BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN034K02

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              397   7e-137   
emb|CAD20821.1|  alpha tubulin                                          394   6e-136   Zea mays [maize]
gb|ABR25510.1|  tubulin alpha-1 chain                                   393   8e-136   Oryza sativa Indica Group [Indian rice]
ref|XP_001777110.1|  predicted protein                                  395   3e-135   
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              399   3e-135   Malus domestica [apple tree]
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              398   6e-135   Pyrus x bretschneideri [bai li]
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         398   6e-135   Jatropha curcas
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   397   1e-134   
gb|KJB83378.1|  hypothetical protein B456_013G244600                    395   1e-134   Gossypium raimondii
emb|CAL35827.1|  alpha-2 tubulin                                        389   2e-134   Plantago major [cart-track plant]
dbj|BAH20267.1|  AT5G19780                                              390   2e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   397   2e-134   Populus euphratica
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        397   2e-134   Fragaria vesca subsp. vesca
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   396   2e-134   Pyrus x bretschneideri [bai li]
tpg|DAA41189.1|  TPA: alpha tubulin5                                    392   3e-134   
emb|CDP17586.1|  unnamed protein product                                396   3e-134   Coffea canephora [robusta coffee]
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   396   3e-134   Malus domestica [apple tree]
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   396   3e-134   Malus domestica [apple tree]
tpg|DAA63280.1|  TPA: alpha tubulin6                                    391   3e-134   
gb|AHJ80821.1|  Tua3                                                    394   3e-134   Eragrostis tef [tef]
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   396   3e-134   Sesamum indicum [beniseed]
ref|XP_007030078.1|  Tubulin alpha-5                                    397   3e-134   
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              396   4e-134   Populus euphratica
gb|AGG37290.1|  alpha-tubulin 8                                         395   4e-134   Salix arbutifolia
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               395   5e-134   Populus trichocarpa [western balsam poplar]
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          395   5e-134   Amborella trichopoda
ref|XP_002525416.1|  tubulin alpha chain, putative                      395   5e-134   Ricinus communis
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        395   5e-134   Prunus mume [ume]
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             395   5e-134   Prunus persica
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     393   6e-134   Eucalyptus grandis [rose gum]
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             395   7e-134   Gossypium arboreum [tree cotton]
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              395   7e-134   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN40824.1|  unknown                                                 395   7e-134   Picea sitchensis
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                395   8e-134   Erythranthe guttata [common monkey flower]
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     395   8e-134   Populus trichocarpa [western balsam poplar]
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                395   9e-134   Erythranthe guttata [common monkey flower]
gb|AGG37288.1|  alpha-tubulin 6                                         395   9e-134   Salix arbutifolia
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   395   9e-134   Populus euphratica
gb|KHG26159.1|  Tubulin alpha-6 chain                                   395   9e-134   Gossypium arboreum [tree cotton]
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   395   9e-134   Vitis vinifera
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              395   1e-133   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB83375.1|  hypothetical protein B456_013G244600                    395   1e-133   Gossypium raimondii
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   395   1e-133   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHJ80820.1|  Tua3                                                    393   1e-133   Eragrostis tef [tef]
gb|AGG37284.1|  alpha-tubulin 2                                         395   1e-133   Salix arbutifolia
emb|CDY44941.1|  BnaA02g04460D                                          395   1e-133   Brassica napus [oilseed rape]
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             394   1e-133   Prunus persica
emb|CAD26887.1|  alpha-tubulin                                          394   1e-133   Miscanthus sinensis
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             394   1e-133   Citrus clementina [clementine]
emb|CAD26893.1|  alpha-tubulin                                          394   1e-133   Miscanthus floridulus
gb|ABO47741.1|  alpha-tubulin                                           394   1e-133   Gossypium hirsutