022561270.1|  Low specificity L-threonine aldolase             77.0    1e-13   Vibrio nigripulchritudo
ref|WP_025229058.1|  threonine aldolase                               77.4    1e-13   Fimbriimonas ginsengisoli
ref|WP_026475800.1|  threonine aldolase                               77.0    2e-13   Alkaliphilus transvaalensis
ref|WP_002635500.1|  threonine aldolase                               77.0    2e-13   Myxococcus hansupus
ref|WP_012269711.1|  MULTISPECIES: threonine aldolase                 76.6    2e-13   Thermoanaerobacter
ref|WP_003867083.1|  MULTISPECIES: threonine aldolase                 76.3    3e-13   Thermoanaerobacter
ref|WP_011196526.1|  threonine aldolase                               76.3    3e-13   Symbiobacterium thermophilum
ref|WP_029688227.1|  threonine aldolase                               76.3    3e-13   
ref|WP_038083758.1|  threonine aldolase                               76.3    4e-13   Tumebacillus flagellatus
ref|WP_027448368.1|  threonine aldolase                               76.3    4e-13   Pontibacillus marinus
ref|WP_013935419.1|  threonine aldolase                               75.9    5e-13   Myxococcus macrosporus
ref|WP_008216429.1|  threonine aldolase                               75.9    5e-13   Vibrionales bacterium SWAT-3
ref|WP_013778623.1|  threonine aldolase                               75.1    8e-13   Tepidanaerobacter acetatoxydans
ref|WP_003869086.1|  threonine aldolase                               75.1    8e-13   
ref|WP_013705006.1|  threonine aldolase                               75.1    8e-13   Marinithermus hydrothermalis
ref|WP_017109562.1|  threonine aldolase                               75.1    8e-13   Vibrio
ref|WP_017067124.1|  threonine aldolase                               75.1    9e-13   Vibrio crassostreae
ref|WP_039929082.1|  threonine aldolase                               75.1    9e-13   Thermoanaerobacter
gb|EIV99346.1|  threonine aldolase                                    75.1    1e-12   Thermoanaerobacter siderophilus SR4
ref|WP_038227001.1|  threonine aldolase                               74.7    1e-12   Vibrio sp. ER1A
ref|WP_004740139.1|  threonine aldolase                               74.7    1e-12   Vibrio splendidus
ref|WP_013015285.1|  threonine aldolase                               74.7    1e-12   Meiothermus ruber
ref|WP_013275483.1|  threonine aldolase                               74.7    1e-12   Thermosediminibacter oceani
gb|ETX05065.1|  threonine aldolase                                    74.7    1e-12   Candidatus Entotheonella gemina
ref|WP_042834178.1|  threonine aldolase                               74.7    1e-12   Thermoanaerobacter sp. YS13
ref|WP_018133494.1|  hypothetical protein                             74.7    1e-12   Effusibacillus pohliae
ref|WP_038960521.1|  threonine aldolase                               74.3    2e-12   
ref|WP_003540689.1|  threonine aldolase                               73.9    2e-12   Desulfotomaculum nigrificans
ref|WP_002629188.1|  Low-specificity L-threonine aldolase             73.9    2e-12   Cystobacter fuscus
ref|WP_031792098.1|  hypothetical protein                             70.9    2e-12   
ref|WP_033406166.1|  hypothetical protein                             73.9    2e-12   
dbj|GAL27114.1|  low-specificity L-threonine aldolase                 72.0    3e-12   Vibrio variabilis
ref|WP_000854011.1|  threonine aldolase                               73.6    3e-12   Bacillus thuringiensis
ref|WP_035698102.1|  threonine aldolase                               72.0    3e-12   
ref|WP_029955476.1|  threonine aldolase                               72.0    3e-12   
dbj|GAK82526.1|  low-specificity L-threonine aldolase                 71.6    3e-12   Vibrio ponticus
ref|WP_017104708.1|  threonine aldolase                               73.6    3e-12   Vibrio
ref|WP_042470320.1|  threonine aldolase                               73.2    3e-12   
gb|AIE93607.1|  Beta-eliminating lyase superfamily protein (ltaE)     73.6    3e-12   uncultured marine group II/III euryarchaeote AD1000_39_C05
ref|WP_041274354.1|  threonine aldolase                               73.2    4e-12   
gb|ABO48655.1|  L-threonine aldolase                                  73.2    4e-12   Desulfotomaculum reducens MI-1
ref|WP_031408953.1|  threonine aldolase                               73.2    4e-12   Geobacillus vulcani
ref|WP_039015891.1|  threonine aldolase                               73.2    4e-12   
ref|WP_041887564.1|  threonine aldolase                               73.2    4e-12   
dbj|GAJ99891.1|  LOW QUALITY PROTEIN: low-specificity L-threonine...  72.8    4e-12   Geomicrobium sp. JCM 19055
ref|WP_022934098.1|  threonine aldolase                               72.8    5e-12   
ref|WP_029710900.1|  MULTISPECIES: threonine aldolase                 71.2    5e-12   
ref|WP_017086880.1|  threonine aldolase                               72.8    5e-12   Vibrio splendidus
ref|WP_034217358.1|  threonine aldolase                               72.8    6e-12   
ref|WP_017070585.1|  threonine aldolase                               72.4    6e-12   Vibrio crassostreae
emb|CAN82414.1|  hypothetical protein VITISV_039151                   73.2    6e-12   Vitis vinifera
ref|WP_017058210.1|  threonine aldolase                               72.4    6e-12   Vibrio kanaloae
ref|WP_017064540.1|  threonine aldolase                               72.4    6e-12   Vibrio crassostreae
ref|WP_019822304.1|  threonine aldolase                               72.4    7e-12   Vibrio splendidus
emb|CEG01512.1|  Aromatic amino acid beta-eliminating lyase/threo...  72.8    7e-12   Ostreococcus tauri
ref|WP_017078726.1|  threonine aldolase                               72.4    7e-12   Vibrio splendidus
ref|WP_006827009.1|  threonine aldolase                               72.4    8e-12   Natrialba taiwanensis
ref|WP_034421730.1|  threonine aldolase                               72.4    8e-12   Clostridiales bacterium DRI-13
ref|WP_017095444.1|  threonine aldolase                               72.0    9e-12   Vibrio splendidus
ref|WP_006714392.1|  threonine aldolase                               72.0    9e-12   Vibrio ichthyoenteri
ref|WP_017062565.1|  threonine aldolase                               72.0    9e-12   Vibrio crassostreae
ref|WP_027415105.1|  threonine aldolase                               72.4    9e-12   Aneurinibacillus terranovensis
gb|EVU16683.1|  L-allo-threonine aldolase                             70.1    9e-12   Vibrio parahaemolyticus V-223/04
ref|XP_003080829.1|  L-allo-threonine aldolase, putative (ISS)        72.8    1e-11   
ref|WP_044351028.1|  threonine aldolase                               72.0    1e-11   Dethiosulfatarculus sandiegensis
ref|WP_017632336.1|  threonine aldolase                               72.0    1e-11   Vibrio sp. 624788
ref|WP_019178138.1|  hypothetical protein                             72.0    1e-11   Methanomassiliicoccus luminyensis
ref|WP_036199434.1|  threonine aldolase                               72.0    1e-11   Meiothermus ruber
ref|WP_042501630.1|  threonine aldolase                               72.0    1e-11   
ref|WP_010678507.1|  threonine aldolase                               72.0    1e-11   Bacillus timonensis
gb|ADU51350.1|  L-threonine aldolase                                  72.0    1e-11   
ref|WP_017102851.1|  threonine aldolase                               72.0    1e-11   
ref|WP_017076025.1|  threonine aldolase                               71.6    1e-11   
ref|WP_016566240.1|  l-allo-threonine aldolase                        72.0    1e-11   
ref|WP_009385056.1|  threonine aldolase                               71.6    1e-11   
ref|WP_017089379.1|  threonine aldolase                               71.6    1e-11   
ref|WP_009845431.1|  MULTISPECIES: threonine aldolase                 71.6    1e-11   
ref|WP_044162565.1|  threonine aldolase                               71.6    1e-11   
ref|WP_017025760.1|  threonine aldolase                               71.6    2e-11   
ref|WP_027695975.1|  threonine aldolase                               71.2    2e-11   
ref|WP_038321350.1|  threonine aldolase                               71.2    2e-11   
ref|WP_041976323.1|  threonine aldolase                               71.2    2e-11   
ref|WP_016958887.1|  threonine aldolase                               71.2    2e-11   
ref|WP_017004902.1|  threonine aldolase                               71.2    2e-11   
ref|WP_038886197.1|  threonine aldolase                               71.2    2e-11   
gb|ETM34050.1|  hypothetical protein, variant                         70.1    2e-11   
gb|EQB62887.1|  Aromatic amino acid beta-eliminating lyase/threon...  71.2    2e-11   
ref|WP_004731185.1|  threonine aldolase                               71.2    2e-11   
ref|WP_029710921.1|  MULTISPECIES: threonine aldolase                 71.2    2e-11   
ref|WP_017006944.1|  threonine aldolase                               71.2    2e-11   
ref|WP_026444574.1|  threonine aldolase                               71.2    2e-11   
ref|WP_038899520.1|  threonine aldolase                               70.9    2e-11   
ref|WP_008074850.1|  threonine aldolase                               70.9    2e-11   
ref|XP_008897473.1|  hypothetical protein, variant                    69.7    2e-11   
gb|AIE92478.1|  threonine aldolase (ltaE)                             71.2    2e-11   
ref|WP_014757710.1|  MULTISPECIES: threonine aldolase                 70.9    2e-11   
ref|WP_006069652.1|  threonine aldolase                               70.9    2e-11   
ref|WP_041868473.1|  threonine aldolase                               71.2    3e-11   
ref|WP_013159535.1|  threonine aldolase                               70.9    3e-11   
ref|XP_006442684.1|  hypothetical protein CICLE_v10020798mg           70.5    3e-11   
ref|WP_005594507.1|  threonine aldolase                               70.9    3e-11   
ref|WP_013456865.1|  threonine aldolase                               70.9    3e-11   
ref|WP_010451642.1|  threonine aldolase                               70.9    3e-11   
ref|WP_015922826.1|  threonine aldolase                               70.9    3e-11   
gb|ETK74181.1|  hypothetical protein, variant                         69.7    3e-11   
ref|WP_019839219.1|  threonine aldolase                               70.9    3e-11   
ref|WP_034631722.1|  threonine aldolase                               70.9    3e-11   
ref|WP_031852043.1|  threonine aldolase                               70.9    3e-11   
ref|WP_012872806.1|  threonine aldolase                               70.9    3e-11   
ref|WP_017781663.1|  threonine aldolase                               70.9    3e-11   
ref|WP_017786172.1|  threonine aldolase                               70.9    3e-11   
ref|WP_004513587.1|  threonine aldolase                               70.9    3e-11   
ref|WP_006672298.1|  threonine aldolase                               70.9    3e-11   
ref|WP_005299873.1|  threonine aldolase                               70.9    3e-11   
ref|WP_017765885.1|  threonine aldolase                               70.9    3e-11   
ref|WP_010634262.1|  MULTISPECIES: L-allo-threonine aldolase          70.9    3e-11   
ref|WP_042050919.1|  L-allo-threonine aldolase                        70.9    3e-11   
ref|WP_018467711.1|  threonine aldolase                               70.5    3e-11   
dbj|BAL53180.1|  threonine aldolase                                   70.5    3e-11   
ref|WP_022611326.1|  Low specificity L-threonine aldolase             70.5    3e-11   
ref|WP_006904712.1|  threonine aldolase                               70.5    3e-11   
ref|WP_006643962.1|  threonine aldolase                               70.5    4e-11   
ref|WP_035551533.1|  threonine aldolase                               70.5    4e-11   
ref|WP_009793967.1|  MULTISPECIES: threonine aldolase                 70.5    4e-11   
ref|WP_038046898.1|  threonine aldolase                               70.5    4e-11   
ref|WP_013787005.1|  threonine aldolase                               70.5    4e-11   
ref|WP_025627548.1|  threonine aldolase                               70.1    4e-11   
ref|WP_006447171.1|  threonine aldolase                               70.5    5e-11   
dbj|GAK16991.1|  low-specificity L-threonine aldolase                 70.1    5e-11   
ref|WP_038559128.1|  threonine aldolase                               70.1    5e-11   
ref|WP_008412134.1|  L-allo-threonine aldolase                        70.1    5e-11   
ref|WP_025027486.1|  threonine aldolase                               70.1    5e-11   
gb|AIV07123.1|  threonine aldolase                                    70.1    5e-11   
ref|WP_027365759.1|  threonine aldolase                               70.1    5e-11   
ref|WP_028784440.1|  threonine aldolase                               70.1    5e-11   
ref|WP_034122282.1|  threonine aldolase                               70.1    5e-11   
ref|WP_039447431.1|  threonine aldolase                               70.1    5e-11   
ref|WP_042520986.1|  threonine aldolase                               70.1    5e-11   
ref|WP_005396402.1|  low-specificity L-threonine aldolase             70.1    5e-11   
ref|WP_011081042.1|  threonine aldolase                               70.1    5e-11   
ref|WP_024943462.1|  L-allo-threonine aldolase                        70.1    5e-11   
ref|WP_031820542.1|  threonine aldolase                               70.1    5e-11   
gb|EKM29605.1|  low specificity L-threonine aldolase                  70.1    5e-11   
ref|WP_038038638.1|  threonine aldolase                               70.1    5e-11   
ref|WP_009705325.1|  threonine aldolase                               69.7    6e-11   
gb|EPZ48130.1|  hypothetical protein N007_04560                       70.1    6e-11   
ref|WP_017069124.1|  threonine aldolase                               69.7    6e-11   
gb|ETM34049.1|  hypothetical protein L914_18796                       70.1    6e-11   
ref|WP_042008166.1|  L-allo-threonine aldolase                        69.7    6e-11   
ref|WP_039987426.1|  threonine aldolase                               69.7    6e-11   
ref|WP_010644227.1|  threonine aldolase                               69.7    6e-11   
gb|KEK21307.1|  threonine aldolase                                    70.1    6e-11   
ref|WP_034635021.1|  threonine aldolase                               70.1    6e-11   
ref|WP_031218345.1|  threonine aldolase                               70.1    6e-11   
ref|WP_038891255.1|  threonine aldolase                               69.7    6e-11   
ref|WP_029789292.1|  threonine aldolase                               69.7    6e-11   
ref|WP_009696116.1|  MULTISPECIES: threonine aldolase                 69.7    6e-11   
ref|WP_012129284.1|  threonine aldolase                               69.7    6e-11   
ref|WP_012957344.1|  threonine aldolase                               69.7    6e-11   
ref|WP_005446977.1|  L-allo-threonine aldolase                        69.7    7e-11   
ref|WP_005426721.1|  threonine aldolase                               69.7    7e-11   
ref|WP_039839175.1|  threonine aldolase                               69.7    7e-11   
ref|WP_005532104.1|  L-allo-threonine aldolase                        69.7    7e-11   
ref|WP_000347574.1|  threonine aldolase                               69.7    7e-11   
ref|WP_006648299.1|  threonine aldolase                               69.7    7e-11   
ref|XP_008897472.1|  hypothetical protein PPTG_05622                  69.7    7e-11   
ref|WP_017092987.1|  threonine aldolase                               69.3    8e-11   
ref|WP_030000032.1|  threonine aldolase                               69.3    8e-11   
ref|WP_035985324.1|  threonine aldolase                               69.7    8e-11   
ref|WP_013970093.1|  threonine aldolase                               69.7    8e-11   
gb|EAU69563.1|  L-allo-threonine aldolase                             68.9    8e-11   
ref|WP_042601515.1|  threonine aldolase                               69.3    8e-11   
ref|WP_031781926.1|  threonine aldolase                               69.3    8e-11   
ref|WP_017080978.1|  threonine aldolase                               69.3    8e-11   
ref|WP_025501069.1|  threonine aldolase                               69.3    8e-11   
ref|WP_025817565.1|  threonine aldolase                               69.3    8e-11   
ref|WP_025629171.1|  threonine aldolase                               69.3    8e-11   
ref|WP_005480299.1|  threonine aldolase                               69.3    8e-11   
ref|WP_021487072.1|  cys/Met metabolism PLP-dependent enzyme fami...  69.3    8e-11   
ref|WP_029802664.1|  threonine aldolase                               69.3    8e-11   
ref|WP_025794376.1|  threonine aldolase                               69.3    8e-11   
gb|EQL91328.1|  cys/Met metabolism PLP-dependent enzyme family pr...  69.3    8e-11   
ref|WP_031855575.1|  threonine aldolase                               69.3    9e-11   
ref|WP_025541936.1|  threonine aldolase                               69.3    9e-11   
ref|WP_005488643.1|  threonine aldolase                               69.3    9e-11   
ref|WP_025442802.1|  threonine aldolase                               69.3    9e-11   
ref|WP_025767724.1|  threonine aldolase                               69.3    9e-11   
ref|WP_025527060.1|  threonine aldolase                               69.3    9e-11   
ref|WP_005498988.1|  threonine aldolase                               69.3    9e-11   
ref|WP_029834682.1|  threonine aldolase                               69.3    9e-11   
ref|WP_029849857.1|  threonine aldolase                               69.3    9e-11   
ref|WP_025504468.1|  threonine aldolase                               69.3    9e-11   
ref|WP_020837928.1|  threonine aldolase                               69.3    9e-11   
ref|WP_025612068.1|  threonine aldolase                               69.3    9e-11   
ref|WP_025551796.1|  threonine aldolase                               69.3    9e-11   
ref|WP_044799803.1|  L-allo-threonine aldolase                        69.3    9e-11   
ref|WP_025557276.1|  threonine aldolase                               69.3    9e-11   
ref|WP_017302462.1|  hypothetical protein                             69.3    9e-11   
gb|ETK74180.1|  hypothetical protein L915_18981                       69.3    9e-11   
ref|WP_014234157.1|  threonine aldolase                               69.3    9e-11   
ref|WP_043933757.1|  threonine aldolase                               69.3    9e-11   
ref|WP_019852182.1|  threonine aldolase                               69.3    1e-10   
ref|WP_012843618.1|  threonine aldolase                               69.3    1e-10   
ref|WP_025521722.1|  threonine aldolase                               69.3    1e-10   
ref|WP_012063574.1|  threonine aldolase                               69.3    1e-10   
ref|WP_006665336.1|  threonine aldolase                               69.3    1e-10   
ref|WP_029822955.1|  threonine aldolase                               68.9    1e-10   
ref|WP_025624099.1|  threonine aldolase                               68.9    1e-10   
ref|WP_017820204.1|  threonine aldolase                               68.9    1e-10   
ref|WP_034107576.1|  threonine aldolase                               69.3    1e-10   
ref|WP_005375978.1|  MULTISPECIES: threonine aldolase                 68.9    1e-10   
ref|WP_000347573.1|  MULTISPECIES: threonine aldolase                 68.9    1e-10   
ref|WP_012842205.1|  threonine aldolase                               68.9    1e-10   
ref|WP_013034649.1|  threonine aldolase                               68.9    1e-10   
ref|WP_040992653.1|  MULTISPECIES: threonine aldolase                 68.9    1e-10   
gb|EGU19361.1|  L-allo-threonine aldolase                             68.9    1e-10   
ref|WP_025622487.1|  threonine aldolase                               68.9    1e-10   
ref|WP_014067260.1|  threonine aldolase                               68.9    1e-10   
gb|AGK52867.1|  threonine aldolase                                    68.9    1e-10   
ref|WP_038177305.1|  threonine aldolase                               68.9    1e-10   
ref|WP_041580936.1|  threonine aldolase                               68.9    1e-10   
ref|WP_042071615.1|  L-allo-threonine aldolase                        68.9    1e-10   
ref|WP_006092490.1|  threonine aldolase                               68.9    1e-10   
ref|WP_029301221.1|  L-allo-threonine aldolase                        68.9    1e-10   
ref|WP_043171927.1|  MULTISPECIES: L-allo-threonine aldolase          68.9    1e-10   
ref|WP_005584362.1|  L-allo-threonine aldolase                        68.9    1e-10   
ref|WP_029810303.1|  threonine aldolase                               68.9    1e-10   
ref|WP_028022675.1|  threonine aldolase                               68.9    1e-10   
gb|EOD01392.1|  Low-specificity L-threonine aldolase                  68.9    1e-10   
ref|WP_034429132.1|  threonine aldolase                               68.9    1e-10   
ref|WP_043045824.1|  threonine aldolase                               68.9    1e-10   
ref|WP_023623614.1|  threonine aldolase                               68.9    1e-10   
ref|WP_027891899.1|  threonine aldolase                               68.9    1e-10   
ref|WP_015049145.1|  threonine aldolase                               68.9    1e-10   
ref|WP_028777176.1|  threonine aldolase                               68.9    1e-10   
ref|WP_025610157.1|  threonine aldolase                               68.6    1e-10   
ref|WP_013375111.1|  threonine aldolase                               68.9    1e-10   
ref|WP_006182932.1|  threonine aldolase                               68.6    1e-10   
ref|WP_025574600.1|  threonine aldolase                               68.6    2e-10   
ref|WP_028794247.1|  threonine aldolase                               68.9    2e-10   
ref|XP_004151117.1|  PREDICTED: L-allo-threonine aldolase-like        68.2    2e-10   
ref|WP_000347575.1|  threonine aldolase                               68.6    2e-10   
ref|WP_010943783.1|  threonine aldolase                               68.6    2e-10   
ref|WP_029857109.1|  threonine aldolase                               68.6    2e-10   
ref|WP_043893263.1|  threonine aldolase                               68.6    2e-10   
ref|WP_031847875.1|  threonine aldolase                               68.6    2e-10   
ref|WP_025638678.1|  threonine aldolase                               68.6    2e-10   
ref|WP_017190808.1|  threonine aldolase                               68.6    2e-10   
ref|WP_029839720.1|  threonine aldolase                               68.6    2e-10   
ref|WP_025508963.1|  threonine aldolase                               68.6    2e-10   
ref|WP_043165668.1|  L-allo-threonine aldolase                        68.6    2e-10   
ref|WP_025533837.1|  threonine aldolase                               68.6    2e-10   
ref|WP_031427810.1|  threonine aldolase                               68.6    2e-10   
ref|WP_025625462.1|  threonine aldolase                               68.6    2e-10   
gb|EPJ52411.1|  hypothetical protein OFPI_14000                       68.6    2e-10   
ref|WP_029831322.1|  threonine aldolase                               68.2    2e-10   
ref|WP_043122222.1|  L-allo-threonine aldolase                        68.6    2e-10   
ref|WP_011716293.1|  threonine aldolase                               68.2    2e-10   
ref|WP_042033568.1|  L-allo-threonine aldolase                        68.2    2e-10   
ref|WP_031849072.1|  threonine aldolase                               68.2    2e-10   
ref|WP_025547634.1|  threonine aldolase                               68.2    2e-10   
ref|WP_006653265.1|  threonine aldolase                               68.6    2e-10   
ref|WP_038130867.1|  threonine aldolase                               68.2    2e-10   
ref|WP_043851472.1|  L-allo-threonine aldolase                        68.2    2e-10   
dbj|GAK54836.1|  L-threonine aldolase                                 68.2    2e-10   
ref|WP_009602342.1|  threonine aldolase                               68.2    2e-10   
ref|WP_031821878.1|  threonine aldolase                               68.2    2e-10   
ref|WP_042028952.1|  L-allo-threonine aldolase                        68.2    2e-10   
ref|WP_024700669.1|  threonine aldolase                               68.2    2e-10   
ref|WP_023585093.1|  threonine aldolase                               68.2    2e-10   
ref|WP_039976577.1|  threonine aldolase                               68.2    2e-10   
ref|WP_026456738.1|  L-allo-threonine aldolase                        68.2    2e-10   
ref|WP_041153863.1|  threonine aldolase                               68.2    2e-10   
ref|WP_010675015.1|  MULTISPECIES: threonine aldolase                 68.2    2e-10   
emb|CBN78642.1|  Threonine aldolase                                   69.3    2e-10   
ref|WP_000347576.1|  threonine aldolase                               68.2    2e-10   
ref|WP_017790755.1|  threonine aldolase                               68.2    2e-10   
ref|WP_016785291.1|  threonine aldolase                               68.2    2e-10   
ref|WP_039214922.1|  L-allo-threonine aldolase                        68.2    2e-10   
ref|WP_029303300.1|  L-allo-threonine aldolase                        68.2    2e-10   
ref|WP_013171710.1|  threonine aldolase [                             68.2    3e-10   
ref|WP_020697051.1|  hypothetical protein                             68.2    3e-10   
ref|WP_015347063.1|  L-allo-threonine aldolase                        67.8    3e-10   
ref|WP_008989461.1|  threonine aldolase                               67.8    3e-10   
ref|WP_042764629.1|  threonine aldolase                               67.8    3e-10   
ref|WP_005337176.1|  threonine aldolase                               67.8    3e-10   
ref|WP_039480221.1|  threonine aldolase                               67.8    3e-10   
ref|WP_016768093.1|  threonine aldolase                               67.8    3e-10   
ref|WP_035232635.1|  hypothetical protein                             67.8    3e-10   
ref|WP_011228172.1|  L-allo-threonine aldolase                        66.2    3e-10   
ref|WP_023266504.1|  L-threonine aldolase                             67.8    3e-10   



>ref|XP_009798339.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798340.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798341.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798342.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798343.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
Length=359

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA + FQEN+ KLEGDHKKAK LAE LNKI GL+VD+A+VETNIV+CDILK + 
Sbjct  241  VGVLCAAAFIAFQENLVKLEGDHKKAKILAEELNKIKGLKVDIAAVETNIVYCDILKGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             +E E+CK L +HG+LILPEGP+RIRFVIHHQIS+ DV YA S VQRA+ GVA  +GD
Sbjct  301  ISETEMCKTLEQHGLLILPEGPQRIRFVIHHQISENDVHYAASCVQRALAGVAEENGD  358



>ref|XP_009631531.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009631532.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009631533.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
Length=359

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA +GFQEN+ KLEGDHKKAK LAE LNKI GL+VD+A+VETNIV+CDILK + 
Sbjct  241  VGVLCAAAFIGFQENLVKLEGDHKKAKILAEELNKIKGLKVDIAAVETNIVYCDILKGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             +E E+CK L +HG+LILPEG  RIRFVIHHQIS+ DV YA+S VQRA+ GVA  +GD
Sbjct  301  ISETEMCKILEQHGLLILPEGLMRIRFVIHHQISENDVHYAVSCVQRALAGVAEENGD  358



>emb|CDO99988.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAAL+  QENVGKLEGDHKKAKTLA GLNKI GL VD+ SVETNIV+CDILK  N
Sbjct  222  VGVLCAAALIALQENVGKLEGDHKKAKTLAVGLNKIKGLNVDIDSVETNIVYCDILKSVN  281

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  255
             TE +LCK L  HG+LILPEGP RIR V+HHQIS++DV Y LS +Q+AV GV
Sbjct  282  ITETKLCKILEGHGILILPEGPFRIRMVLHHQISESDVHYTLSCMQQAVNGV  333



>ref|NP_001275261.1| L-allo-threonine aldolase-related protein [Solanum tuberosum]
 ref|XP_006361424.1| PREDICTED: uncharacterized protein R102.4 isoform X5 [Solanum 
tuberosum]
 ref|XP_006361425.1| PREDICTED: uncharacterized protein R102.4 isoform X6 [Solanum 
tuberosum]
 gb|ABB72802.1| L-allo-threonine aldolase-related protein [Solanum tuberosum]
Length=359

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAA    QEN+ KLEGDH+KAK+LA  LNKI GL+VD+A+VETNIV+CDILK + 
Sbjct  241  IGVLCAAAFTALQENLVKLEGDHRKAKSLAAELNKIKGLKVDVATVETNIVYCDILKGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             +E EL K L ++G+LILPEGP R+RFV+HHQIS++DV YA+S +QRA+ GVA  +GD
Sbjct  301  ISETELVKTLEQYGLLILPEGPLRVRFVLHHQISESDVHYAVSCLQRALAGVAEENGD  358



>ref|XP_006361420.1| PREDICTED: uncharacterized protein R102.4 isoform X1 [Solanum 
tuberosum]
 ref|XP_006361421.1| PREDICTED: uncharacterized protein R102.4 isoform X2 [Solanum 
tuberosum]
 ref|XP_006361422.1| PREDICTED: uncharacterized protein R102.4 isoform X3 [Solanum 
tuberosum]
Length=361

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAA    QEN+ KLEGDH+KAK+LA  LNKI GL+VD+A+VETNIV+CDILK + 
Sbjct  243  IGVLCAAAFTALQENLVKLEGDHRKAKSLAAELNKIKGLKVDVATVETNIVYCDILKGSR  302

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             +E EL K L ++G+LILPEGP R+RFV+HHQIS++DV YA+S +QRA+ GVA  +GD
Sbjct  303  ISETELVKTLEQYGLLILPEGPLRVRFVLHHQISESDVHYAVSCLQRALAGVAEENGD  360



>ref|XP_004236787.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_004236788.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_004236789.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
Length=359

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAA    QEN+ KLEGDH+KAK LA  LNKI GL+VD+A+VETNIV+CDILK + 
Sbjct  241  IGVLCAAAFTALQENLVKLEGDHRKAKILAAELNKIKGLKVDVATVETNIVYCDILKGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             +E EL K L ++G+LILPEGP R+RFV+HHQIS++DV YA+S +QRA+ GVA  +GD
Sbjct  301  ISEAELVKTLEQYGLLILPEGPLRVRFVLHHQISESDVHYAVSCIQRALAGVAEENGD  358



>ref|XP_010319280.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319281.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319282.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
Length=361

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAA    QEN+ KLEGDH+KAK LA  LNKI GL+VD+A+VETNIV+CDILK + 
Sbjct  243  IGVLCAAAFTALQENLVKLEGDHRKAKILAAELNKIKGLKVDVATVETNIVYCDILKGSR  302

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             +E EL K L ++G+LILPEGP R+RFV+HHQIS++DV YA+S +QRA+ GVA  +GD
Sbjct  303  ISEAELVKTLEQYGLLILPEGPLRVRFVLHHQISESDVHYAVSCIQRALAGVAEENGD  360



>emb|CBI22386.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G++CAAALV  QEN+ KLEGDHKKAK LAEGLN+I GL+V++ SVETNIV+ +I++ +N
Sbjct  222  VGIICAAALVALQENIAKLEGDHKKAKILAEGLNQIKGLKVNVTSVETNIVYFEIVEGSN  281

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             T  +LCK L EHGVL++PE   RIR V+HHQIS TDVQY LS +Q+AVTGV + +GD
Sbjct  282  ITAEKLCKYLQEHGVLMMPESSSRIRVVLHHQISGTDVQYTLSCIQQAVTGVHDCNGD  339



>ref|XP_002266992.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_003633695.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_003633696.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_010660226.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
Length=364

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G++CAAALV  QEN+ KLEGDHKKAK LAEGLN+I GL+V++ SVETNIV+ +I++ +N
Sbjct  241  VGIICAAALVALQENIAKLEGDHKKAKILAEGLNQIKGLKVNVTSVETNIVYFEIVEGSN  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             T  +LCK L EHGVL++PE   RIR V+HHQIS TDVQY LS +Q+AVTGV + +GD
Sbjct  301  ITAEKLCKYLQEHGVLMMPESSSRIRVVLHHQISGTDVQYTLSCIQQAVTGVHDCNGD  358



>ref|XP_009795458.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
Length=372

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAA V  QEN+ KLEGDH+KAK LAE LNKI GL+VD A+VETNIV+C ILK + 
Sbjct  241  IGVLCAAASVALQENLVKLEGDHRKAKLLAEELNKIKGLKVDSAAVETNIVYCHILKGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             +   LCK L +HG+L+LPEGP RIRFVIHHQIS++DV Y +S +Q+ + G A  +GD
Sbjct  301  VSRTHLCKILEQHGILVLPEGPMRIRFVIHHQISESDVHYTVSCLQQTLAGEAEENGD  358



>ref|XP_007030420.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030421.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 gb|EOY10922.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 gb|EOY10923.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
Length=358

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G +CAAA V  QENVGKLEGDHKKAK LAEGLN+I GL VD+A+V+TNI++ DI++ + 
Sbjct  241  VGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIIYFDIVEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             T  +L K L EHGVL++PEGP R+R V+HHQIS +DVQY LS  Q+A+TGV   +G+
Sbjct  301  LTAEKLYKNLEEHGVLVMPEGPARMRIVLHHQISSSDVQYTLSCFQQALTGVQEENGN  358



>ref|XP_011101617.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Sesamum 
indicum]
 ref|XP_011101618.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Sesamum 
indicum]
Length=359

 Score =   152 bits (385),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GV+CAAALV   ENVGKLE DHKKAK L+EGLNKI GL++++ASVETNIV+ DIL+E  
Sbjct  241  VGVICAAALVALGENVGKLESDHKKAKILSEGLNKIEGLKINLASVETNIVYFDILEEVG  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  240
             TE+EL K+L  HG+L++ EG  +IR VIHHQIS+ DVQY LS +Q+AVTG+   +G
Sbjct  301  ITEIELVKKLEAHGILVMAEGRLKIRLVIHHQISEYDVQYTLSCIQKAVTGMKAENG  357



>ref|XP_007030422.1| Threonine aldolase 1 isoform 3, partial [Theobroma cacao]
 gb|EOY10924.1| Threonine aldolase 1 isoform 3, partial [Theobroma cacao]
Length=355

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G +CAAA V  QENVGKLEGDHKKAK LAEGLN+I GL VD+A+V+TNI++ DI++ + 
Sbjct  241  VGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIIYFDIVEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  255
             T  +L K L EHGVL++PEGP R+R V+HHQIS +DVQY LS  Q+A+TGV
Sbjct  301  LTAEKLYKNLEEHGVLVMPEGPARMRIVLHHQISSSDVQYTLSCFQQALTGV  352



>gb|AFK42511.1| unknown [Lotus japonicus]
Length=121

 Score =   144 bits (363),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  Q+ VG+LE DHKKA+TLA+GLN+I GL VD +SVETNIV+ +I + + 
Sbjct  4    VGILCAAALVALQDIVGELESDHKKARTLADGLNQIKGLRVDTSSVETNIVYIEIKEGSG  63

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
            TT  +L K L  +GVL++P G  +IR V HHQISD+DVQYALS  Q+AV GV N +G+
Sbjct  64   TTAAKLSKDLENYGVLLMPLGSSKIRVVFHHQISDSDVQYALSCFQQAVNGVGNENGN  121



>ref|XP_002521974.1| l-allo-threonine aldolase, putative [Ricinus communis]
 gb|EEF40378.1| l-allo-threonine aldolase, putative [Ricinus communis]
Length=358

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  QEN GKLE DHKK K LAEGLN+I GL VD+A+VETNI++ DI++ + 
Sbjct  241  VGILCAAALVAVQENAGKLENDHKKTKALAEGLNQIKGLSVDVATVETNIIYLDIIEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             T  +LCK L +HGVL++ EGP  IR V+HHQIS +DVQY LS  Q+A+TGV   +G+
Sbjct  301  FTAEKLCKYLEKHGVLVMKEGPFSIRIVLHHQISASDVQYTLSIFQQALTGVQEENGN  358



>gb|KCW61508.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=362

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  +ENVGKLE DHKKAK LAEGLNKI GL +++ASVETNI++ DI + +N
Sbjct  245  VGILCAAALVALRENVGKLESDHKKAKILAEGLNKIRGLALNVASVETNIIYFDINEGSN  304

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  240
             T  +LCK L EHG+L++PE   R+R V+HHQIS+ DV YALS  QR + G  + +G
Sbjct  305  MTVQKLCKNLEEHGILVMPETSTRVRLVVHHQISENDVHYALSCFQRIMMGTPSENG  361



>ref|XP_010024956.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024958.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024959.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024960.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024961.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024962.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024963.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 gb|KCW61509.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
 gb|KCW61510.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=358

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  +ENVGKLE DHKKAK LAEGLNKI GL +++ASVETNI++ DI + +N
Sbjct  241  VGILCAAALVALRENVGKLESDHKKAKILAEGLNKIRGLALNVASVETNIIYFDINEGSN  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  240
             T  +LCK L EHG+L++PE   R+R V+HHQIS+ DV YALS  QR + G  + +G
Sbjct  301  MTVQKLCKNLEEHGILVMPETSTRVRLVVHHQISENDVHYALSCFQRIMMGTPSENG  357



>ref|XP_004494746.1| PREDICTED: L-allo-threonine aldolase-like isoform X1 [Cicer arietinum]
 ref|XP_004494747.1| PREDICTED: L-allo-threonine aldolase-like isoform X2 [Cicer arietinum]
Length=358

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAALV  QENVGKLE DHK A+  A+GLNKI GL+VD++SVETN+VF +I + + 
Sbjct  241  VGVLCAAALVALQENVGKLESDHKNARFFADGLNKIKGLKVDISSVETNMVFIEIEESSG  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
            TT  ++CK L ++G+L+LP G  R+R V HHQIS++DV+YALS  Q+AV+G  N +G+
Sbjct  301  TTAAKICKDLEDYGILLLPIGSSRLRVVFHHQISNSDVKYALSCFQQAVSGGLNENGN  358



>ref|XP_007030424.1| Threonine aldolase 1 isoform 5 [Theobroma cacao]
 gb|EOY10926.1| Threonine aldolase 1 isoform 5 [Theobroma cacao]
Length=357

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G +CAAA V  QENVGKLEGDHKKAK LAEGLN+I GL VD+A+V+TNI++ DI++ + 
Sbjct  241  VGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIIYFDIVEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
             T  +L K L EHGVL++PEGP R+R V+HHQIS +DVQY LS  Q
Sbjct  301  LTAEKLYKNLEEHGVLVMPEGPARMRIVLHHQISSSDVQYTLSCFQ  346



>ref|XP_003521772.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Glycine 
max]
 gb|KHN31499.1| L-allo-threonine aldolase [Glycine soja]
Length=358

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  QENVGKL+ DH KAK LA+GLN+I GL VD++SVETNI++ ++ + + 
Sbjct  241  VGILCAAALVALQENVGKLQSDHNKAKLLADGLNEIKGLRVDISSVETNIIYVEVEEGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             T  +LCK L ++G+L++P G  R+R V HHQIS +DVQYALS  Q+AV GV N +G+
Sbjct  301  ATAAKLCKDLEDYGILLMPMGSSRLRIVFHHQISASDVQYALSCFQQAVNGVRNENGN  358



>gb|AFK43649.1| unknown [Lotus japonicus]
Length=358

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  Q+ VG+LE DHKKA+TLA+GLN+I GL VD +SVETNIV+ +I + + 
Sbjct  241  VGILCAAALVALQDIVGELESDHKKARTLADGLNQIKGLRVDTSSVETNIVYIEIKEGSG  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
            TT  +L K L  +GVL++P G  +IR V HHQISD+DVQYALS  Q+AV GV N +G+
Sbjct  301  TTAAKLSKDLENYGVLLMPLGSSKIRVVFHHQISDSDVQYALSCFQQAVNGVGNENGN  358



>gb|KCW61511.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=365

 Score =   142 bits (358),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  +ENVGKLE DHKKAK LAEGLNKI GL +++ASVETNI++ DI + +N
Sbjct  241  VGILCAAALVALRENVGKLESDHKKAKILAEGLNKIRGLALNVASVETNIIYFDINEGSN  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
             T  +LCK L EHG+L++PE   R+R V+HHQIS+ DV YALS  Q
Sbjct  301  MTVQKLCKNLEEHGILVMPETSTRVRLVVHHQISENDVHYALSCFQ  346



>gb|EYU19887.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19888.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19889.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19890.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
Length=359

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GV+CAAALV  +ENV KLE DHKKAKTLAEG+N I GL VD+ASVETNIV+ DI +   
Sbjct  241  VGVICAAALVALEENVAKLETDHKKAKTLAEGVNNIKGLNVDLASVETNIVYFDIQESLG  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSG  240
             TE +L K L  HG+  + EGP +IR VIHHQIS+TDVQY +S +Q+ V G+   +G
Sbjct  301  ITEGKLLKNLEAHGIFAMSEGPLKIRLVIHHQISETDVQYTVSCIQKIVGGLVGENG  357



>gb|KJB82283.1| hypothetical protein B456_013G187300 [Gossypium raimondii]
 gb|KJB82284.1| hypothetical protein B456_013G187300 [Gossypium raimondii]
Length=358

 Score =   139 bits (350),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G +CAAA V  +ENV KLEGDHKKAK LAEGLN+I GL V++A+VETNI+F DI++ + 
Sbjct  241  LGFICAAAFVALKENVAKLEGDHKKAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  255
             T  +L K+L EHGVL++ EGP R+R V+HHQIS +DV Y LS  Q+A+ GV
Sbjct  301  ITAEKLYKKLEEHGVLVMLEGPLRMRIVLHHQISSSDVLYTLSCFQQALIGV  352



>ref|XP_006577318.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Glycine 
max]
Length=357

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 90/118 (76%), Gaps = 1/118 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  QENVGKL+ DH KAK LA+GLN+I GL VD++SVETNI++ ++ + + 
Sbjct  241  VGILCAAALVALQENVGKLQSDHNKAKLLADGLNEIKGLRVDISSVETNIIYVEVEEGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             T  +LCK L ++G+L++P G  R+R V HHQIS +DVQYALS  Q AV GV N +G+
Sbjct  301  ATAAKLCKDLEDYGILLMPMGSSRLRIVFHHQISASDVQYALSCFQ-AVNGVRNENGN  357



>ref|XP_002325334.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
 gb|EEE99715.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
Length=359

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAALV   E V KLE DHKK K LAEGLN+I GL +++A+VETNI+F D+++ A 
Sbjct  241  VGVLCAAALVALHETVLKLEDDHKKTKMLAEGLNQIKGLRLNVAAVETNIIFFDVVEGAK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             T  +LCK L +HG+L++ E P RIR V+HHQIS++DVQYALS  ++A+TG
Sbjct  301  ITAEKLCKNLEQHGILVMQESPVRIRVVLHHQISESDVQYALSCFKQALTG  351



>gb|KDP23711.1| hypothetical protein JCGZ_23544 [Jatropha curcas]
Length=354

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAA LV  QENVGKLE DHKKAKT+AEGL++   L VD A+VETNI++ D+++ + 
Sbjct  237  VGMLCAAGLVAVQENVGKLEDDHKKAKTIAEGLHQFKELRVDAAAVETNIIYVDVVESSK  296

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             T  +LCK L +HGVL++ EGP   R V+HHQIS +DVQY LS  Q+ +TGV   +G+
Sbjct  297  FTAEKLCKSLEQHGVLVMLEGPFSFRIVLHHQISASDVQYTLSCFQQILTGVQAENGN  354



>gb|KJB44860.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=370

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G +CAAA V  +ENV KL+GDHKKAK LAEGLN+I GL+VD+A+VETNI++ DI++ + 
Sbjct  241  VGFICAAAFVALKENVEKLDGDHKKAKELAEGLNQIKGLKVDIAAVETNIIYVDIVEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH  234
             T  +L K L EHGVL++P+G  R+R V+HHQIS +DV Y LS  Q+A +G+   +G +
Sbjct  301  ITAEKLYKNLEEHGVLVMPKGLSRMRIVLHHQISSSDVHYTLSCFQQAFSGMHQENGSY  359



>ref|XP_011036295.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036297.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036298.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036299.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036300.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
Length=359

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAA LV   ENV KLE DHKKAK LAEGLN+I GL +++A+VETNI+F DI++ A 
Sbjct  241  VGILCAADLVALHENVLKLEDDHKKAKMLAEGLNQIKGLRLNVAAVETNIIFFDIVEGAK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             T  +LCK L  HG+L++ E P RIR V+HHQIS++DVQYALS  ++A++G
Sbjct  301  ITAEKLCKNLEHHGILVMQESPVRIRVVLHHQISESDVQYALSCFKQALSG  351



>gb|KJB44862.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=413

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G +CAAA V  +ENV KL+GDHKKAK LAEGLN+I GL+VD+A+VETNI++ DI++ + 
Sbjct  284  VGFICAAAFVALKENVEKLDGDHKKAKELAEGLNQIKGLKVDIAAVETNIIYVDIVEGSK  343

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH  234
             T  +L K L EHGVL++P+G  R+R V+HHQIS +DV Y LS  Q+A +G+   +G +
Sbjct  344  ITAEKLYKNLEEHGVLVMPKGLSRMRIVLHHQISSSDVHYTLSCFQQAFSGMHQENGSY  402



>gb|KJB46043.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
 gb|KJB46044.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
Length=358

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GV+CAAALV  QEN+ KLEGDHK AK LAEGLN+I GL V++A+VETNI+F DI++ + 
Sbjct  241  VGVICAAALVALQENLIKLEGDHKNAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             +  +L K L E GV +L EGP R+R V+HHQIS +DVQY LS  Q+A +G+   +G+
Sbjct  301  ISGEKLYKHLVERGVFVLLEGPSRMRIVLHHQISSSDVQYTLSCFQQAFSGLQEENGN  358



>gb|KJB44861.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=417

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 90/119 (76%), Gaps = 0/119 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G +CAAA V  +ENV KL+GDHKKAK LAEGLN+I GL+VD+A+VETNI++ DI++ + 
Sbjct  288  VGFICAAAFVALKENVEKLDGDHKKAKELAEGLNQIKGLKVDIAAVETNIIYVDIVEGSK  347

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH  234
             T  +L K L EHGVL++P+G  R+R V+HHQIS +DV Y LS  Q+A +G+   +G +
Sbjct  348  ITAEKLYKNLEEHGVLVMPKGLSRMRIVLHHQISSSDVHYTLSCFQQAFSGMHQENGSY  406



>gb|AFK40044.1| unknown [Medicago truncatula]
Length=358

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV   ENV KLE DHK A+ LA+GLN+I GL VD +SVETNI++ +I + + 
Sbjct  241  VGILCAAALVALHENVEKLESDHKNARFLADGLNEIKGLRVDTSSVETNIIYIEIEENSG  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
            TT  +L K L E+G+LI+P G  R+R V HHQISD+DV+Y LS  +RAV G  N +G+
Sbjct  301  TTAAKLSKDLEEYGILIMPMGTSRLRVVFHHQISDSDVRYTLSCFERAVAGEPNENGN  358



>gb|KEH24599.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=358

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV   ENV KLE DHK A+ LA+GLN+I GL VD +SVETNI++ +I + + 
Sbjct  241  VGILCAAALVALHENVEKLESDHKNARFLADGLNEIKGLRVDTSSVETNIIYIEIEENSG  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
            TT  +L K L E+G+LI+P G  R+R V HHQISD+DV+Y LS  +RAV G  N +G+
Sbjct  301  TTAAKLSKDLEEYGILIMPMGTSRLRVVFHHQISDSDVRYTLSCFERAVAGEPNENGN  358



>ref|XP_007147215.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 ref|XP_007147216.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 gb|ESW19209.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 gb|ESW19210.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
Length=362

 Score =   137 bits (344),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  QENV KLE DHKKAK LA+GLN+I GL VD +SVETN++F ++ +   
Sbjct  241  VGILCAAALVALQENVEKLESDHKKAKLLADGLNEIKGLSVDTSSVETNMMFVEVEEGLG  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVAN  249
            TT  +LCK L ++G+L++  G  R+R V HHQIS +DVQYALS  Q+AV GV N
Sbjct  301  TTASKLCKDLEDYGILLMAIGSSRLRIVFHHQISASDVQYALSCFQQAVNGVRN  354



>gb|KHG25609.1| L-allo-threonine aldolase [Gossypium arboreum]
Length=358

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GV+CAAALV  QEN+ KLEGDHK AK LAEGLN+I GL V++A+VETNI+F DI++ + 
Sbjct  241  VGVICAAALVALQENLVKLEGDHKNAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             +  +L K L E GV ++ EGP R+R V+HHQIS +DVQY LS  Q+A +G+   +G+
Sbjct  301  ISGEKLYKHLVERGVFVMLEGPSRMRIVLHHQISSSDVQYTLSCFQQAFSGLQEENGN  358



>ref|XP_002319106.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
 gb|EEE95029.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
Length=356

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAALVG QENV KLE DHKKAK LAEGLN+I GL V++A+VETNI++ D+++ A 
Sbjct  241  VGVLCAAALVGVQENVSKLEDDHKKAKMLAEGLNQIKGLRVNVAAVETNIIYIDVVEGAA  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  255
                +LCK L +HG+LI+ E P  IR  +HHQIS +DVQY LS  ++A+TGV
Sbjct  301  E---KLCKNLEQHGILIMQESPISIRVALHHQISASDVQYTLSCFKQALTGV  349



>ref|XP_010102233.1| L-allo-threonine aldolase [Morus notabilis]
 gb|EXB93176.1| L-allo-threonine aldolase [Morus notabilis]
Length=358

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  QENVGKLE DHK AK LA+GL+KI GL VD+ASVETNI+F DI + + 
Sbjct  241  VGVLCAAAFVAVQENVGKLEADHKNAKFLADGLHKIKGLFVDVASVETNIIFIDIEEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             T  +LCK L EHG++++ E   RIR V+HHQIS  DV++ LS  Q A+ GV+  +G+
Sbjct  301  MTAEKLCKNLEEHGIVVMKESSSRIRIVLHHQISYDDVKFTLSCFQNALNGVSVENGN  358



>gb|KHN04944.1| L-allo-threonine aldolase [Glycine soja]
Length=360

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 2/120 (2%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  QENVGKLE DHKKA+ LA+GLN++ GL VD  SVETN+VF DI +   
Sbjct  241  IGILCAAALVALQENVGKLESDHKKARLLADGLNEVKGLRVDACSVETNMVFIDIEEGTK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT--GVANGSGD  237
            T   ++CK + E G+L++ E   R+R V+HHQIS +DVQYALS  Q+AV   GV N  G+
Sbjct  301  TRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQYALSCFQQAVAVKGVQNEMGN  360



>ref|XP_009364444.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
 ref|XP_009364445.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
 ref|XP_009364446.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
Length=359

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALVG   NV KLE DHK+AK LAEGLN+I GL VD+ASVETNI++  + + +N
Sbjct  241  VGILCAAALVGLHNNVAKLETDHKRAKILAEGLNQIKGLSVDVASVETNILYIHVEEGSN  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             T  +L K L EHG+L++ E    IR VIHHQIS +DVQY LS  Q+A+TG
Sbjct  301  VTTEKLVKNLEEHGILMMQESSSSIRIVIHHQISASDVQYTLSCFQKALTG  351



>gb|ACJ83727.1| unknown [Medicago truncatula]
Length=118

 Score =   127 bits (320),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG++CAAALV  +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + 
Sbjct  4    IGIICAAALVALKENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSR  63

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
            TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  64   TTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  118



>ref|XP_008388714.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
 ref|XP_008388715.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
 ref|XP_008388716.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
Length=359

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALVG  +NV KLE DHK+AK LAEGLN+I GL VD+ASVETNI++  + + +N
Sbjct  241  VGILCAAALVGLHDNVAKLETDHKRAKILAEGLNQIKGLSVDVASVETNILYIHVEEGSN  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             T  +L K L EHGVL++ E    IR VIHHQIS +DVQY LS  Q+A+ G
Sbjct  301  VTTEKLVKNLEEHGVLMMQESSSSIRIVIHHQISASDVQYTLSCFQKALXG  351



>ref|XP_011038517.1| PREDICTED: LOW QUALITY PROTEIN: probable low-specificity L-threonine 
aldolase 1 [Populus euphratica]
Length=356

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAALV  QENV KLE DHKKAK LAEGLN+I GL V++A+VET I++ D+++ A 
Sbjct  241  VGVLCAAALVAVQENVSKLEDDHKKAKMLAEGLNQIKGLRVNVAAVETKIIYIDVVEGAA  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
                +LCK L +HG+LI+ E P  IR V+HHQIS +DVQY LS  Q+A+TG
Sbjct  301  E---KLCKNLEQHGILIMQESPISIRVVLHHQISTSDVQYTLSCFQQALTG  348



>ref|XP_008388713.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Malus domestica]
Length=371

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALVG  +NV KLE DHK+AK LAEGLN+I GL VD+ASVETNI++  + + +N
Sbjct  253  VGILCAAALVGLHDNVAKLETDHKRAKILAEGLNQIKGLSVDVASVETNILYIHVEEGSN  312

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             T  +L K L EHGVL++ E    IR VIHHQIS +DVQY LS  Q+A+ G
Sbjct  313  VTTEKLVKNLEEHGVLMMQESSSSIRIVIHHQISASDVQYTLSCFQKALXG  363



>ref|XP_008218319.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218320.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218321.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218322.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218323.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
Length=359

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV   ENV KLE DHK+AK LAEGLN+I GL VD+ +VETNIV+  +++ +N
Sbjct  241  VGILCAAALVALHENVAKLETDHKRAKILAEGLNQIKGLRVDIDTVETNIVYIHVVEGSN  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             +  +L K L EHG+L++ E    IR V+HHQIS +DVQY LS  QRAVTG
Sbjct  301  ISAEKLLKNLEEHGILMMRESSSSIRIVLHHQISASDVQYTLSCFQRAVTG  351



>ref|XP_006577317.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Glycine 
max]
Length=368

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  QENVGKL+ DH KAK LA+GLN+I GL VD++SVETNI++ ++ + + 
Sbjct  241  VGILCAAALVALQENVGKLQSDHNKAKLLADGLNEIKGLRVDISSVETNIIYVEVEEGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR  270
             T  +LCK L ++G+L++P G  R+R V HHQIS +DVQYALS  Q+
Sbjct  301  ATAAKLCKDLEDYGILLMPMGSSRLRIVFHHQISASDVQYALSCFQK  347



>gb|KJB46045.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
Length=388

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 97/157 (62%), Gaps = 20/157 (13%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GV+CAAALV  QEN+ KLEGDHK AK LAEGLN+I GL V++A+VETNI+F DI++ + 
Sbjct  241  VGVICAAALVALQENLIKLEGDHKNAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH*  231
             +  +L K L E GV +L EGP R+R V+HHQIS +DVQY LS  Q  +           
Sbjct  301  ISGEKLYKHLVERGVFVLLEGPSRMRIVLHHQISSSDVQYTLSCFQVII-----------  349

Query  230  N*GNCYLCFKIFYLVK------KCNIPVDLQFIFIFK  138
                 +L F++F  +K           V +Q+  +F+
Sbjct  350  ---RAFLLFRLFIFIKTLISDSSSYTSVGIQWCMLFR  383



>ref|XP_004170828.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=359

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  QEN+ KLEGDH+ AK LA+GLNKI GL+V+   +ETNI+F DI + + 
Sbjct  241  VGILCAAALVAIQENIVKLEGDHENAKILADGLNKIKGLQVESHLIETNIIFVDIKEGST  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             T  +L K L EHG+L+LPE   RIR V+HHQIS TD QY LS  Q+A+ G
Sbjct  301  ITGDKLSKILEEHGILVLPESSSRIRIVLHHQISATDTQYTLSCFQQAMAG  351



>ref|XP_003556456.2| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Glycine 
max]
Length=421

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  QENVGKLE DHKKA+ LA+GLN++ GL VD  SVETN+VF DI +   
Sbjct  302  IGILCAAALVALQENVGKLESDHKKARLLADGLNEVKGLRVDACSVETNMVFIDIEEGTK  361

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T   ++CK + E G+L++ E   R+R V+HHQIS +DVQYALS  Q+AV
Sbjct  362  TRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQYALSCFQQAV  410



>ref|XP_008456444.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
Length=358

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  QEN+ KLEGDH+ AK LA+GLNKI GL+V+   +ETNI+F DI K++ 
Sbjct  241  VGILCAAALVAIQENIVKLEGDHENAKFLADGLNKIKGLQVESHLIETNIIFVDI-KDST  299

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             T  +L K L EHG+L+LPE   RIR V+HHQIS TD QY LS  Q+A+ G
Sbjct  300  ITGEKLSKILEEHGILVLPESSSRIRIVLHHQISATDTQYTLSCFQQAMAG  350



>ref|XP_010262337.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Nelumbo nucifera]
Length=341

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAA V   ENVGKLE DHKK K LA+G+N+I  L +DM+S+ETNI+F DIL+ +N
Sbjct  224  VGILCAAAYVALHENVGKLEDDHKKTKILADGINQIKELSIDMSSIETNIIFFDILEGSN  283

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L + L +HG+L++P     IR V+HHQIS+ DVQY LS +Q+AV
Sbjct  284  VTVEKLVQFLEKHGILVMPASSSSIRLVLHHQISECDVQYTLSCIQQAV  332



>ref|XP_010262335.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262336.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Nelumbo nucifera]
Length=358

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAA V   ENVGKLE DHKK K LA+G+N+I  L +DM+S+ETNI+F DIL+ +N
Sbjct  241  VGILCAAAYVALHENVGKLEDDHKKTKILADGINQIKELSIDMSSIETNIIFFDILEGSN  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L + L +HG+L++P     IR V+HHQIS+ DVQY LS +Q+AV
Sbjct  301  VTVEKLVQFLEKHGILVMPASSSSIRLVLHHQISECDVQYTLSCIQQAV  349



>gb|KDO44520.1| hypothetical protein CISIN_1g0182431mg, partial [Citrus sinensis]
 gb|KDO44521.1| hypothetical protein CISIN_1g0182431mg, partial [Citrus sinensis]
Length=174

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENV-GKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEA  414
            +GVLCAAALV  QENV   L+GDHKKAK LAEGLN++ GL VD+ +VETNIV+ +I +++
Sbjct  56   VGVLCAAALVALQENVLVMLDGDHKKAKLLAEGLNQLKGLRVDVDAVETNIVYFEITEDS  115

Query  413  NTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
                  L K+L EHGVL++PE   R+R V+HHQIS  DV Y LS  Q+   GV   +G+
Sbjct  116  KLYAACLLKKLEEHGVLVMPESSTRVRIVVHHQISANDVHYTLSCFQKIYAGVCEENGN  174



>ref|XP_010694951.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010694952.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Beta 
vulgaris subsp. vulgaris]
Length=371

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  Q+NV KLE DHK AK LA+GLN+I+GL+VD +SVETNI++  + + +N
Sbjct  253  IGILCAAALVALQDNVRKLEDDHKNAKLLADGLNQITGLKVDNSSVETNIIYVRVCENSN  312

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVAN  249
            TT  +L K L E+G+L++ E   R R VIHHQI+ +DVQ ALS +Q+AVTG ++
Sbjct  313  TTAPKLSKSLEENGILVMLENTFRFRVVIHHQITTSDVQRALSCIQQAVTGASS  366



>ref|XP_004139254.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
 gb|KGN60769.1| hypothetical protein Csa_2G009560 [Cucumis sativus]
Length=359

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  QEN+ KLEGDH+ AK LA+GLNKI GL+V+   +ETNI+F DI + + 
Sbjct  241  VGILCAAALVAIQENIVKLEGDHENAKILADGLNKIKGLQVESHLIETNIIFVDIKEGSI  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             T  +L K L EHG+L+LPE   RIR V+HHQIS TD QY LS  Q+A+ G
Sbjct  301  ITGDKLSKILEEHGILVLPESSSRIRIVLHHQISATDTQYTLSCFQQAMAG  351



>ref|XP_006606453.1| PREDICTED: uncharacterized protein R102.4-like isoform X4 [Glycine 
max]
Length=380

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  QENVGKLE DHKKA+ LA+GLN++ GL VD  SVETN+VF DI +   
Sbjct  241  IGILCAAALVALQENVGKLESDHKKARLLADGLNEVKGLRVDACSVETNMVFIDIEEGTK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  261
            T   ++CK + E G+L++ E   R+R V+HHQIS +DVQYALS  Q  +T
Sbjct  301  TRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQYALSCFQVMLT  350



>ref|XP_006606452.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Glycine 
max]
Length=390

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  QENVGKLE DHKKA+ LA+GLN++ GL VD  SVETN+VF DI +   
Sbjct  251  IGILCAAALVALQENVGKLESDHKKARLLADGLNEVKGLRVDACSVETNMVFIDIEEGTK  310

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  261
            T   ++CK + E G+L++ E   R+R V+HHQIS +DVQYALS  Q  +T
Sbjct  311  TRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQYALSCFQVMLT  360



>ref|XP_011465993.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465994.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465995.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
Length=359

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  QENV KLEGDHKKAKTLAEGLN+I G+ VD   VETNI++  + + + 
Sbjct  241  VGILCAAALVALQENVAKLEGDHKKAKTLAEGLNRIKGIRVDTEMVETNILYVHVDEGST  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH  234
             +  +L K+L ++G+L + E    IR V+HHQIS++DVQY LS  Q+A+TG    +G +
Sbjct  301  ISAEKLYKKLEDYGILAMKESSSSIRIVLHHQISESDVQYTLSCFQKALTGAPEENGHY  359



>ref|XP_006606451.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Glycine 
max]
Length=441

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  QENVGKLE DHKKA+ LA+GLN++ GL VD  SVETN+VF DI +   
Sbjct  302  IGILCAAALVALQENVGKLESDHKKARLLADGLNEVKGLRVDACSVETNMVFIDIEEGTK  361

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  261
            T   ++CK + E G+L++ E   R+R V+HHQIS +DVQYALS  Q  +T
Sbjct  362  TRAEKICKYMEERGILVMQESSSRMRVVLHHQISASDVQYALSCFQVMLT  411



>ref|XP_006417664.1| hypothetical protein EUTSA_v10008026mg [Eutrema salsugineum]
 gb|ESQ36017.1| hypothetical protein EUTSA_v10008026mg [Eutrema salsugineum]
Length=358

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ VD+A+VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQFDHKKAKLLAEGLNQLKGIRVDVAAVETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L E+G+L++P    RIR VIHHQI+ +DV Y LS VQ+AV
Sbjct  301  LTAEKLSKSLTEYGILVIPANSSRIRMVIHHQITTSDVHYTLSCVQQAV  349



>gb|ADI24921.1| L-allo-threonine aldolase [Carica papaya]
Length=360

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 86/114 (75%), Gaps = 2/114 (2%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAA+V  ++N+ KLEGDHKKAK LA+GLN+I+GL VD A VETNI++  +++ + 
Sbjct  241  VGILCAAAVVALRKNLSKLEGDHKKAKILADGLNQINGLRVDAAKVETNIIYFKVMEYSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVAN  249
             T   LCK L +HG+L++ EG  RIR V+HHQIS +DVQY LS  Q  VT +A+
Sbjct  301  MTAERLCKYLKDHGILVIYEGEFRIRIVLHHQISASDVQYTLSCFQ--VTNLAH  352



>emb|CDX93548.1| BnaA06g05000D [Brassica napus]
Length=358

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 83/109 (76%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LAEGLNK+ G+ V++A++ETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQFDHKKAKLLAEGLNKMKGIRVNVAAMETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L EHG+L++PE   RIR VIHHQI+ +DV Y LS +Q+AV
Sbjct  301  LTAEKLRKSLTEHGILVIPESSSRIRMVIHHQITTSDVHYTLSCLQQAV  349



>ref|XP_010246795.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nelumbo 
nucifera]
Length=358

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAA V   ENVGKLEGDHKKAK LAEGLN+I  L VD++SVETNI+F  +L+ + 
Sbjct  241  IGILCAAAYVALHENVGKLEGDHKKAKVLAEGLNQIKELRVDVSSVETNIIFFHVLEGSE  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                +L + L +HG+L++P     IR V+HHQIS++DVQY LS +Q+AV
Sbjct  301  VIVEKLTQFLEKHGILVMPVSSSGIRLVLHHQISESDVQYTLSCIQQAV  349



>ref|XP_009148115.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009148116.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009148118.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=358

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKK K LAEGLNK+ G+ V++A++ETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQSDHKKTKLLAEGLNKMKGIRVNVAAMETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L EHG+L++PE   RIR VIHHQI+ +DV Y LS +Q+AV
Sbjct  301  LTAEKLRKSLTEHGILVIPESSSRIRMVIHHQITTSDVHYTLSCLQQAV  349



>ref|XP_007205422.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 ref|XP_007205423.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 gb|EMJ06621.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 gb|EMJ06622.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
Length=359

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV   ENV KLE DHK+AK LAEGLN+I GL VD+ +VETNI++  +++ +N
Sbjct  241  VGILCAAALVALHENVAKLETDHKRAKILAEGLNQIKGLRVDIDTVETNIIYIHVVEGSN  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             +  +L   L EHG+L++ E    +R V+HHQIS +DVQY LS  QRA+TG
Sbjct  301  ISAEKLLMNLEEHGILMMRESSSSVRIVLHHQISASDVQYTLSCFQRALTG  351



>emb|CDX95045.1| BnaC05g06260D [Brassica napus]
Length=358

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKK K LAEGLNK+ G+ V++A++ETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQSDHKKTKLLAEGLNKMKGIRVNVAAMETNMIFMDMEDGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L EHG+L++PE   RIR V+HHQI+ +DV Y LS +Q+AV
Sbjct  301  LTAEKLRKSLTEHGILVIPENSTRIRMVLHHQITTSDVHYTLSCLQQAV  349



>ref|XP_006487715.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487716.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Citrus 
sinensis]
 ref|XP_006487717.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Citrus 
sinensis]
 ref|XP_006487718.1| PREDICTED: uncharacterized protein R102.4-like isoform X4 [Citrus 
sinensis]
Length=359

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 85/119 (71%), Gaps = 1/119 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENV-GKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEA  414
            +GVLCAAALV  QENV   L+GDHKKAK LAEGLN++ GL VD+ +VETNIV+ +I +++
Sbjct  241  VGVLCAAALVALQENVLVMLDGDHKKAKLLAEGLNQLKGLRVDVDAVETNIVYFEITEDS  300

Query  413  NTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
                  L K+L EHGVL++PE   R+R V+HHQIS +DV Y LS  Q+   GV   +G+
Sbjct  301  KLDAACLLKKLEEHGVLVMPESSTRVRIVVHHQISASDVHYTLSCFQKIYAGVCEENGN  359



>ref|XP_003590971.1| L-allo-threonine aldolase [Medicago truncatula]
Length=336

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + 
Sbjct  222  IGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSR  281

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
            TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  282  TTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  336



>gb|AES61221.2| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=355

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + 
Sbjct  241  IGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
            TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  301  TTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  355



>gb|AFK38526.1| unknown [Medicago truncatula]
Length=370

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + 
Sbjct  256  IGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSR  315

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
            TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  316  TTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  370



>ref|XP_003590972.1| L-allo-threonine aldolase [Medicago truncatula]
 gb|AES61223.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=370

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + 
Sbjct  256  IGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSR  315

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
            TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  316  TTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  370



>ref|XP_009118358.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118360.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118361.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118362.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118363.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=358

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKK K LAEGLN++ G+ V++A+VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQFDHKKTKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K LAEHG+L++PE   RIR VIHHQI+ +DV Y LS  ++AV
Sbjct  301  LTAEKLRKSLAEHGILVIPENSSRIRMVIHHQITTSDVHYTLSCFKQAV  349



>emb|CDY06323.1| BnaA09g48800D [Brassica napus]
Length=358

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKK K LAEGLN++ G+ V++A+VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQFDHKKTKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K LAEHG+L++PE   RIR VIHHQI+ +DV Y LS  ++AV
Sbjct  301  LTAEKLRKSLAEHGILVIPENSSRIRMVIHHQITTSDVHYTLSCFKQAV  349



>ref|XP_010906811.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X3 [Elaeis guineensis]
Length=365

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ + 
Sbjct  247  VGVLCAAAYVALRDNVGKLEDDHKKAKMFADGLRQIKELTVDTSSVETNMVFFDIVESSL  306

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T   LC+ L EHGVL +P     +RFV+H+QIS++D+ YAL+ VQ+AV
Sbjct  307  ITPERLCQVLEEHGVLAMPASSTSVRFVVHYQISESDIHYALACVQQAV  355



>ref|XP_003590973.1| L-allo-threonine aldolase [Medicago truncatula]
 gb|AES61224.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=396

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + 
Sbjct  282  IGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSR  341

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
            TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  342  TTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  396



>ref|XP_006442676.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442677.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442678.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442679.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442680.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442681.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442682.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442683.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55916.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55917.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55918.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55919.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55920.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55921.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55922.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55923.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
Length=359

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 84/119 (71%), Gaps = 1/119 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENV-GKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEA  414
            +GVLCAAALV  QENV   L+GDHKKAK LAEGLN++ GL VD+ +VETNIV+ +I +++
Sbjct  241  VGVLCAAALVALQENVLVMLDGDHKKAKLLAEGLNQLKGLRVDVDAVETNIVYFEITEDS  300

Query  413  NTTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
                  L K+L EHGVL++PE   R+R V+HHQIS  DV Y LS  Q+   GV   +G+
Sbjct  301  KLYAACLLKKLEEHGVLVMPESSTRVRIVVHHQISANDVHYTLSCFQKIYAGVCEENGN  359



>ref|XP_010906812.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X4 [Elaeis guineensis]
 ref|XP_010906813.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X4 [Elaeis guineensis]
Length=359

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ + 
Sbjct  241  VGVLCAAAYVALRDNVGKLEDDHKKAKMFADGLRQIKELTVDTSSVETNMVFFDIVESSL  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T   LC+ L EHGVL +P     +RFV+H+QIS++D+ YAL+ VQ+AV
Sbjct  301  ITPERLCQVLEEHGVLAMPASSTSVRFVVHYQISESDIHYALACVQQAV  349



>ref|XP_010906810.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Elaeis guineensis]
Length=384

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ + 
Sbjct  266  VGVLCAAAYVALRDNVGKLEDDHKKAKMFADGLRQIKELTVDTSSVETNMVFFDIVESSL  325

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T   LC+ L EHGVL +P     +RFV+H+QIS++D+ YAL+ VQ+AV
Sbjct  326  ITPERLCQVLEEHGVLAMPASSTSVRFVVHYQISESDIHYALACVQQAV  374



>ref|XP_010906809.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
Length=387

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ + 
Sbjct  269  VGVLCAAAYVALRDNVGKLEDDHKKAKMFADGLRQIKELTVDTSSVETNMVFFDIVESSL  328

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T   LC+ L EHGVL +P     +RFV+H+QIS++D+ YAL+ VQ+AV
Sbjct  329  ITPERLCQVLEEHGVLAMPASSTSVRFVVHYQISESDIHYALACVQQAV  377



>gb|ACJ85157.1| unknown [Medicago truncatula]
 gb|AFK44463.1| unknown [Medicago truncatula]
Length=421

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + 
Sbjct  307  IGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSR  366

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
            TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY LS  Q+AV  + NG+
Sbjct  367  TTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQYTLSCFQQAVQ-IENGN  421



>ref|XP_004495577.1| PREDICTED: L-allo-threonine aldolase-like isoform X2 [Cicer arietinum]
Length=355

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA+LV  +ENVGKLE DHKK + LA+GLN+I GL V+  SVETNI+F DI + + 
Sbjct  241  IGILCAASLVALKENVGKLESDHKKTRLLADGLNEIEGLRVNPCSVETNIIFIDIEEGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
            TT  ++CK L E G+L+L +   R+R V+H QIS +DVQY LS  Q+A+  + NG+
Sbjct  301  TTAEKICKYLEERGILLLQDKSSRLRVVLHFQISSSDVQYTLSCFQQALQ-IENGN  355



>ref|XP_004495576.1| PREDICTED: L-allo-threonine aldolase-like isoform X1 [Cicer arietinum]
Length=370

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 85/116 (73%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA+LV  +ENVGKLE DHKK + LA+GLN+I GL V+  SVETNI+F DI + + 
Sbjct  256  IGILCAASLVALKENVGKLESDHKKTRLLADGLNEIEGLRVNPCSVETNIIFIDIEEGSR  315

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
            TT  ++CK L E G+L+L +   R+R V+H QIS +DVQY LS  Q+A+  + NG+
Sbjct  316  TTAEKICKYLEERGILLLQDKSSRLRVVLHFQISSSDVQYTLSCFQQALQ-IENGN  370



>emb|CDY22672.1| BnaC08g43060D [Brassica napus]
Length=358

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKK K LAEGLN++ G+ V++A+VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQFDHKKTKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L EHG+L++PE   RIR VIHH I+ +DV Y LS  Q+AV
Sbjct  301  LTAEKLRKSLTEHGILVIPENSSRIRMVIHHHITTSDVHYTLSCFQQAV  349



>ref|XP_007144017.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 ref|XP_007144018.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 gb|ESW16011.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 gb|ESW16012.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
Length=365

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  QEN+GKLE DHKKA+ LA+GL ++ GL VD   VETNIVF DI     
Sbjct  241  IGILCAAALVALQENIGKLENDHKKARLLADGLRELKGLRVDTLGVETNIVFIDIEDGIQ  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
            T   ++CK L E G+L++ E   R+R V+HHQIS +DVQYALS
Sbjct  301  TRAEKICKYLEERGILLMQESSSRMRVVLHHQISASDVQYALS  343



>ref|XP_010489194.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010489200.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010489206.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 85/116 (73%), Gaps = 0/116 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G++V++ +VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIKVNVTAVETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             T  +L K L E+G+L++PE   RIR VIHHQI+ +DV Y LS +Q+AV  +   S
Sbjct  301  LTAEKLRKTLEENGILVIPEKSSRIRMVIHHQITTSDVHYTLSCLQQAVETIQEPS  356



>ref|XP_010475669.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010475670.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ V++ +VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQHDHKKAKLLAEGLNQLKGIRVNVTAVETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             T  +L K L E+G+L++PE   RIR VIHHQI+  DVQY LS +Q+A+  +   S
Sbjct  301  LTAGKLRKALEENGILVIPENSSRIRMVIHHQITTCDVQYTLSCLQQALQTIQEPS  356



>ref|NP_566228.1| threonine aldolase 2 [Arabidopsis thaliana]
 sp|Q9FPH3.1|THA2_ARATH RecName: Full=Probable low-specificity L-threonine aldolase 2; 
AltName: Full=Threonine aldolase 2 [Arabidopsis thaliana]
 gb|AAG40385.1|AF325033_1 AT3g04520 [Arabidopsis thaliana]
 gb|AAM14044.1| putative L-allo-threonine aldolase [Arabidopsis thaliana]
 gb|AAM62682.1| L-allo-threonine aldolase, putative [Arabidopsis thaliana]
 gb|AAM67566.1| putative L-allo-threonine aldolase [Arabidopsis thaliana]
 dbj|BAD43108.1| L-allo-threonine aldolase like protein [Arabidopsis thaliana]
 gb|AEE74091.1| threonine aldolase 2 [Arabidopsis thaliana]
Length=355

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV   ENV KLE DHKKA+ LAEGLN+I  L V++A+VETNI++ DI ++  
Sbjct  245  IGVLCAAALVALHENVAKLEDDHKKARVLAEGLNRIERLRVNVAAVETNIIYVDIPEDPK  304

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
                E CK L + GVL++P+   RIR V+HHQISD DV+Y LS
Sbjct  305  FGAEEACKSLEDVGVLVIPQATFRIRIVLHHQISDVDVEYVLS  347



>ref|XP_006305180.1| hypothetical protein CARUB_v10009546mg [Capsella rubella]
 gb|EOA38078.1| hypothetical protein CARUB_v10009546mg [Capsella rubella]
Length=358

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKK K LAEGLN++ G+ V++A+VETN++F D+   + 
Sbjct  241  IGVLCAAALVAIQENLPKLQHDHKKTKLLAEGLNQVKGIRVNVAAVETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             T  +L K L E+G+L++PE   RIR VIHHQI+ +DV Y LS +Q+A+  +   S
Sbjct  301  LTAEKLRKTLEENGILVIPENSSRIRMVIHHQITTSDVHYTLSCLQQALQTIQEPS  356



>ref|XP_006408182.1| hypothetical protein EUTSA_v10021036mg [Eutrema salsugineum]
 gb|ESQ49635.1| hypothetical protein EUTSA_v10021036mg [Eutrema salsugineum]
Length=352

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV   ENV KL+ DHKKAK LAEGLN+I  L VD+ +VETNI++ DI K+  
Sbjct  244  IGVLCAAALVALHENVAKLDDDHKKAKILAEGLNRIERLRVDVTAVETNIIYVDIPKDPK  303

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
                + CK L   GVL++P+   RIR V+HHQISD+DV+Y LS
Sbjct  304  FRAEDACKSLEVLGVLVIPQATFRIRIVLHHQISDSDVEYVLS  346



>ref|XP_003590970.1| L-allo-threonine aldolase [Medicago truncatula]
Length=463

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 86/132 (65%), Gaps = 7/132 (5%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAAALV  +ENVGKLE DHKK + LA+GLN+I GL V+  S+ETNI+F DI+  + 
Sbjct  298  IGILCAAALVALKENVGKLESDHKKTRLLADGLNEIKGLRVNPCSIETNIIFIDIVDGSR  357

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGDH*  231
            TT  ++ K L E G+L++ E   R+R V+HHQIS +DVQY LS  Q     +A       
Sbjct  358  TTTEKIFKYLEERGILLMQEKASRLRVVLHHQISASDVQYTLSCFQLYKLKMATS-----  412

Query  230  N*GNCYLCFKIF  195
              G   LC++I 
Sbjct  413  --GKIALCWRII  422



>ref|XP_009123981.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brassica 
rapa]
 ref|XP_009123982.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brassica 
rapa]
Length=360

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  +ENV KLE DHKKAK LAEGLN+I  L+VD+A+VETNI++ D+ K+  
Sbjct  244  IGVLCAAALVALRENVAKLEDDHKKAKILAEGLNRIERLKVDVAAVETNIIYVDLPKDPK  303

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  255
                + CK L   GV ++P+   RIR V+HHQISD+D+ Y LS  ++  + V
Sbjct  304  FGAEDACKSLEVLGVFVIPQTTFRIRIVLHHQISDSDLDYVLSCFEKLFSSV  355



>ref|XP_010553776.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Tarenaya hassleriana]
Length=339

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAAL+  QENV KLE DHKKAK LA+GLN+I G+ V+ A+VETNI+F ++   + 
Sbjct  222  IGVLCAAALIALQENVSKLEYDHKKAKILAQGLNQIKGIRVNAAAVETNIIFLEMEDSSR  281

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
                +L K L E+G+L++P    RIR VIHHQIS  DV + LS +Q+AV G    + D
Sbjct  282  LGAEKLRKNLEENGILVIPVNSSRIRIVIHHQISAGDVYHTLSCIQQAVNGAQEANVD  339



>ref|XP_010553775.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Tarenaya hassleriana]
Length=365

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAAL+  QENV KLE DHKKAK LA+GLN+I G+ V+ A+VETNI+F ++   + 
Sbjct  248  IGVLCAAALIALQENVSKLEYDHKKAKILAQGLNQIKGIRVNAAAVETNIIFLEMEDSSR  307

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
                +L K L E+G+L++P    RIR VIHHQIS  DV + LS +Q+AV G    + D
Sbjct  308  LGAEKLRKNLEENGILVIPVNSSRIRIVIHHQISAGDVYHTLSCIQQAVNGAQEANVD  365



>emb|CDY42933.1| BnaC05g47180D [Brassica napus]
Length=360

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  +ENV KLE DHK AK LAEGLN+I  L+V++A+VETNI++ D+ K+  
Sbjct  244  IGVLCAAALVALRENVAKLEDDHKNAKILAEGLNRIERLKVNVAAVETNIIYVDLPKDPK  303

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVA  252
                + CK L   GVL++P+   RIR V+HHQISD+D+ Y LS  ++  + VA
Sbjct  304  FGAEDACKSLEVLGVLVIPQTTFRIRIVLHHQISDSDLDYVLSCFEKLFSSVA  356



>emb|CDY49330.1| BnaA05g32920D [Brassica napus]
Length=360

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  +ENV KLE DHKKAK LAEGLN+I  L+VD+A+VETNI++ D+ K+  
Sbjct  244  IGVLCAAALVALRENVAKLEDDHKKAKILAEGLNRIERLKVDVAAVETNIIYVDLPKDPK  303

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  255
                + CK L    VL++P+   RIR V+HHQISD+D+ Y LS  ++  + V
Sbjct  304  FGAEDACKSLEVLSVLVIPQTTFRIRIVLHHQISDSDLDYVLSCFEKLFSSV  355



>ref|XP_002884450.1| hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60709.1| hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. 
lyrata]
Length=353

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV   ENV KLE DHKKA+ LAEGL++I  L V++A+VETNI++ DI ++  
Sbjct  245  IGVLCAAALVALHENVAKLEDDHKKARFLAEGLSRIERLRVNVAAVETNIIYVDIPEDPK  304

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
                E CK L + GVLI+P+   RIR V+HHQISD DV+Y LS
Sbjct  305  FGAEEACKSLEDVGVLIIPQATFRIRIVLHHQISDVDVEYVLS  347



>tpg|DAA36971.1| TPA: putative threonine aldolase family protein isoform 1 [Zea 
mays]
 tpg|DAA36972.1| TPA: putative threonine aldolase family protein isoform 2 [Zea 
mays]
Length=372

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 1/109 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  L VD +SVETN+VF DI+ +  
Sbjct  241  VGVLCAAAYVAVRDTVGKLADDHRKAKALAEGLKKIKQLTVDSSSVETNMVFFDIV-DPR  299

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             +  +LC+ L +  VL +P   K +RFVIH+QISD+DVQYAL+ V++AV
Sbjct  300  ISPSKLCQVLEQRNVLAMPASSKSVRFVIHYQISDSDVQYALTCVEKAV  348



>gb|KGN66766.1| hypothetical protein Csa_1G681120 [Cucumis sativus]
Length=121

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA LV  +ENV KLE DHKKAK LA GL +I GL++D  SVETNI+  +I  +  
Sbjct  4    IGILCAAGLVAIKENVQKLEADHKKAKQLASGLFQIKGLKIDPKSVETNIILFEIEDDYG  63

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGSGD  237
             +   LCK L E G+ ++ +   R R V HHQIS +DVQY LS  Q+ + G+   +G+
Sbjct  64   ISMETLCKSLEERGIFVMLQTQTRARIVFHHQISTSDVQYILSCFQQTLNGIKVVNGN  121



>ref|XP_010415759.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV   ENV KL  DHKKAK LAEGLN+I  L V++A+VETNI++ DI ++  
Sbjct  245  IGVLCAAALVALNENVPKLGDDHKKAKILAEGLNRIERLRVNVAAVETNIIYVDIPEDPK  304

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
                + CK L + GVL+LP+   RIR V+HHQISD DV+Y LS
Sbjct  305  FGAEDACKSLEDVGVLVLPQATFRIRIVLHHQISDVDVEYVLS  347



>ref|XP_006298023.1| hypothetical protein CARUB_v10014068mg [Capsella rubella]
 gb|EOA30921.1| hypothetical protein CARUB_v10014068mg [Capsella rubella]
Length=353

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV   ENV KL+ DHKKAK LAEGLN+I  L+V++A+VETNI++ DI ++  
Sbjct  245  IGVLCAAALVALNENVPKLDDDHKKAKILAEGLNRIERLKVNVAAVETNIIYVDIPEDPK  304

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR  270
                + CK L + GVL++P+   R+R V+HHQISD DV Y LS  Q+
Sbjct  305  FGAEDACKSLKDVGVLVIPQSTFRMRIVLHHQISDDDVDYVLSCFQK  351



>ref|XP_008661960.1| PREDICTED: L-allo-threonine aldolase isoform X1 [Zea mays]
 ref|XP_008661961.1| PREDICTED: L-allo-threonine aldolase isoform X1 [Zea mays]
 gb|ACG33933.1| L-allo-threonine aldolase [Zea mays]
 gb|AFW58856.1| putative threonine aldolase family protein [Zea mays]
Length=377

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++NVGKL  DH+KAK LA+GLNKI    VD ASV+TN+VF DI+ ++ 
Sbjct  242  VGVLCAAAHVAVRDNVGKLADDHRKAKALADGLNKIEQFRVDSASVQTNMVFLDIV-DSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             +  +LC+ L  H VL  P  PK +R V+H+QISD DVQYAL+  ++A   +  GS
Sbjct  301  ISSNKLCQVLGTHNVLASPRSPKSVRLVLHYQISDDDVQYALTCFKKAAEQLLMGS  356



>gb|ACG34432.1| L-allo-threonine aldolase [Zea mays]
Length=377

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V   +NVGKL  DH+KAK LA+GLNKI    VD ASV+TN+VF DI+ ++ 
Sbjct  242  VGVLCAAAHVAVHDNVGKLADDHRKAKALADGLNKIEQFRVDSASVQTNMVFLDIV-DSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             +  +LC+ L  H VL  P  PK +R V+H+QISD DVQYAL+  ++A   +  GS
Sbjct  301  ISSNKLCQVLGTHNVLASPRSPKSVRLVLHYQISDDDVQYALTCFKKAAEQLLMGS  356



>ref|XP_010458106.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010458107.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010458108.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVL AAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ V++ +VETN++F D+   + 
Sbjct  241  IGVLWAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIRVNVTAVETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             T  +L + L E+G+L++PE   RIR VIHHQI+ +DV Y LS +Q+AV  +   S
Sbjct  301  LTAEKLRRTLEENGILVIPENSSRIRMVIHHQITTSDVHYTLSCLQQAVQTIQEPS  356



>ref|XP_010463930.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV   ENV KL  DHKKAK LAEGLN+I  L V++A+VE+NI++ DI ++  
Sbjct  245  IGVLCAAALVALNENVPKLGDDHKKAKILAEGLNRIERLRVNVAAVESNIIYVDIPEDPK  304

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
                + CK L + GVL+LP+   RIR V+HHQISD DV+Y LS
Sbjct  305  FGAEDACKSLKDVGVLVLPQATFRIRIVLHHQISDVDVEYVLS  347



>ref|XP_008443794.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
 ref|XP_008443795.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
Length=360

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA LV  +ENV KLE DH KAK LA GL +I G++VD+ SVETNI+F +I +++ 
Sbjct  242  IGILCAAGLVALKENVQKLEADHHKAKQLASGLCQIKGIKVDLKSVETNIIFFEIEEDSQ  301

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  255
             +   LCK + EHG+L++ E   RIR V+HHQIS +DV+Y L  +++ + GV
Sbjct  302  ISAKLLCKSMEEHGILLMQESLSRIRIVLHHQISTSDVEYTLKCMKQFLCGV  353



>ref|XP_008802139.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Phoenix dactylifera]
Length=359

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ ++
Sbjct  241  VGVLCAAAYVALRDNVGKLEDDHKKAKLFADGLKQIKELTVDTSSVETNMVFLDIVESSH  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             +   LC+ L EHGVL +P     +R V+HHQI ++D++Y L+ +++AV
Sbjct  301  ISPERLCQVLEEHGVLAMPASSTSVRLVVHHQILESDIRYVLACMKQAV  349



>emb|CDY31134.1| BnaA08g26840D [Brassica napus]
Length=369

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ +++A+VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQFDHKKAKLLAEGLNQMKGIRINVAAVETNMIFMDMEDGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L E G+L+LP    RIR V+HHQI+ +DV Y LS +Q+A+
Sbjct  301  LTAEKLRKSLTECGILVLPGNSSRIRMVVHHQITISDVHYTLSCLQQAM  349



>ref|XP_009110878.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=369

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ +++A+VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQFDHKKAKLLAEGLNQMKGIRINVAAVETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L E G+L+LP    RIR V+HHQI+ +DV Y LS +Q+A+
Sbjct  301  LTAEKLRKSLTECGILVLPGNSSRIRMVVHHQITISDVHYTLSCLQQAM  349



>ref|XP_010485829.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAALV   ENV KL  DHKKAK LAEGLN+I    V++A+VETNI++ DI ++  
Sbjct  245  VGVLCAAALVALNENVPKLGDDHKKAKILAEGLNRIERFRVNVAAVETNIIYVDIPEDPK  304

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
                + CK L + GVL+LP+   RIR V+HHQISD DV+Y LS
Sbjct  305  FGAEDACKSLEDVGVLVLPQATFRIRIVLHHQISDVDVEYVLS  347



>ref|XP_003580135.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brachypodium 
distachyon]
 ref|XP_010240138.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brachypodium 
distachyon]
Length=372

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAA VG ++ VGKL  DH+KAK LAEGL KI    VD+ SVETN+VF DI  +  
Sbjct  241  VGILCAAAYVGVRDTVGKLADDHRKAKVLAEGLKKIKQFTVDLTSVETNMVFFDI-TDPR  299

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             +  +LC+ L +  VL +P   K +R VIH+QISDTDVQYAL+ +++ V  + +G+
Sbjct  300  ISPDKLCQVLEQRNVLAMPASSKSVRLVIHYQISDTDVQYALTCIEKVVEEILSGN  355



>ref|XP_002448187.1| hypothetical protein SORBIDRAFT_06g022630 [Sorghum bicolor]
 gb|EES12515.1| hypothetical protein SORBIDRAFT_06g022630 [Sorghum bicolor]
Length=372

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+VF DI+ +  
Sbjct  241  VGVLCAAAYVAVRDTVGKLADDHRKAKALAEGLKKIKQFTVDSSSVETNMVFFDIV-DPR  299

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             +  +LC+ L +  VL +P   K +RFV+H+QISD+DVQYAL+ V++AV
Sbjct  300  ISPNKLCQVLEQRNVLAMPASSKSVRFVVHYQISDSDVQYALTCVEKAV  348



>dbj|BAK03835.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++NVGKL  DH+KAK LA+GL KI    VD+ SVETN+VF DI  +  
Sbjct  243  VGVLCAAAYVAVRDNVGKLADDHRKAKVLADGLKKIKQFTVDLTSVETNMVFFDI-ADPR  301

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             T  +LC+ L    VL +P   K +R VIH+QISD+DVQY L+ +++AV  + +GS
Sbjct  302  ITSDKLCQLLERRNVLAMPGTSKSVRLVIHYQISDSDVQYTLTCIEKAVEEILSGS  357



>gb|ACF86035.1| unknown [Zea mays]
 tpg|DAA36966.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=231

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  + VD ASVETN+VF +++ +  
Sbjct  100  VGVLCAAAHVAVRDTVGKLADDHRKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPR  158

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             +  +LC+ L +  VL LP   K IRFVIH+QISD DV YAL+ V++A+  +  GS
Sbjct  159  ISPDKLCQVLEQDNVLALPANSKSIRFVIHYQISDADVGYALACVEKAIKELLEGS  214



>gb|AAM63785.1| unknown [Arabidopsis thaliana]
Length=358

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ V++A+VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L E+G+L++     RIR VIHHQI+ +DV Y LS  Q+A+
Sbjct  301  LTAEKLRKNLEENGILLIRGKSSRIRIVIHHQITTSDVHYTLSXFQQAM  349



>ref|NP_001189807.1| threonine aldolase 2 [Arabidopsis thaliana]
 gb|AEE74092.1| threonine aldolase 2 [Arabidopsis thaliana]
Length=354

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV   ENV KLE DHKKA+ LA GLN+I  L V++A+VETNI++ DI ++  
Sbjct  245  IGVLCAAALVALHENVAKLEDDHKKARVLA-GLNRIERLRVNVAAVETNIIYVDIPEDPK  303

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
                E CK L + GVL++P+   RIR V+HHQISD DV+Y LS
Sbjct  304  FGAEEACKSLEDVGVLVIPQATFRIRIVLHHQISDVDVEYVLS  346



>ref|NP_563822.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_849614.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_849615.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_001031001.2| threonine aldolase [Arabidopsis thaliana]
 sp|Q8RXU4.1|THA1_ARATH RecName: Full=Probable low-specificity L-threonine aldolase 1; 
AltName: Full=Threonine aldolase 1 [Arabidopsis thaliana]
 gb|AAL86346.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51302.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01898.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28320.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28321.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28322.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28323.1| threonine aldolase [Arabidopsis thaliana]
Length=358

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ V++A+VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L E+G+L++     RIR VIHHQI+ +DV Y LS  Q+A+
Sbjct  301  LTAEKLRKNLEENGILLIRGNSSRIRIVIHHQITTSDVHYTLSCFQQAM  349



>emb|CAE05443.2| OSJNBa0073E02.3 [Oryza sativa Japonica Group]
Length=349

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAA V  ++ VGKL  DH++AK LA+GL KI    VD  SVETN+VF DI+ ++ 
Sbjct  218  VGILCAAAYVAVRDTVGKLADDHRRAKVLADGLKKIKHFRVDTTSVETNMVFFDIV-DSR  276

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             +  +LC+ L +  VL +P G K +R VIH+QISD+DVQYAL+ V++A   +  GS
Sbjct  277  ISPDKLCQVLEQRNVLAMPAGSKSMRLVIHYQISDSDVQYALTCVEKAAEEILTGS  332



>ref|NP_001053314.1| Os04g0516600 [Oryza sativa Japonica Group]
 emb|CAD41482.2| OSJNBb0072M01.18 [Oryza sativa Japonica Group]
 dbj|BAF15228.1| Os04g0516600 [Oryza sativa Japonica Group]
 emb|CAH67219.1| OSIGBa0145M07.1 [Oryza sativa Indica Group]
 dbj|BAG94039.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87066.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77644.1| hypothetical protein OsI_16646 [Oryza sativa Indica Group]
 gb|EEE61341.1| hypothetical protein OsJ_15466 [Oryza sativa Japonica Group]
Length=372

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAA V  ++ VGKL  DH++AK LA+GL KI    VD  SVETN+VF DI+ ++ 
Sbjct  241  VGILCAAAYVAVRDTVGKLADDHRRAKVLADGLKKIKHFRVDTTSVETNMVFFDIV-DSR  299

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             +  +LC+ L +  VL +P G K +R VIH+QISD+DVQYAL+ V++A   +  GS
Sbjct  300  ISPDKLCQVLEQRNVLAMPAGSKSMRLVIHYQISDSDVQYALTCVEKAAEEILTGS  355



>ref|XP_008453666.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Cucumis melo]
Length=400

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 79/118 (67%), Gaps = 2/118 (2%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA LV  +ENV KLE DH+KAK LA GL +I GL+VD  SVETNI+F +I  +  
Sbjct  283  IGILCAAGLVAIKENVQKLEADHEKAKQLASGLYQIKGLKVDPKSVETNIIFFEIEDDYG  342

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG--VANGS  243
             +   LCK L E G+ ++ E   R R V+HHQIS +DVQY LS  ++ + G  V NG+
Sbjct  343  ISMETLCKTLEERGIFMMLESQTRARIVLHHQISTSDVQYTLSCFKQTLNGIKVVNGN  400



>ref|XP_008453667.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Cucumis melo]
Length=392

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 79/118 (67%), Gaps = 2/118 (2%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA LV  +ENV KLE DH+KAK LA GL +I GL+VD  SVETNI+F +I  +  
Sbjct  275  IGILCAAGLVAIKENVQKLEADHEKAKQLASGLYQIKGLKVDPKSVETNIIFFEIEDDYG  334

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG--VANGS  243
             +   LCK L E G+ ++ E   R R V+HHQIS +DVQY LS  ++ + G  V NG+
Sbjct  335  ISMETLCKTLEERGIFMMLESQTRARIVLHHQISTSDVQYTLSCFKQTLNGIKVVNGN  392



>tpg|DAA45471.1| TPA: hypothetical protein ZEAMMB73_239903 [Zea mays]
Length=194

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G LCAAA V  ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+VF DI+ + +
Sbjct  75   VGFLCAAAYVAVRDTVGKLADDHRKAKALAEGLTKIKQFTVDSSSVETNMVFFDIV-DPH  133

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
             +  +LC+ L +  VL +P   K +RFVIH+QI D+DVQYAL+ V+
Sbjct  134  ISPSKLCQVLEQRNVLAMPASSKSVRFVIHYQILDSDVQYALTCVE  179



>ref|XP_002892465.1| hypothetical protein ARALYDRAFT_470930 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68724.1| hypothetical protein ARALYDRAFT_470930 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV   EN+ KL+ DHKKAK LAEGLN++ G+ V++A+VETN++F D+   + 
Sbjct  241  IGVLCAAALVALHENLPKLQHDHKKAKLLAEGLNQMKGIRVNVAAVETNMIFMDMEDGSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             T  +L K L E+G+L++     RIR VIHHQI+ +DV Y LS  Q+A+  +   S
Sbjct  301  LTAEKLRKSLEENGILLIRGNSSRIRMVIHHQITTSDVHYTLSCFQQAMQTIQEPS  356



>ref|NP_001241763.1| L-allo-threonine aldolase [Zea mays]
 gb|ACG36649.1| L-allo-threonine aldolase [Zea mays]
Length=370

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 82/116 (71%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ +GKL  DH+KAK LA GL KI  + VD ASVETN+VF +++ +  
Sbjct  239  VGVLCAAAHVAVRDTMGKLADDHRKAKALAVGLKKIEQITVDPASVETNMVFFEVM-DPR  297

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             +  +LC+ L +H VL +P   K IRFV+H+QISD DV+YAL+ VQ+A+  +  GS
Sbjct  298  ISPDKLCQVLEQHNVLAMPANSKSIRFVVHYQISDADVRYALACVQKAIKELLEGS  353



>ref|XP_008655940.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X2 [Zea mays]
Length=198

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G LCAAA V  ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+VF DI+ + +
Sbjct  75   VGFLCAAAYVAVRDTVGKLADDHRKAKALAEGLTKIKQFTVDSSSVETNMVFFDIV-DPH  133

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
             +  +LC+ L +  VL +P   K +RFVIH+QI D+DVQYAL+ V+
Sbjct  134  ISPSKLCQVLEQRNVLAMPASSKSVRFVIHYQILDSDVQYALTCVE  179



>ref|NP_001149239.1| L-allo-threonine aldolase [Zea mays]
 gb|ACG34688.1| L-allo-threonine aldolase [Zea mays]
 gb|AFW58857.1| putative threonine aldolase family protein [Zea mays]
Length=375

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 3/116 (3%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++NVGKL  DH+KAK LA+GLNKI    VD ASV+TN+VF DI+ ++ 
Sbjct  242  VGVLCAAAHVAVRDNVGKLADDHRKAKALADGLNKIEQFRVDSASVQTNMVFLDIV-DSR  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             +  +LC+ L  H VL  P  PKR+  V+H+QISD DVQYAL+  ++A   +  GS
Sbjct  301  ISSNKLCQVLGTHNVLASPRSPKRL--VLHYQISDDDVQYALTCFKKAAEQLLMGS  354



>ref|XP_008655935.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X1 [Zea mays]
Length=216

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G LCAAA V  ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+VF DI+ + +
Sbjct  93   VGFLCAAAYVAVRDTVGKLADDHRKAKALAEGLTKIKQFTVDSSSVETNMVFFDIV-DPH  151

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
             +  +LC+ L +  VL +P   K +RFVIH+QI D+DVQYAL+ V+
Sbjct  152  ISPSKLCQVLEQRNVLAMPASSKSVRFVIHYQILDSDVQYALTCVE  197



>ref|XP_008667491.1| PREDICTED: putative threonine aldolase family protein isoform 
X1 [Zea mays]
 tpg|DAA36968.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=370

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  + VD ASVETN+VF +++ +  
Sbjct  239  VGVLCAAAHVAVRDTVGKLADDHRKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPR  297

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             +  +LC+ L +  VL LP   K IRFVIH+QISD DV YAL+ V++A+  +  GS
Sbjct  298  ISPDKLCQVLEQDNVLALPANSKSIRFVIHYQISDADVGYALACVEKAIKELLEGS  353



>ref|NP_001242307.1| uncharacterized protein LOC100790890 [Glycine max]
 gb|ACU17690.1| unknown [Glycine max]
Length=360

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = -1

Query  554  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  375
            QENVGKLE DHKKA+ LA+GL ++ GL VD  SVETN+VF DI +   T   ++CK + E
Sbjct  253  QENVGKLESDHKKARLLADGLKEVKGLRVDAGSVETNMVFIDIEEGTKTRAEKICKYMEE  312

Query  374  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR--AVTGVANGSGD  237
             G+L++ E   R+R V+HHQIS +DVQYALS  Q+  AV GV N  G+
Sbjct  313  RGILVMQESSSRMRVVLHHQISASDVQYALSCFQQALAVKGVQNEMGN  360



>ref|XP_006588445.1| PREDICTED: uncharacterized protein LOC100790890 isoform X1 [Glycine 
max]
 gb|KHN14818.1| L-allo-threonine aldolase [Glycine soja]
Length=360

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = -1

Query  554  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  375
            QENVGKLE DHKKA+ LA+GL ++ GL VD  SVETN+VF DI +   T   ++CK + E
Sbjct  253  QENVGKLESDHKKARLLADGLKEVKGLRVDAGSVETNMVFIDIEEGTKTRAEKICKYMEE  312

Query  374  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR--AVTGVANGSGD  237
             G+L++ E   R+R V+HHQIS +DVQYALS  Q+  AV GV N  G+
Sbjct  313  RGILVMQESSSRMRVVLHHQISASDVQYALSCFQQALAVKGVQNEMGN  360



>gb|EMS67121.1| L-allo-threonine aldolase [Triticum urartu]
Length=367

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA VG ++ VGKL  DH+KAK LA+GL KI    VD++SVETN+VF D + +  
Sbjct  241  VGVLCAAAEVGVRDTVGKLADDHRKAKVLADGLKKIKQFTVDLSSVETNMVFFD-MADPR  299

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             +  +LC+ L +  VL +P   K +RFV+H+QISD+D+QY L  ++ AV
Sbjct  300  ISPAKLCQALKQRNVLAMPTSSKSVRFVVHYQISDSDIQYTLKCIEEAV  348



>ref|XP_004155692.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=358

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 77/118 (65%), Gaps = 2/118 (2%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA LV  +ENV KLE DHKKAK LA GL +I GL++D  SVETNI+  +I  +  
Sbjct  241  IGILCAAGLVAIKENVQKLEADHKKAKQLASGLFQIKGLKIDPKSVETNIILFEIEDDYG  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG--VANGS  243
             +   LCK L E G+ ++ +   R R V HHQIS +DVQY LS  Q+ + G  V NG+
Sbjct  301  ISMETLCKSLEERGIFVMLQTQTRARIVFHHQISTSDVQYILSCFQQTLNGIKVVNGN  358



>ref|XP_009389078.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Musa 
acuminata subsp. malaccensis]
Length=359

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAA V  Q+NV KLE DH+KAK  A+GL +I  L VD +SVETN+VF +I + + 
Sbjct  241  IGVLCAAAYVALQDNVVKLEDDHRKAKIFADGLKEIKQLRVDSSSVETNMVFFNINESSM  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             + + LC+ L + GVL +P     +R VIH+QIS++DV YAL+ +++A+
Sbjct  301  ISPISLCEALEKFGVLAMPASSTSVRVVIHYQISESDVHYALTSIKQAI  349



>gb|EMS52584.1| L-allo-threonine aldolase [Triticum urartu]
Length=349

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAA +  ++ VGKL  DH+KAK LA+GL KI    VD+ASVETN+VF DI  +  
Sbjct  218  VGILCAAAYLAVRDTVGKLADDHRKAKVLADGLTKIKQFTVDLASVETNMVFFDI-ADPR  276

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             T  +LC+ L +  VL +P   K +R V H+QISD+DVQY L+ +++AV  + +G+
Sbjct  277  ITPDKLCQVLEQRNVLAMPASSKSVRLVTHYQISDSDVQYTLTCIEKAVEEILSGN  332



>ref|XP_007030423.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 ref|XP_007030426.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 gb|EOY10925.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 gb|EOY10928.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
Length=359

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G +CAAA V  QENVGKLEGDHKKAK LAEGLN+I GL VD+A+V+TNI++ DI++ + 
Sbjct  241  VGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIIYFDIVEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGPKR  339
             T  +L K L EHGVL++PEGP R
Sbjct  301  LTAEKLYKNLEEHGVLVMPEGPAR  324



>gb|AAF63783.1| L-allo-threonine aldolase, putative [Arabidopsis thaliana]
Length=370

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 72/103 (70%), Gaps = 6/103 (6%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV   ENV KLE DHKKA+ LAEGLN+I  L V++A+VETNIV      E  
Sbjct  245  IGVLCAAALVALHENVAKLEDDHKKARVLAEGLNRIERLRVNVAAVETNIVNPKFGAE--  302

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
                E CK L + GVL++P+   RIR V+HHQISD DV+Y LS
Sbjct  303  ----EACKSLEDVGVLVIPQATFRIRIVLHHQISDVDVEYVLS  341



>emb|CDY54493.1| BnaCnng27100D [Brassica napus]
Length=315

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ +++A+VETN++F D+   + 
Sbjct  199  IGVLCAAALVALQENLPKLQFDHKKAKLLAEGLNQMKGIRINVAAVETNMIFMDMEDGSK  258

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRA  267
             T  +L K L E G+L+LP    RIR VI+H I+ +DV Y LS +Q+A
Sbjct  259  LTAEKLRKSLTECGILVLPGNSSRIRMVIYHHIT-SDVHYTLSCLQQA  305



>ref|XP_010906817.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Elaeis guineensis]
Length=335

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  QEN+GKLE DH+KAK  A+GL +I  L +D  SVETN++F  I   + 
Sbjct  217  VGVLCAAAYVALQENIGKLEDDHRKAKIFADGLKQIKELSIDATSVETNMIFFSIADSSL  276

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             +   LC+ L  HG+L +P     +R V+H+QIS+ DV YAL+ ++ AV
Sbjct  277  ISPKRLCQVLEVHGILAMPASSTSVRLVLHYQISENDVYYALTCIKHAV  325



>ref|XP_010906814.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
 ref|XP_010906816.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
Length=359

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  QEN+GKLE DH+KAK  A+GL +I  L +D  SVETN++F  I   + 
Sbjct  241  VGVLCAAAYVALQENIGKLEDDHRKAKIFADGLKQIKELSIDATSVETNMIFFSIADSSL  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             +   LC+ L  HG+L +P     +R V+H+QIS+ DV YAL+ ++ AV
Sbjct  301  ISPKRLCQVLEVHGILAMPASSTSVRLVLHYQISENDVYYALTCIKHAV  349



>dbj|BAJ93201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA VG ++ +GKL  DH+KAK LA+GL KI    VD+ SVETN+VF   + +  
Sbjct  241  VGVLCAAAEVGVRDTIGKLTDDHRKAKVLADGLKKIEQFTVDLTSVETNMVFFH-MADPR  299

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +LCK L +  VL +P   K +R V+H+QISD+DVQY L+ +++AV
Sbjct  300  ITPAKLCKVLEQRNVLAMPTSSKSVRLVVHYQISDSDVQYTLTCIEKAV  348



>ref|XP_004142582.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=365

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA LV  +ENV KLE DH KAK LA GL +I GL+V+  SVETNI+F +I +++ 
Sbjct  242  IGILCAAGLVAIKENVQKLEADHHKAKQLASGLCQIKGLKVNPKSVETNIIFFEIEEDSQ  301

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  285
             +   LC+ + E G+L++ E   RIR V+HHQIS +DVQY L
Sbjct  302  ISAKLLCESMKERGILLMQESLSRIRIVVHHQISTSDVQYTL  343



>ref|XP_006857300.1| hypothetical protein AMTR_s00067p00056150 [Amborella trichopoda]
 gb|ERN18767.1| hypothetical protein AMTR_s00067p00056150 [Amborella trichopoda]
Length=358

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 79/109 (72%), Gaps = 1/109 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAALV  ++ V KLE DH+KAK LA+GLN + GL+VD+ASVETN+VF +I  +  
Sbjct  241  VGILCAAALVALRDIVPKLEEDHQKAKILADGLNHVKGLKVDLASVETNLVFFEITDKRV  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T E +  + L + G+L+LP     IR V+HHQIS +DVQY LS + +AV
Sbjct  301  TAE-KFSQVLNDRGILVLPISSCSIRIVLHHQISFSDVQYTLSYITQAV  348



>ref|XP_006652519.1| PREDICTED: uncharacterized protein R102.4-like [Oryza brachyantha]
Length=372

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+LCAAA V  ++ VGKL  DH++AK LA+GL KI    VD  SVETN+VF DI+ ++ 
Sbjct  241  VGILCAAAYVAVRDTVGKLADDHRRAKVLADGLKKIKHFRVDSTSVETNMVFFDIV-DSR  299

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
             +  +LC+ L    VL +P   K +R V+H+QISD+DVQYAL+ +++A   +  GS
Sbjct  300  ISPNKLCQILEHRNVLAMPASSKSMRLVVHYQISDSDVQYALACLEKAAEEILTGS  355



>ref|XP_008802138.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Phoenix 
dactylifera]
Length=359

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 78/119 (66%), Gaps = 1/119 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  QEN+ KLE DH+KAK  A+GL +I  L +D  SVETN++F  I+  + 
Sbjct  241  VGVLCAAAYVALQENIRKLEDDHRKAKIFADGLKQIKELSIDATSVETNMIFFSIVDSSL  300

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG-VANGSGD  237
             +   LC+ L E G+L +P     +R V+H+QIS+ DV YAL+ +++ V   V NG+ +
Sbjct  301  MSPKRLCQVLEERGILAMPASSTSVRLVLHYQISENDVYYALTCIKQLVQQMVTNGTAE  359



>ref|XP_004976222.1| PREDICTED: uncharacterized protein R102.4-like [Setaria italica]
Length=372

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  +++V KL  DH++AK LAEGLNK+    VD  SVETN+VF DI+ ++ 
Sbjct  241  VGVLCAAAHVAVRDSVEKLADDHRRAKALAEGLNKMEQFTVDSTSVETNMVFFDIV-DSR  299

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             +  +LC+ L +H V + P  PK +R V+H+ ISD+DVQYAL+  ++ V
Sbjct  300  ISSYKLCQILEKHNVHVNPRSPKSVRLVLHYHISDSDVQYALTCFEKVV  348



>ref|XP_008667492.1| PREDICTED: putative threonine aldolase family protein isoform 
X2 [Zea mays]
Length=360

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  + VD ASVETN+VF +++ +  
Sbjct  239  VGVLCAAAHVAVRDTVGKLADDHRKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPR  297

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
             +  +LC+ L +  VL LP   K IRFVIH+QISD DV YAL+ V+
Sbjct  298  ISPDKLCQVLEQDNVLALPANSKSIRFVIHYQISDADVGYALACVE  343



>gb|AAF99780.1|AC003981_30 F22O13.11 [Arabidopsis thaliana]
Length=352

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 76/109 (70%), Gaps = 6/109 (6%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LAEGLN++ G+ V++A+VETN      +  + 
Sbjct  241  IGVLCAAALVALQENLPKLQHDHKKAKLLAEGLNQMKGIRVNVAAVETN------MDGSR  294

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L E+G+L++     RIR VIHHQI+ +DV Y LS  Q+A+
Sbjct  295  LTAEKLRKNLEENGILLIRGNSSRIRIVIHHQITTSDVHYTLSCFQQAM  343



>gb|KHG00003.1| ltaA [Gossypium arboreum]
Length=326

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G +CAAA V  +ENV KLEGDHKKAK LAEGLN+I GL V++A+VETNI+F DI++ + 
Sbjct  241  LGFICAAAFVALKENVAKLEGDHKKAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSK  300

Query  410  TTEMELCKRLAEHGVLILPEGP  345
             T  +L K+L EHGVL++ EGP
Sbjct  301  ITAEKLYKKLEEHGVLVMLEGP  322



>gb|ABR18450.1| unknown [Picea sitchensis]
Length=379

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 68/103 (66%), Gaps = 0/103 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAA LV   + VG+L+ DH K + LAEGLN I GL V++ +V TNIVF +I  ++ 
Sbjct  257  VGVLCAAGLVALHDMVGRLKDDHHKCRILAEGLNGIDGLHVNLDAVHTNIVFVNITADSI  316

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
                ELC+ +   GVL +P    R RFV HHQIS+ D++Y L+
Sbjct  317  PGAEELCEAMKHEGVLAIPMSHTRFRFVTHHQISEDDIRYTLA  359



>ref|XP_004976228.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Setaria 
italica]
Length=372

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = -1

Query  554  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  375
            ++ VGKL  DH+KAK LAEGL KI   +VD ASVETN+VF DI+ +   +   LC+ L +
Sbjct  253  RDTVGKLADDHRKAKALAEGLKKIKQFKVDSASVETNMVFFDIM-DPRISPDRLCQVLEQ  311

Query  374  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVANGS  243
              VL +P   K +RFV+H+QISD+DV+YAL+ V++AV  +  GS
Sbjct  312  RNVLAMPASSKSMRFVLHYQISDSDVKYALTCVEKAVEELLKGS  355



>gb|KHG00004.1| ltaA [Gossypium arboreum]
Length=362

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G +CAAA V  +ENV KLEGDHKKAK LAEGLN+I GL V++A+VETNI+F DI++ + 
Sbjct  277  LGFICAAAFVALKENVAKLEGDHKKAKVLAEGLNQIKGLRVNVAAVETNIIFFDIVEGSK  336

Query  410  TTEMELCKRLAEHGVLILPEGP  345
             T  +L K+L EHGVL++ EGP
Sbjct  337  ITAEKLYKKLEEHGVLVMLEGP  358



>gb|EPS60604.1| hypothetical protein M569_14199, partial [Genlisea aurea]
Length=322

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAAL+   ENV KLE DHKKAK LAEGLNKI GL VD+ASVETNIVF D+L+++ 
Sbjct  241  VGVLCAAALIAVDENVDKLESDHKKAKILAEGLNKIKGLHVDLASVETNIVFFDVLEDSC  300

Query  410  TTEMELCKRLAEHGVLILPEGP  345
             T+ +L K L  +GV  + EGP
Sbjct  301  ITKDDLLKSLEAYGVYAMSEGP  322



>ref|XP_006605267.1| PREDICTED: uncharacterized protein LOC102668529 [Glycine max]
Length=127

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -1

Query  497  GLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGVLILPEGPKRIRFVIHH  318
            GLN+I GL VD++SVETNI++ +I + + TT  +LCK L ++G+L++P    R+R V HH
Sbjct  41   GLNEIKGLRVDISSVETNIIYVEIEEGSRTTAAKLCKDLEDYGILLMPMDSSRLRIVFHH  100

Query  317  QISDTDVQYALSRVQRAVTGVANGSGD  237
            QIS TDVQYALS  Q+AV GV N +G+
Sbjct  101  QISATDVQYALSCFQQAVNGVRNENGN  127



>gb|KJB44863.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=339

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 5/92 (5%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNI-----VFCDI  426
            +G +CAAA V  +ENV KL+GDHKKAK LAEGLN+I GL+VD+A+VETNI     ++ DI
Sbjct  241  VGFICAAAFVALKENVEKLDGDHKKAKELAEGLNQIKGLKVDIAAVETNIALFQQIYVDI  300

Query  425  LKEANTTEMELCKRLAEHGVLILPEGPKRIRF  330
            ++ +  T  +L K L EHGVL++P+G  R  F
Sbjct  301  VEGSKITAEKLYKNLEEHGVLVMPKGLSRSVF  332



>ref|XP_004976227.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Setaria 
italica]
Length=374

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -1

Query  554  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  375
            ++ VGKL  DH+KAK LAEGL KI   +VD ASVETN+VF DI+ +   +   LC+ L +
Sbjct  253  RDTVGKLADDHRKAKALAEGLKKIKQFKVDSASVETNMVFFDIM-DPRISPDRLCQVLEQ  311

Query  374  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
              VL +P   K +RFV+H+QISD+DV+YAL+ V+
Sbjct  312  RNVLAMPASSKSMRFVLHYQISDSDVKYALTCVE  345



>ref|XP_008802141.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Phoenix dactylifera]
Length=333

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++NVGKLE DHKKAK  A+GL +I  L VD +SVETN+VF DI++ ++
Sbjct  241  VGVLCAAAYVALRDNVGKLEDDHKKAKLFADGLKQIKELTVDTSSVETNMVFLDIVESSH  300

Query  410  TTEMELCKRLAEHGVLILPEGPKR  339
             +   LC+ L EHGVL +P    R
Sbjct  301  ISPERLCQVLEEHGVLAMPASSTR  324



>ref|XP_010520652.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Tarenaya 
hassleriana]
Length=349

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGV+CAAAL+   EN+ KLEGDHKKAK LAEGLN+I  + VD+A+VETNI++ DI ++  
Sbjct  259  IGVICAAALMALHENLPKLEGDHKKAKFLAEGLNRIDRVRVDVAAVETNIIYIDIPEDPK  318

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIH  321
             T  + CK L   GV ++P+   + R+VI+
Sbjct  319  FTAEDACKSLEHVGVHVIPQ--SKFRYVIY  346



>ref|WP_020877756.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Desulfococcus multivorans]
 gb|EPR35940.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Desulfococcus multivorans DSM 2059]
Length=347

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 69/112 (62%), Gaps = 1/112 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GV+ AA +V   E V +L  DH  A+ LAEGL +I+G+ VD A V TNIV+ D+ +  + 
Sbjct  237  GVIAAAGIVALTEMVDRLPEDHANARKLAEGLAEIAGVAVDPAGVRTNIVYFDVTRP-DM  295

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVA  252
                L +R+   GV +L  GP+RIR V H+Q+S  D++ ALS  +R + G A
Sbjct  296  DAQALARRMKASGVALLAAGPRRIRAVTHYQVSAGDIEAALSAFRRVLAGDA  347



>ref|NP_001077492.1| threonine aldolase [Arabidopsis thaliana]
 dbj|BAH19728.1| AT1G08630 [Arabidopsis thaliana]
 gb|AEE28324.1| threonine aldolase [Arabidopsis thaliana]
Length=344

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 68/109 (62%), Gaps = 14/109 (13%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DHKKAK LA              +VETN++F D+   + 
Sbjct  241  IGVLCAAALVALQENLPKLQHDHKKAKLLA--------------AVETNMIFMDMEDGSR  286

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             T  +L K L E+G+L++     RIR VIHHQI+ +DV Y LS  Q+A+
Sbjct  287  LTAEKLRKNLEENGILLIRGNSSRIRIVIHHQITTSDVHYTLSCFQQAM  335



>ref|XP_001768407.1| predicted protein [Physcomitrella patens]
 gb|EDQ66769.1| predicted protein [Physcomitrella patens]
Length=383

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 70/114 (61%), Gaps = 0/114 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+L AA LV  ++ V +L  DH  AK +AEGLN + GL VDM+ VETNIV+ ++  ++ 
Sbjct  250  VGILAAAGLVAMRDMVDRLNVDHANAKLMAEGLNAVKGLRVDMSIVETNIVYAEVTDDSV  309

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVAN  249
             T  E+ +   E+GVL +  G   IR + H+QI++ DV +ALS  +      AN
Sbjct  310  LTPKEIVEAWKEYGVLAMTWGRNMIRVLTHYQITEDDVLFALSFFKTTSLQAAN  363



>emb|CDY59150.1| BnaC08g13650D, partial [Brassica napus]
Length=447

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 64/90 (71%), Gaps = 2/90 (2%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IGVLCAAALV  QEN+ KL+ DH KAK LAEGLN+++G+ +++A+VETN++F D+   + 
Sbjct  351  IGVLCAAALVALQENLPKLQFDHNKAKLLAEGLNQMTGIRINVAAVETNMIFMDMEDGSK  410

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIH  321
             T  +L K L E G+L+LP      R+V H
Sbjct  411  LTAEKLRKSLTECGILVLPGNSS--RYVSH  438



>ref|WP_011697570.1| threonine aldolase [Syntrophobacter fumaroxidans]
 gb|ABK16397.1| L-threonine aldolase [Syntrophobacter fumaroxidans MPOB]
Length=353

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 68/108 (63%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA +V   E V +L  DH  A+ LAEGL+ ++GL VD+  V+TNIVF D+ +E + 
Sbjct  237  GILAAAGIVALDEMVTRLAEDHANARALAEGLSTMTGLSVDLEFVKTNIVFIDVERE-DL  295

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T   L  RL   GVL+   GP+R+R V H+ +S  D+ + L+  ++A+
Sbjct  296  TAPVLAARLKPDGVLVQVTGPRRMRAVTHYGVSAEDIDFTLTAFKKAM  343



>ref|XP_008453668.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X3 [Cucumis melo]
Length=382

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 66/105 (63%), Gaps = 5/105 (5%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA LV  +ENV KLE DH+KAK LA GL +I GL+VD  SVETNI+F +I  +  
Sbjct  283  IGILCAAGLVAIKENVQKLEADHEKAKQLASGLYQIKGLKVDPKSVETNIIFFEIEDDYG  342

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRV  276
             +   LCK L E G+ ++ E   R +     Q+  + +  ALS++
Sbjct  343  ISMETLCKTLEERGIFMMLESQTRFQ-----QVMFSTLYLALSKL  382



>ref|XP_004976226.1| PREDICTED: uncharacterized protein R102.4-like [Setaria italica]
Length=321

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ +GKLE DH+KAK LAEGL KI  + VD ASVETN+VF DI     
Sbjct  239  VGVLCAAAQVAVRDTLGKLEDDHRKAKALAEGLKKIKHITVDPASVETNMVFFDITNPRI  298

Query  410  TTEMELCKRLAEHGVLILPEGPKR  339
            + +  LC+ L +H VL +P   KR
Sbjct  299  SPD-NLCQVLEQHNVLAMPASSKR  321



>ref|WP_027408853.1| threonine aldolase [Anoxybacillus tepidamans]
Length=343

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL A  ++  ++ V +L  DH  A+ LAEGL  + GL VD+A VETNIV CDI K    
Sbjct  236  GVLAAPGIIALEKMVDRLAEDHANARQLAEGLAAVPGLHVDVAGVETNIVLCDI-KGTGL  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            +  E   RL E G+L +P     IRFV H +++   VQ A+ R+++ V
Sbjct  295  SNKEFLTRLKEAGILAVPFDEGVIRFVTHREVTSDMVQTAIERIRQLV  342



>dbj|BAK01917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 56/88 (64%), Gaps = 1/88 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++NVGKL  DH+KAK LA+GL KI    VD+ SVETN+VF DI  +  
Sbjct  243  VGVLCAAAYVAVRDNVGKLADDHRKAKVLADGLKKIKQFTVDLTSVETNMVFFDI-ADPR  301

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFV  327
             T  +LC+ L    VL +P   KR   V
Sbjct  302  ITSDKLCQLLERRNVLAMPGTSKRFNSV  329



>ref|XP_002975719.1| hypothetical protein SELMODRAFT_103881 [Selaginella moellendorffii]
 gb|EFJ23348.1| hypothetical protein SELMODRAFT_103881 [Selaginella moellendorffii]
Length=358

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+L A  LV  ++ V +L  DH  A+ LAEGL  + GL+VDM++VETNIV  D+ K   
Sbjct  246  VGILAAPGLVALKDMVCRLYEDHSNARLLAEGLCGMKGLQVDMSAVETNIVNVDVTKSRF  305

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
            T E ELC+ + + G+L        IR V H+ IS+ DV+Y L+  Q
Sbjct  306  TAE-ELCRAMGKIGILSYDLTKTSIRLVTHYHISEDDVRYTLACFQ  350



>ref|XP_002973664.1| hypothetical protein SELMODRAFT_99781 [Selaginella moellendorffii]
 gb|EFJ25324.1| hypothetical protein SELMODRAFT_99781 [Selaginella moellendorffii]
Length=358

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+L A  LV  ++ V +L  DH  A+ LAEGL  + GL+VDM++VETNIV  D+ K   
Sbjct  246  VGILAAPGLVALKDMVCRLYEDHSNARLLAEGLCGMKGLQVDMSAVETNIVNVDVTKSRF  305

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
            T E ELC+ + + G+L        IR V H+ IS+ DV+Y L+  Q
Sbjct  306  TAE-ELCRAMGKIGILSYDLTKTSIRLVTHYHISEDDVRYTLACFQ  350



>ref|XP_008655946.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X3 [Zea mays]
Length=191

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G LCAAA V  ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+VF DI+ + +
Sbjct  93   VGFLCAAAYVAVRDTVGKLADDHRKAKALAEGLTKIKQFTVDSSSVETNMVFFDIV-DPH  151

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRF  330
             +  +LC+ L +  VL +P   K   F
Sbjct  152  ISPSKLCQVLEQRNVLAMPASSKSRYF  178



>gb|KGN66765.1| hypothetical protein Csa_1G680120 [Cucumis sativus]
Length=331

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA LV  +ENV KLE DH KAK LA GL +I GL+V+  SVETNI+F +I +++ 
Sbjct  242  IGILCAAGLVAIKENVQKLEADHHKAKQLASGLCQIKGLKVNPKSVETNIIFFEIEEDSQ  301

Query  410  TTEMELCKRLAEHGVLILPEGPKR  339
             +   LC+ + E G+L++ E   R
Sbjct  302  ISAKLLCESMKERGILLMQESLSR  325



>ref|XP_005854754.1| threonine aldolase, partial [Nannochloropsis gaditana CCMP526]
 gb|EKU21599.1| threonine aldolase, partial [Nannochloropsis gaditana CCMP526]
Length=283

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVL AA LV  +  + +L  DH+ A+ LA+GL+ + GL+V++ +VETNIV  D      
Sbjct  177  VGVLAAAGLVALKRTLPRLAEDHENARRLAKGLSTLPGLKVNVEAVETNIVMIDFEDRLP  236

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
             +  EL + L    VL L  GP+RIR V H+ +S+ D++ A++
Sbjct  237  LSPPELLEELERRNVLALAVGPRRIRMVTHYDVSEGDIKKAIT  279



>tpg|DAA45470.1| TPA: hypothetical protein ZEAMMB73_239903 [Zea mays]
Length=488

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G LCAAA V  ++ VGKL  DH+KAK LAEGL KI    VD +SVETN+V   +  EA 
Sbjct  366  VGFLCAAAYVAVRDTVGKLADDHRKAKALAEGLTKIKQFTVDSSSVETNMV--SVKDEAR  423

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
               +       +     +P     +RFVIH+QI D+DVQYAL+ V+
Sbjct  424  YIFLIFHNVNRKGPAYDIPLLFISVRFVIHYQILDSDVQYALTCVE  469



>ref|XP_004170415.1| PREDICTED: L-allo-threonine aldolase-like, partial [Cucumis sativus]
Length=326

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG+LCAA LV  +ENV KLE DH KAK LA GL +I GL+V+  SVETNI+F +I +++ 
Sbjct  244  IGILCAAGLVAIKENVQKLEADHHKAKQLASGLCQIKGLKVNPKSVETNIIFFEIEEDSQ  303

Query  410  TTEMELCKRLAEHGVLILPE  351
             +   LC+ + E G+L++ E
Sbjct  304  ISAKLLCESMKERGILLMQE  323



>gb|EEG77367.1| Threonine aldolase [Dethiobacter alkaliphilus AHT 1]
Length=339

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 64/108 (59%), Gaps = 4/108 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA LV   +++ +L  DH+ A  LAEGL KI GL VD++ V+TN+V  +I      
Sbjct  236  GVLAAAGLVAL-DDIAQLSDDHENAVRLAEGLAKIEGLSVDLSKVQTNMVMAEI---QEL  291

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            +  E   R+ E GV   P GP R+RFV H  ++  D+  AL R+ +A+
Sbjct  292  SVQEFLDRILEAGVAAGPMGPGRVRFVTHRDVTAADIDEALMRIGQAL  339



>ref|WP_040378796.1| threonine aldolase [Dethiobacter alkaliphilus]
Length=341

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 64/108 (59%), Gaps = 4/108 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA LV   +++ +L  DH+ A  LAEGL KI GL VD++ V+TN+V  +I      
Sbjct  238  GVLAAAGLVAL-DDIAQLSDDHENAVRLAEGLAKIEGLSVDLSKVQTNMVMAEI---QEL  293

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            +  E   R+ E GV   P GP R+RFV H  ++  D+  AL R+ +A+
Sbjct  294  SVQEFLDRILEAGVAAGPMGPGRVRFVTHRDVTAADIDEALMRIGQAL  341



>ref|WP_018706849.1| hypothetical protein [Bacillus fordii]
Length=348

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G++ AA ++  +E +G+L+ DH  AK LAEGL +I+G+++D   VETNI+   I +    
Sbjct  235  GIVGAAGIIALEEIIGRLQEDHLHAKKLAEGLARINGIDIDAEGVETNIIMFSIARSGLD  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR  270
             + E  K+L  H +L    GP RIRFV H  I+  D+  A+  ++R
Sbjct  295  AD-EFIKKLHGHEILANSAGPYRIRFVTHRGIATEDIDTAIEAIKR  339



>ref|WP_026677955.1| threonine aldolase [Fictibacillus gelatini]
Length=342

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVL A  +V  ++ V +L  DH  A+  AEGL+ I G+ +D+  VETNI+ CDI +E  
Sbjct  232  VGVLAAPGIVALEKMVDRLAEDHANARQFAEGLSAIPGITIDVDGVETNIILCDI-RETG  290

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             +  +   +L E G+L  P     IRFV H ++++  VQ A+ R+ + + G
Sbjct  291  LSNEQFLTKLKEAGILAGPFDDGIIRFVTHREVTNEMVQTAIERIAQIIAG  341



>ref|XP_007030425.1| Threonine aldolase 1 isoform 6 [Theobroma cacao]
 gb|EOY10927.1| Threonine aldolase 1 isoform 6 [Theobroma cacao]
Length=319

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIV  438
            +G +CAAA V  QENVGKLEGDHKKAK LAEGLN+I GL VD+A+V+TNIV
Sbjct  241  VGFICAAAFVALQENVGKLEGDHKKAKVLAEGLNQIKGLRVDVAAVQTNIV  291



>ref|XP_008675991.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Zea 
mays]
Length=161

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ VGKL  DHKKAK LAEGL KI  + VD ASVETN+VF +++ +  
Sbjct  74   VGVLCAAAHVVVRDTVGKLADDHKKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPR  132

Query  410  TTEMELCKRLAEHGVLILP  354
             +  +LC+ L +H VL +P
Sbjct  133  ISPDKLCQVLEQHNVLAMP  151



>ref|NP_001140767.1| putative threonine aldolase family protein [Zea mays]
 gb|ACF84582.1| unknown [Zea mays]
 tpg|DAA36967.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=321

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ VGKL  DH+KAK LAEGL KI  + VD ASVETN+VF +++ +  
Sbjct  239  VGVLCAAAHVAVRDTVGKLADDHRKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPR  297

Query  410  TTEMELCKRLAEHGVLILPEGPKR  339
             +  +LC+ L +  VL LP   KR
Sbjct  298  ISPDKLCQVLEQDNVLALPANSKR  321



>ref|WP_009609982.1| threonine aldolase [Caldanaerobacter subterraneus]
 gb|EEB76295.1| Beta-eliminating lyase superfamily protein [Caldanaerobacter 
subterraneus subsp. pacificus DSM 12653]
Length=346

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+++DM +V+TNIV  DI      
Sbjct  236  GFIAAAGIVALEKMTKRLQEDHDNARLLAEGLKNIPGIDLDMETVQTNIVMTDI-SGTGM  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T  E   +L EHGVL+       +RFV H+ I+  DV+ ALS +++ V
Sbjct  295  TGREFSLKLKEHGVLVNGGDDFSVRFVTHYYITKEDVKKALSAIEKVV  342



>ref|WP_011024735.1| threonine aldolase [Caldanaerobacter subterraneus]
 gb|AAM23563.1| Threonine aldolase [Caldanaerobacter subterraneus subsp. tengcongensis 
MB4]
 gb|ERM92570.1| threonine aldolase [Caldanaerobacter subterraneus subsp. yonseiensis 
KB-1]
Length=346

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+++DM +V+TNIV  DI      
Sbjct  236  GFIAAAGIVALEKMTKRLQEDHDNARLLAEGLKNIPGIDLDMETVQTNIVMTDI-SGTGM  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T  E   +L EHGVL+       +RFV H+ I+  DV+ ALS +++ V
Sbjct  295  TGREFSLKLKEHGVLVNGGDDFSVRFVTHYYITKEDVKKALSAIEKVV  342



>ref|XP_008657658.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Zea 
mays]
Length=210

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ VGKL  DHK AK LAEGL KI  + VD ASVETN+VF +++ +  
Sbjct  123  VGVLCAAAHVAVRDTVGKLADDHKNAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPR  181

Query  410  TTEMELCKRLAEHGVLILP  354
             +  +LC+ L +H VL +P
Sbjct  182  ISPDKLCQVLEQHNVLAMP  200



>gb|EWM22625.1| threonine aldolase [Nannochloropsis gaditana]
Length=912

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 41/109 (38%), Positives = 67/109 (61%), Gaps = 0/109 (0%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVL AA LV  +  + +L  DH+ A+ LA+GL+ + GL+V++ +VETNIV  D      
Sbjct  341  VGVLAAAGLVALKRTLPRLAEDHENARRLAKGLSTLPGLKVNVEAVETNIVMIDFEDRLP  400

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             +  EL + L    VL L  GP+RIR V H+ +S+ D++ A++  ++ +
Sbjct  401  LSPPELLEELERRNVLALAVGPRRIRMVTHYDVSEGDIKKAITVFEKVL  449



>gb|KIG16688.1| Low-specificity L-threonine aldolase [Enhygromyxa salina]
Length=348

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 64/111 (58%), Gaps = 1/111 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G++ AA +V  +  +  L  DH +A+ LAEGL +I GL VDMASVETN+V+ +      +
Sbjct  238  GIIAAAGIVALETMIEPLAHDHARARALAEGLARIPGLRVDMASVETNMVYVNHTATGRS  297

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGV  255
            T+ ++ + LA H V+     P  IR V +    D  +  A++RVQ A+  +
Sbjct  298  TD-QIIELLARHSVIASNRPPDHIRLVTNRHHDDATITEAITRVQAAINSI  347



>gb|EGU57937.1| L-allo-threonine aldolase [Vibrio nigripulchritudo ATCC 27043]
Length=173

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+L AA  +   E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +
Sbjct  69   VGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETID  128

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                 L  +LAE G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  129  VD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNTLVDTIKRLI  173



>ref|WP_014394185.1| threonine aldolase [Corallococcus coralloides]
 gb|AFE09262.1| L-allo-threonine aldolase [Corallococcus coralloides DSM 2259]
Length=341

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 61/99 (62%), Gaps = 4/99 (4%)
 Frame = -1

Query  554  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  375
            + +V +L  DH  A+ LAEGL ++ G++VD+A VETN+VF D+++ A     E    L +
Sbjct  247  EHHVERLAEDHANARRLAEGLAQVPGVKVDLARVETNMVFADLVRPA----AEASALLLK  302

Query  374  HGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
             GVL  P GP  IR V H  +S  D+  AL+R+++A  G
Sbjct  303  QGVLANPTGPHSIRLVCHLDVSTADIDDALARIRKAFAG  341



>ref|WP_038146243.1| threonine aldolase, partial [Vibrio nigripulchritudo]
Length=173

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+L AA  +   E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +
Sbjct  69   VGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETID  128

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                 L  +LAE G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  129  VD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNTLVDTIKRLI  173



>ref|WP_027877883.1| threonine aldolase [Meiothermus cerbereus]
Length=339

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 64/108 (59%), Gaps = 6/108 (6%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA L+   E    L  DH+ A+ LAEGL ++  LEVD+ +V+TN+V+  + +    
Sbjct  235  GVLAAAGLIALSEGPKHLARDHQMARALAEGLLRLH-LEVDLQAVQTNMVYVQVPQAP--  291

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                L +RL E G+L    GP R+RFV H  + D D+  AL R+++A+
Sbjct  292  ---ALVQRLRELGLLANAMGPNRVRFVTHRDLQDEDIPQALKRIEQAL  336



>ref|WP_037564212.1| threonine aldolase [Spirochaeta sp. JC202]
 gb|KGM38782.1| threonine aldolase [Spirochaeta sp. JC202]
Length=345

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 64/101 (63%), Gaps = 1/101 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA +V   + V +L  DH  A+ LAEGL ++ GL +D+A +++NIVF +++++  T
Sbjct  237  GVLAAAGIVALNDMVDRLTEDHVNARKLAEGLAEMPGLAIDLARIKSNIVFFEVVRDDMT  296

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  285
             E +L + L + G  +LP G  RIR V H+ IS  ++ + L
Sbjct  297  AE-QLVRMLDDQGARMLPVGVGRIRAVTHYHISSENIDHTL  336



>ref|WP_014645330.1| threonine aldolase [Halobacillus halophilus]
 emb|CCG47449.1| threonine aldolase [Halobacillus halophilus DSM 2266]
Length=339

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 62/107 (58%), Gaps = 2/107 (2%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G++ A  LV   + V +L  DH+ AK LAEGL  I GLE++  +V+TNI+  ++     
Sbjct  233  VGIIAAPGLVALNDMVDRLAEDHEHAKQLAEGLGNIEGLEIE-NNVDTNILLVNVEGRGK  291

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQR  270
            T+  E  + L   GVL +P GP  +RFV H+ +S  D+   + RV R
Sbjct  292  TSH-EFLEELKSQGVLAVPFGPYTVRFVTHYDVSGEDIDLVIERVHR  337



>ref|WP_027883536.1| threonine aldolase [Meiothermus rufus]
Length=339

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 64/108 (59%), Gaps = 6/108 (6%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA L+  QE    L+ DH+ A+ LAEGL K+  LEVD+ +V+TN+V+  + +    
Sbjct  235  GVLAAAGLIALQEGPQHLKRDHQMARALAEGLLKLH-LEVDLQAVQTNMVYAQVPQAPTF  293

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T+     RL   GVL  P    R+RFV H  + D D+  AL R+++A+
Sbjct  294  TQ-----RLRALGVLANPMAHNRVRFVTHRDLHDEDIPLALERIEQAL  336



>ref|XP_008671569.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Zea 
mays]
Length=257

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ VGKL  DHKKAK LAEGL KI  + VD ASVETN+VF +++ +  
Sbjct  84   VGVLCAAAHVAVRDTVGKLADDHKKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPR  142

Query  410  TTEMELCKRLAEHGVLIL  357
             +  +LC+ L +H VL +
Sbjct  143  ISPDKLCQVLEQHNVLAM  160



>ref|WP_011551549.1| threonine aldolase [Myxococcus xanthus]
 gb|ABF87719.1| L-allo-threonine aldolase [Myxococcus xanthus DK 1622]
Length=341

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 5/95 (5%)
 Frame = -1

Query  545  VGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGV  366
            V +L  DH  A+ LA GL ++ G+EVD + VETN+VF +  + A    +E+  RL +HGV
Sbjct  250  VERLADDHANARRLAAGLAELPGVEVDASRVETNMVFAEFSRSA----LEMVARLEQHGV  305

Query  365  LILPEG-PKRIRFVIHHQISDTDVQYALSRVQRAV  264
            L  P G P+ +R V H  +S  D+  AL R++RAV
Sbjct  306  LTNPAGAPRTLRLVTHLDVSAADIDEALQRIRRAV  340



>ref|WP_014100459.1| threonine aldolase [Candidatus Chloracidobacterium thermophilum]
 gb|AEP12722.1| L-threonine aldolase [Candidatus Chloracidobacterium thermophilum 
B]
Length=351

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 53/101 (52%), Gaps = 1/101 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA LV  +E    L  DH  A+ LA  L ++ GL+VD+  VETNIV CD+     T
Sbjct  240  GVLAAAGLVALEEGPAHLADDHANARWLAAELAQLPGLDVDLTRVETNIVMCDVTPTGMT  299

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  285
               + C  L   GVL  P GP  +RFV H     +  Q A+
Sbjct  300  AS-DFCAGLKSCGVLAGPAGPYTVRFVTHRDAPRSACQRAV  339



>ref|WP_013296780.1| threonine aldolase [Thermoanaerobacterium thermosaccharolyticum]
 gb|ADL67801.1| Threonine aldolase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=345

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA +V  ++   +L  DH+ A+ LAEGLN I G++VDM++V+TNIV  DI      
Sbjct  236  GILAAAGIVALEKMTKRLSEDHENARLLAEGLNSIKGIKVDMSTVQTNIVMSDI-SATGL  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T  +L  +L ++G+ +   G   +RFV H+ I   D+   L  +   V
Sbjct  295  TGAQLSSKLLDYGIKVNGAGDYNVRFVTHYYIKKDDINKVLHAINTIV  342



>ref|WP_015310760.1| threonine aldolase [Thermoanaerobacterium thermosaccharolyticum]
 gb|AGB17948.1| threonine aldolase [Thermoanaerobacterium thermosaccharolyticum 
M0795]
Length=345

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA +V  ++   +L  DH+ A+ LAEGLN I G++VDM++V+TNIV  DI      
Sbjct  236  GILAAAGIVALEKMTKRLSEDHENARLLAEGLNNIKGIKVDMSTVQTNIVMSDI-SATGL  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T  +L  +L ++G+ +   G   +RFV H+ I   D+   L  +   V
Sbjct  295  TGAQLSSKLLDYGIKVNGAGDYNVRFVTHYYIKKDDINKVLHAINTIV  342



>ref|WP_034427809.1| threonine aldolase [Candidatus Entotheonella sp. TSY1]
 gb|ETW92988.1| threonine aldolase [Candidatus Entotheonella sp. TSY1]
Length=347

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G++ A  +     N+ +L  DH  A  LAEGL+ ++G++++   VETNI+F ++  E   
Sbjct  238  GIIAAGGVYALDHNIERLAEDHAHAHLLAEGLSSMTGVDINPEHVETNIIFFELTPETPL  297

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
            T  E  ++LA+ GV ++  GP RIR V H  IS   ++ A+  +Q  + G
Sbjct  298  TAPEFVEQLAQRGVRMIAMGPSRIRAVTHLDISRPGIETAIGVIQDVLQG  347



>dbj|GAL33596.1| low-specificity L-threonine aldolase [Vibrio maritimus]
Length=108

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 59/109 (54%), Gaps = 6/109 (6%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   E V +L  DH  AK LAEGLN I G  V+   V+TNIVF    K A +
Sbjct  5    GILAAAGKLALTEQVAQLATDHSNAKKLAEGLNAIPGFSVNTEFVQTNIVFA---KLAES  61

Query  407  TEME-LCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             +++ + K LA+  + I P  P  +RFV H  IS  D+   L ++   V
Sbjct  62   VDIDAIAKELAQQDITISPSNP--VRFVTHKDISSQDIDLLLEKLSALV  108



>ref|WP_024050701.1| hypothetical protein [Meiothermus ruber]
Length=339

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 63/108 (58%), Gaps = 6/108 (6%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA ++   E    L  DH+ A+ LAEGL ++  LEVD+ +V+TN+V+  + +    
Sbjct  235  GVLAAAGILALTEGPQHLARDHQMARALAEGLLRLH-LEVDLQTVQTNMVYVQVPQAP--  291

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                  +RL   GVL    GP R+RFV HH + D D+  AL R+++A+
Sbjct  292  ---AFVQRLRGLGVLANAMGPSRVRFVTHHDLQDEDIPLALQRIEQAL  336



>ref|WP_014062139.1| threonine aldolase [Thermoanaerobacter wiegelii]
 gb|AEM77766.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter wiegelii Rt8.B1]
Length=345

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI K   T
Sbjct  236  GFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDISKTGMT  295

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             + E   +L EHG+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  296  GK-EFALKLKEHGILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  342



>ref|WP_025322967.1| threonine aldolase [Deferrisoma camini]
Length=347

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 59/108 (55%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA LV     VG+L  DH  A+ LA G+  + GL VD+ +V+TNIV  +++  A  
Sbjct  236  GILAAAGLVALDTMVGRLTDDHANARALARGIASVDGLRVDLGAVQTNIVLFEVVDPA-W  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                L   L   GVL    GP++IR V H  +S  DV  AL R++  V
Sbjct  295  DAASLVAALGRVGVLCSAFGPRKIRLVTHCDVSTEDVSEALDRIETVV  342



>ref|WP_004400281.1| MULTISPECIES: Threonine aldolase [Thermoanaerobacter]
 gb|EMT39215.1| Threonine aldolase [Thermoanaerobacter thermohydrosulfuricus 
WC1]
Length=345

 Score = 78.2 bits (191),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 63/108 (58%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI K   T
Sbjct  236  GFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDISKTGMT  295

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             + E   +L EHG+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  296  GK-EFALKLKEHGILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  342



>ref|WP_034132280.1| threonine aldolase [Peptococcaceae bacterium BICA1-8]
Length=339

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            IG++ AA +V  +  + +LE DH +AK LA GL+++  L V    +ETNIV  +I+ E  
Sbjct  233  IGIMAAAGIVALETMIDRLEEDHVRAKKLAHGLSELPYLSVCSDEIETNIVIVEIISELI  292

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
            T + E   +LAE+G++    GP ++RFV H +I+D D+   + R+ 
Sbjct  293  TMK-EFLAKLAENGIMAKDIGPTKVRFVTHKEINDDDINLVIERLS  337



>ref|XP_008671685.1| PREDICTED: uncharacterized protein LOC103649121 [Zea mays]
Length=419

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVLCAAA V  ++ VGKL  DHKKAK LAEGL KI  + VD ASVETN+VF +++ +  
Sbjct  84   VGVLCAAAHVAVRDTVGKLADDHKKAKALAEGLKKIEQITVDSASVETNMVFFEVM-DPR  142

Query  410  TTEMELCKRLAEHGVLIL  357
             +  +LC+ L +H VL +
Sbjct  143  ISPDKLCQVLEQHNVLAM  160



>ref|WP_022597498.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN33850.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
AM115]
 emb|CCN65534.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
Pon4]
 emb|CCN43026.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
FTn2]
 emb|CCN75218.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SO65]
Length=334

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+L AA  +   E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +
Sbjct  230  VGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETID  289

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                 L  +LAE G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  290  VD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNTLIDTIKRLI  334



>ref|WP_027888175.1| MULTISPECIES: threonine aldolase [Meiothermus]
 gb|KIQ54343.1| threonine aldolase [Meiothermus ruber]
Length=339

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 63/108 (58%), Gaps = 6/108 (6%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA ++   E  G L  DH+ A+ LAEGL ++  LEVD+ +V+TN+V+  I +    
Sbjct  235  GVLAAAGILALTEGPGHLARDHQMARALAEGLLRLC-LEVDLQAVQTNMVYVQIPQAP--  291

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                  +RL   GVL    GP R+RFV H  + D D+  AL R+++A+
Sbjct  292  ---AFVQRLRGLGVLANAMGPSRVRFVTHRDLHDEDIPLALKRIEQAL  336



>ref|WP_020265088.1| hypothetical protein [Atribacteria bacterium JGI 0000059-I14]
Length=348

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 65/108 (60%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA +V  ++ + +L  DH  A+ LAE L K+ GL++D+ +V+TN+V+CDI  +   
Sbjct  235  GVLAAAGIVALEKMINRLTEDHAHARYLAEELLKVKGLKIDLNTVQTNMVYCDI-SQLKA  293

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            + ++L + L   G+L+ P  P +IR V H  I   D+  A+  ++  +
Sbjct  294  SALQLTEWLKGEGLLVSPVPPDKIRLVTHRHICREDINKAVEIIKMVI  341



>ref|WP_022601443.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN68404.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SFn118]
Length=334

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+L AA  +   E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +
Sbjct  230  VGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETID  289

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                 L  +LAE G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  290  VD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNTLVDTIKRLI  334



>ref|WP_022592526.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN54732.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
MADA3021]
 emb|CCN61704.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
MADA3029]
 emb|CCN49783.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
MADA3020]
Length=334

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+L AA  +   E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +
Sbjct  230  VGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETID  289

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                 L  +LAE G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  290  VD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNTLVDTIKRLI  334



>ref|WP_022561270.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 ref|YP_008641758.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCO60698.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo]
 emb|CCN84480.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
BLFn1]
 emb|CCN86527.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SFn27]
 emb|CCN97070.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
ENn2]
 emb|CCO41573.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
SFn135]
 emb|CCO54178.1| Low specificity L-threonine aldolase [Vibrio nigripulchritudo 
Wn13]
Length=334

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 4/109 (4%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+L AA  +   E V +L+ DHK AK LAEGL  I G  V    V+TNIVF  + +  +
Sbjct  230  VGILAAAGKIALTEQVEQLKADHKHAKQLAEGLATIPGFSVKPELVQTNIVFAKVDETID  289

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                 L  +LAE G++I P  P  IRFV H  +S  DV   +  ++R +
Sbjct  290  VD--SLTNKLAEQGIIINPRSP--IRFVTHKDVSSDDVNTLVDTIKRLI  334



>ref|WP_025229058.1| threonine aldolase [Fimbriimonas ginsengisoli]
 gb|AIE87020.1| serine hydroxymethyltransferase [Fimbriimonas ginsengisoli Gsoil 
348]
Length=349

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L A  +V    NV +L  DH++AK +A+ + ++ G+ V +  VETN+V  D   EA  
Sbjct  245  GILAACGIVSLNSNVDRLADDHRRAKEIAQAVCELPGMSVKLEEVETNMVMVDT--EAPA  302

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  285
             E++   +LAE GVL LP GP R+R V+H  I D   + A+
Sbjct  303  PEIQ--GKLAEKGVLCLPTGPNRLRLVLHADIDDAKTEKAI  341



>ref|WP_026475800.1| threonine aldolase [Alkaliphilus transvaalensis]
Length=346

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G++ AA LV  +++   +E DH  AK LA GLN I G+ V++  V TNI+  DI  E  
Sbjct  238  VGIIAAAGLVALRDHSQWMEEDHLNAKKLAFGLNLIDGVRVNLDKVHTNILMADI-SETG  296

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
                +L  R++E G+L+ P   + IRFV H  I++ DV+ A+  V+
Sbjct  297  FNAYDLVNRMSEKGLLVNPRNERLIRFVTHRGINNRDVEAAIKIVK  342



>ref|WP_002635500.1| threonine aldolase [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK91822.1| Low-specificity L-threonine aldolase protein [Myxococcus sp. 
(contaminant ex DSM 436)]
Length=341

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 60/98 (61%), Gaps = 5/98 (5%)
 Frame = -1

Query  554  QENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAE  375
            + +V +L  DH  A+ LA GL ++ G+ VD ASVETN+VF +  + A+    E+   L  
Sbjct  247  ENHVSRLADDHANARRLAAGLAELPGVTVDTASVETNMVFAEFPQAAH----EVVALLER  302

Query  374  HGVLILPEG-PKRIRFVIHHQISDTDVQYALSRVQRAV  264
            HGVL  P G P+ +R V H  +S  D+  ALSR++RAV
Sbjct  303  HGVLTNPAGAPRTLRLVTHLDVSARDIDEALSRIRRAV  340



>ref|WP_012269711.1| MULTISPECIES: threonine aldolase [Thermoanaerobacter]
 gb|ABY95633.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter pseudethanolicus ATCC 33223]
 gb|ADV80571.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter brockii subsp. finnii Ako-1]
Length=345

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI      
Sbjct  236  GFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDI-SGTGM  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T  EL  RL EHG+LI       +RFV H+ IS  +++  L  +++ V
Sbjct  295  TGKELSLRLKEHGILINDGNDFAVRFVTHYYISKKEIEKTLDAIEKIV  342



>ref|WP_003867083.1| MULTISPECIES: threonine aldolase [Thermoanaerobacter]
 ref|YP_001661860.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X514]
 ref|YP_003903199.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X513]
 gb|ABY91524.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X514]
 gb|EEU63053.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter ethanolicus CCSD1]
 gb|EFK85367.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X561]
 gb|ADN53908.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter sp. X513]
Length=345

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI      
Sbjct  236  GFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDI-SGTGM  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T  EL  RL EHG+LI       +RFV H+ IS  +++  L  +++ V
Sbjct  295  TGKELSLRLKEHGILINGGNDFAVRFVTHYYISKKEIEKTLDAIEKIV  342



>ref|WP_011196526.1| threonine aldolase [Symbiobacterium thermophilum]
 dbj|BAD41388.1| threonine aldolase [Symbiobacterium thermophilum IAM 14863]
Length=346

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA LV  +  + +L  DH  A+ LAEG+  I GL VD+ +V+TN+V  +I+ E   
Sbjct  236  GVLAAAGLVALEMMIDRLADDHANARRLAEGIAGIPGLRVDLETVQTNMVVVEIVDE-RW  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T     + L   GVL    GP+ +R V H  ++  DV+ AL  + R V
Sbjct  295  TAGAFVQALRTQGVLCNDTGPRSVRLVTHKDVTAADVELALDAIARTV  342



>ref|WP_029688227.1| threonine aldolase [Thermoanaerobacter sp. A7A]
Length=345

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI      
Sbjct  236  GFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDI-SGTGM  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T  EL  RL EHG+LI       +RFV H+ IS  +++  L  +++ V
Sbjct  295  TGKELSLRLKEHGILINGGNDFAVRFVTHYYISKKEIEKTLDAIEKIV  342



>ref|WP_038083758.1| threonine aldolase [Tumebacillus flagellatus]
 gb|KEO85216.1| threonine aldolase [Tumebacillus flagellatus]
Length=344

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 1/113 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +GVL A AL+   +NV +L  DH  AK LAEGL +I GL +D A+V+TNIV  +I     
Sbjct  233  VGVLAAPALLALTQNVERLAEDHANAKFLAEGLAQIPGLAIDPATVDTNIVIVNIAG-LG  291

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTGVA  252
             +E  L   L + G+L    GP+ +RFV H  IS  D+  AL  +QR V G+A
Sbjct  292  VSETVLIDELKKSGILCGGFGPQLVRFVTHLNISKADIVSALETIQRVVRGLA  344



>ref|WP_027448368.1| threonine aldolase [Pontibacillus marinus]
 gb|KGX84447.1| threonine aldolase [Pontibacillus marinus BH030004 = DSM 16465]
Length=341

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 62/108 (57%), Gaps = 2/108 (2%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GV+ A  LV   E V +LE DH+ AK LAE +N ISGLEV+   VETNIV  ++ KE   
Sbjct  234  GVIAAPGLVALNEMVDRLEEDHEHAKNLAESVNSISGLEVE-GKVETNIVLINV-KETGM  291

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                   +L E GVL +P GP  IR V + ++S  D+     ++++ V
Sbjct  292  DAEAFLAKLKEQGVLAVPFGPYTIRMVTNKEVSAEDLPEVKKQLEKCV  339



>ref|WP_013935419.1| threonine aldolase [Myxococcus fulvus]
 gb|AEI62246.1| L-allo-threonine aldolase [Myxococcus fulvus HW-1]
Length=341

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = -1

Query  545  VGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANTTEMELCKRLAEHGV  366
            V +L  DH  A+ LA GL ++ G++VD + VETN+VF +  + A    +E    L  HGV
Sbjct  250  VDRLADDHANARRLAAGLAEVPGVKVDASRVETNMVFAEFTRPA----LESLSLLERHGV  305

Query  365  LILPEG-PKRIRFVIHHQISDTDVQYALSRVQRAVT  261
            L  P G P+ +RFV H  +S  D+  AL R++RAV+
Sbjct  306  LTNPAGAPRTLRFVTHLDVSAADIDEALERIRRAVS  341



>ref|WP_008216429.1| threonine aldolase [Vibrionales bacterium SWAT-3]
 gb|EDK30742.1| L-allo-threonine aldolase [Vibrionales bacterium SWAT-3]
Length=336

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 63/109 (58%), Gaps = 4/109 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   ENV +L+ DH+ AK LA GL+K+ G  V+   V+TNIVF  + +  + 
Sbjct  231  GILAAAGKMALTENVTQLKADHENAKNLAIGLSKLEGFSVNPDFVQTNIVFAKLDESVDI  290

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  261
                +   L+E G+ + P  P  +RFV H  IS  D+   L+ +Q+A+T
Sbjct  291  N--RIAGELSEQGITMTPGNP--VRFVTHRDISAEDISRFLNELQKALT  335



>ref|WP_013778623.1| threonine aldolase [Tepidanaerobacter acetatoxydans]
 ref|YP_007272437.1| L-allo-threonine aldolase [Tepidanaerobacter acetatoxydans Re1]
 gb|AEE91700.1| Threonine aldolase [Tepidanaerobacter acetatoxydans Re1]
 emb|CCP26461.1| L-allo-threonine aldolase [Tepidanaerobacter acetatoxydans Re1]
Length=344

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 1/105 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G L AA +V  ++   +L  DH  A+ LAEGLN I G+ +DM +V+TNI+ CDI      
Sbjct  236  GFLAAAGIVALEKMTSRLSEDHNNARILAEGLNNIPGVNIDMETVQTNIILCDI-SGLKM  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
            +  E   +L E G+ +       +RFV H+ I+  D+   L  V+
Sbjct  295  SANEFSAKLYEKGIRVNGGSTATVRFVTHYWITKEDINTVLEAVK  339



>ref|WP_003869086.1| threonine aldolase [Thermoanaerobacter ethanolicus]
 gb|EGD53170.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Thermoanaerobacter ethanolicus JW 200]
Length=345

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI K   T
Sbjct  236  GFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMADISKTGMT  295

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             + E   +L E G+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  296  GK-EFALKLKEQGILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  342



>ref|WP_013705006.1| threonine aldolase [Marinithermus hydrothermalis]
 gb|AEB12962.1| Threonine aldolase [Marinithermus hydrothermalis DSM 14884]
Length=341

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 62/108 (57%), Gaps = 6/108 (6%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA +V  QE    LE DH+ A+ LAEGL ++ GL VD+ +V+TN+V+  +  EA  
Sbjct  235  GVLAAAGIVALQEGPAHLERDHQMARALAEGLVRL-GLGVDLKAVQTNMVYARV-PEAP-  291

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                   RLA  GV     G  R+RFV H  + D D+  AL R+ +A+
Sbjct  292  ---RFVARLAALGVRANALGTDRVRFVTHRDLDDADIPQALERIAQAL  336



>ref|WP_017109562.1| threonine aldolase [Vibrio tasmaniensis]
Length=334

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   ENV +L+ DH  AK LA GLNK+ G  V+   ++TNIVF  + +  + 
Sbjct  231  GILAAAGKMALTENVAQLKADHDNAKNLAIGLNKLEGFSVNPDFIQTNIVFAKLDESVDI  290

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                + + L E G+ + P  P  +RFV H  IS  D+   L+ +++A+
Sbjct  291  N--RIARELGEQGITMSPGNP--VRFVTHRDISTEDIARFLTELEKAL  334



>ref|WP_017067124.1| threonine aldolase [Vibrio crassostreae]
Length=334

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   ENV +L+ DH  AK LA GLNK+ G  V+   ++TNIVF  + +  + 
Sbjct  231  GILAAAGKMALTENVAQLKADHDNAKNLAIGLNKLEGFSVNPDFIQTNIVFAKLDESVDI  290

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                + + L E G+ + P  P  +RFV H  IS  D+   L+ +++A+
Sbjct  291  N--RIARELGEQGITMSPGNP--VRFVTHRDISTEDIARFLTELEKAL  334



>ref|WP_039929082.1| threonine aldolase [Thermoanaerobacter siderophilus]
 gb|AIS51424.1| L-allo-threonine aldolase LtaA [Thermoanaerobacter kivui]
Length=345

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI K   T
Sbjct  236  GFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDISKTGMT  295

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             + E   +L E G+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  296  GK-EFALKLKEQGILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  342



>gb|EIV99346.1| threonine aldolase [Thermoanaerobacter siderophilus SR4]
Length=362

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI K   T
Sbjct  253  GFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKNIPGINLDLETVQTNIVMTDISKTGMT  312

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             + E   +L E G+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  313  GK-EFALKLKEQGILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  359



>ref|WP_038227001.1| threonine aldolase [Vibrio sp. ER1A]
 gb|KFA97958.1| threonine aldolase [Vibrio sp. ER1A]
Length=334

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 64/108 (59%), Gaps = 4/108 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   E V +L+ DH  AK LA GLN ISG  V+   V+TNIVF   L E+  
Sbjct  231  GILAAAGKLALTEQVDQLKVDHANAKKLAFGLNDISGFSVNADFVQTNIVFAK-LDESVK  289

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
             ++ + + LA+ G+ I P  P  IRFV H  IS  D+ + L+R+++ V
Sbjct  290  IDV-IAESLAKEGITITPGNP--IRFVTHKDISSADIDHLLTRLKQLV  334



>ref|WP_004740139.1| threonine aldolase [Vibrio splendidus]
 gb|EGU42310.1| Threonine aldolase [Vibrio splendidus ATCC 33789]
Length=336

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 63/109 (58%), Gaps = 4/109 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   ENV +L+ DH+ AK LA GL+K+ G  V+   V+TNIVF  + +  + 
Sbjct  231  GILAAAGKMALTENVAQLKLDHENAKNLAIGLSKLEGFSVNPDFVQTNIVFAKLDESVDI  290

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  261
                +   L+E G+ + P  P  +RFV H  IS  D+   L+ +Q+A+T
Sbjct  291  N--RIAGELSEQGITMTPGNP--VRFVTHRDISAEDISRFLNELQKALT  335



>ref|WP_013015285.1| threonine aldolase [Meiothermus ruber]
 gb|ADD29787.1| Threonine aldolase [Meiothermus ruber DSM 1279]
 gb|AGK04753.1| threonine aldolase [Meiothermus ruber DSM 1279]
Length=339

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 6/108 (6%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA ++   E    L  DH+ A+ LAEGL ++  LEVD+ +V+TN+V+  + +    
Sbjct  235  GVLAAAGILALTEGPQHLARDHQMARALAEGLLRLH-LEVDLQTVQTNMVYVQVPQAP--  291

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                  +RL   GVL    GP R+RFV H  + D D+  AL R+++A+
Sbjct  292  ---AFVQRLRGLGVLANAMGPSRVRFVTHRDLQDEDIPLALQRIEQAL  336



>ref|WP_013275483.1| threonine aldolase [Thermosediminibacter oceani]
 gb|ADL07436.1| L-threonine aldolase [Thermosediminibacter oceani DSM 16646]
Length=347

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G L AA +V  ++   +L+ DH+ A+ LAEGLN I G+ +DM +V+TNIV CDI      
Sbjct  237  GFLAAAGIVALEKMTERLKEDHENARLLAEGLNSIPGISIDMKTVQTNIVICDI-SGLGI  295

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDV  297
            +  EL  RL E G+ I       +RFV H+ I   DV
Sbjct  296  SGNELAGRLLEKGIKINGGSGSLVRFVTHYGIDKNDV  332



>gb|ETX05065.1| threonine aldolase [Candidatus Entotheonella sp. TSY2]
Length=347

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 62/110 (56%), Gaps = 0/110 (0%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G++ A  +     N+ +L  DH  A+ LAEGL+ ++G++++   VETNI+F ++  E   
Sbjct  238  GIIAAGGVYALDHNIERLAEDHANAQLLAEGLSSMTGVDINPEHVETNIIFFELTPETPF  297

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
            T     +RL + GV ++  GP RIR V H  +S   ++ AL  ++  + G
Sbjct  298  TAPVFVERLEQRGVRMIAMGPSRIRAVTHLDVSRPGIEMALDIIRDVLQG  347



>ref|WP_042834178.1| threonine aldolase [Thermoanaerobacter sp. YS13]
 gb|KHO61352.1| L-threonine aldolase [Thermoanaerobacter sp. YS13]
Length=345

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G + AA +V  ++   +L+ DH  A+ LAEGL  I G+ +D+ +V+TNIV  DI      
Sbjct  236  GFIAAAGIVALEKMTKRLQEDHDNARFLAEGLKDIPGINLDLETVQTNIVMTDI-SGTGM  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
            T  EL  +L E+G+LI       +RFV H+ IS  D++  L  +++ V
Sbjct  295  TGKELSLKLKEYGILINGGNDFAVRFVTHYYISKKDIEKTLDAIEKIV  342



>ref|WP_018133494.1| hypothetical protein [Effusibacillus pohliae]
Length=345

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GV+ A A+V   E V +L  DH+ A+ LA  L ++ G +VD   VETNIV  D+     +
Sbjct  236  GVIAAPAIVALTEMVDRLAEDHENARRLALALAEMKGWQVDPGLVETNIVIADVAGTGRS  295

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
               E    LA+ GVL +  G   IRFV H  +S +D++ A+ R+ R V
Sbjct  296  A-TEWLDWLAKEGVLAVDFGDTLIRFVTHKDVSSSDLEEAIRRIHRVV  342



>ref|WP_038960521.1| threonine aldolase [Atribacteria bacterium SCGC AB-164-A22]
Length=346

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 60/104 (58%), Gaps = 1/104 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL A+ ++  ++ V +L+ D K A  L E LNKI G+EVD+ +V+TN+VF ++ K+   
Sbjct  237  GVLAASGIIALEKMVNRLKEDQKNAWILGEDLNKIKGVEVDLETVQTNMVFINV-KKLRI  295

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRV  276
               E  K+L +  +L  P  P  +RF+ H  I+  D+   +  V
Sbjct  296  NSDEFLKKLLKFNILASPRRPNEVRFITHFGINREDINKTIKAV  339



>ref|WP_003540689.1| threonine aldolase [Desulfotomaculum nigrificans]
Length=343

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 60/102 (59%), Gaps = 3/102 (3%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA LV  + ++ +L  DH  AK LA GL ++ GL +D A V+TNIV  ++  +   
Sbjct  238  GILAAAGLVALK-SIDRLAEDHANAKRLAAGLAELPGLHIDPARVQTNIVIVEV--KGRL  294

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
            T  EL  +LAE GV     GP  IR V H  ++  D++YAL+
Sbjct  295  TAAELVNQLAERGVKCSTFGPNLIRLVTHKDVAAEDIEYALA  336



>ref|WP_002629188.1| Low-specificity L-threonine aldolase [Cystobacter fuscus]
 gb|EPX61548.1| Low-specificity L-threonine aldolase [Cystobacter fuscus DSM 
2262]
Length=342

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 63/113 (56%), Gaps = 6/113 (5%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G+L A AL G + +V +L  DH  A+ LA GL ++ G++V    VETN+V  +      
Sbjct  234  VGILAAGALYGLEHHVERLAEDHVHARRLAAGLAEMPGVKVVPGQVETNMVVAEFPLPVR  293

Query  410  TTEMELCKRLAEHGVLI--LPEGPKRIRFVIHHQISDTDVQYALSRVQRAVTG  258
                E+  +LA HGVL      GP  +R V H  +S TD+   L+R++RA+ G
Sbjct  294  ----EMLGKLASHGVLAGSTGTGPHTVRLVTHLDVSSTDIDEGLARIRRALAG  342



>ref|WP_031792098.1| hypothetical protein [Vibrio parahaemolyticus]
Length=108

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 59/105 (56%), Gaps = 4/105 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   E V +L+ DH  AK LAEGL ++ G  V+   V+TNIVF  +  +A  
Sbjct  5    GILAAAGKLAITEQVAQLKQDHINAKALAEGLAELPGFSVNPDFVQTNIVFAKL--DAKV  62

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQ  273
                + ++L +  ++I P  P  IRFV H  IS  D+Q  LS ++
Sbjct  63   DIQSIAEQLKQQNIIISPGNP--IRFVTHKDISAEDIQTFLSSLK  105



>ref|WP_033406166.1| hypothetical protein [Kiloniella laminariae]
Length=351

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 60/104 (58%), Gaps = 2/104 (2%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL AA L   ++N+ +L  DH  A+ LAEGL  + GL VD+++VETNIV    L     
Sbjct  239  GVLAAAGLFALEQNIDRLGEDHVIARRLAEGLLSL-GLTVDLSAVETNIVMA-YLPSHLP  296

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRV  276
            +     + L +  VL+LP    R RFVIH  +S  DV  AL+R+
Sbjct  297  SPATFHQLLTDENVLVLPPKGNRFRFVIHKDLSADDVDLALTRM  340



>dbj|GAL27114.1| low-specificity L-threonine aldolase [Vibrio variabilis]
Length=187

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 4/108 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   E V +L  DH  AK LAEGLN ++G  V+   V+TNIVF  + +  + 
Sbjct  84   GILAAAGKLALTEQVAQLATDHANAKKLAEGLNAVAGFSVNADFVQTNIVFAKLDESVDI  143

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                + ++LA  G+ I P  P  +RFV H  +S  D+   L +++  V
Sbjct  144  N--RIAEQLAVDGITISPSNP--VRFVTHKDVSSNDIDVLLEKLKTLV  187



>ref|WP_000854011.1| threonine aldolase [Bacillus thuringiensis]
 gb|ADY24340.1| threonine aldolase [Bacillus thuringiensis serovar finitimus 
YBT-020]
Length=353

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 62/102 (61%), Gaps = 1/102 (1%)
 Frame = -1

Query  590  IGVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEAN  411
            +G++ A A+V  Q   G+L+ DH +AK LA GL+ I G+EVD + ++TNIV   I  + N
Sbjct  239  VGIIAAPAMVALQTMTGRLQDDHIRAKRLAIGLSSIDGIEVDASEIQTNIVMFRI-TDPN  297

Query  410  TTEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  285
               ++  K+  E G++    G  R+R V+H  I ++D+++ +
Sbjct  298  YDWVKFLKKTEEKGLVFSEMGYGRMRAVVHRHIKESDIEHTI  339



>ref|WP_035698102.1| threonine aldolase, partial [Atribacteria bacterium SCGC AAA255-N14]
Length=199

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL A+ ++  +    +L+ D K A  L E LNKI G+EVD+ +V+TN+VF ++ K    
Sbjct  90   GVLAASGIIALETMADRLKEDQKNAWILGEDLNKIKGVEVDLETVQTNMVFINV-KNLGI  148

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRV  276
               E  K+L +  +L  P  P  +RF+ H  I+  D+   +  V
Sbjct  149  NSDEFLKKLLKFNILASPRRPNEVRFITHFGINREDINKTIKAV  192



>ref|WP_029955476.1| threonine aldolase, partial [Atribacteria bacterium SCGC AAA255-N14]
Length=198

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            GVL A+ ++  +    +L+ D K A  L E LNKI G+EVD+ +V+TN+VF ++ K    
Sbjct  89   GVLAASGIIALETMADRLKEDQKNAWILGEDLNKIKGVEVDLETVQTNMVFINV-KNLGI  147

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRV  276
               E  K+L +  +L  P  P  +RF+ H  I+  D+   +  V
Sbjct  148  NSDEFLKKLLKFNILASPRRPNEVRFITHFGINREDINKTIKAV  191



>dbj|GAK82526.1| low-specificity L-threonine aldolase [Vibrio ponticus]
Length=173

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   E V +L+ DH  AK LAEGL++I G  V+   + TNIVF  + +  + 
Sbjct  70   GILAAAGKLALTEQVKQLKQDHINAKRLAEGLSQIPGFAVNTEFIHTNIVFAKLDERIDI  129

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                L  +LA+ G+ + P  P  +RFV H  IS  D++  L ++ R V
Sbjct  130  --QSLATKLADDGITVTPGNP--MRFVTHKDISAQDIETCLEKIARYV  173



>ref|WP_017104708.1| threonine aldolase [Vibrio tasmaniensis]
Length=336

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 62/109 (57%), Gaps = 4/109 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   ENV +L+ DH  AK LA GL+K+ G  V+   ++TNIVF  + +  + 
Sbjct  231  GILAAAGKMALTENVAQLKADHDNAKNLAIGLHKLEGFSVNPDFIQTNIVFAKLDESVDI  290

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAVT  261
                + + L E G+ + P  P  +RFV H  IS  D+   L+ +++A+T
Sbjct  291  N--RIARELDEQGITMSPGNP--VRFVTHRDISAEDIARFLTELEKALT  335



>ref|WP_042470320.1| threonine aldolase [Vibrio maritimus]
 dbj|GAL17387.1| low-specificity L-threonine aldolase [Vibrio maritimus]
Length=316

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 60/108 (56%), Gaps = 4/108 (4%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA  +   E V +L  DH  AK LAEGLN ++G  V+   V+TNIVF  + +  + 
Sbjct  213  GILAAAGKLALTEQVAQLATDHANAKKLAEGLNAVAGFSVNADFVQTNIVFAKLDESVDI  272

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALSRVQRAV  264
                + ++LA+ G+ I P  P  +RFV H  +S  D+   L +++  V
Sbjct  273  N--RIAEQLAQDGITISPSNP--VRFVTHKDVSSNDIDVLLEKLKTLV  316



>gb|AIE93607.1| Beta-eliminating lyase superfamily protein (ltaE) [uncultured 
marine group II/III euryarchaeote AD1000_39_C05]
 gb|AIF05204.1| Beta-eliminating lyase superfamily protein (ltaE) [uncultured 
marine group II/III euryarchaeote KM3_181_A09]
Length=356

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 61/102 (60%), Gaps = 3/102 (3%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA L    ++V +L  DH +A+ LA  +N++ G  VDM SV+TN+V+   +  AN 
Sbjct  252  GILAAAGLYALDQHVERLAEDHDRARRLAAAVNEMDGYAVDMNSVQTNMVY---ISTANG  308

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYALS  282
               ++  +LAEHGV  L      +R VIH  I+D D++ A++
Sbjct  309  EAQKVVDQLAEHGVDTLTIDDSTVRAVIHLHITDEDIERAIA  350



>ref|WP_041274354.1| threonine aldolase [Desulfotomaculum reducens]
Length=339

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 3/101 (3%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA LV  Q NV +L  DH  A+ LAEGL K+ GL VD+A V+TNI+  ++ +  + 
Sbjct  234  GILAAAGLVALQ-NVDRLAEDHANARRLAEGLAKLPGLGVDLAKVQTNIIVVNVNQPRSA  292

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  285
             ++ +   L   G+     GP  IR V H  +S  D+ YAL
Sbjct  293  ADLTMA--LNNKGIKCSTFGPSTIRMVTHINVSKEDIDYAL  331



>gb|ABO48655.1| L-threonine aldolase [Desulfotomaculum reducens MI-1]
Length=344

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 58/101 (57%), Gaps = 3/101 (3%)
 Frame = -1

Query  587  GVLCAAALVGFQENVGKLEGDHKKAKTLAEGLNKISGLEVDMASVETNIVFCDILKEANT  408
            G+L AA LV  Q NV +L  DH  A+ LAEGL K+ GL VD+A V+TNI+  ++ +  + 
Sbjct  239  GILAAAGLVALQ-NVDRLAEDHANARRLAEGLAKLPGLGVDLAKVQTNIIVVNVNQPRSA  297

Query  407  TEMELCKRLAEHGVLILPEGPKRIRFVIHHQISDTDVQYAL  285
             ++ +   L   G+     GP  IR V H  +S  D+ YAL
Sbjct  298  ADLTMA--LNNKGIKCSTFGPSTIRMVTHINVSKEDIDYAL  336



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 751271412925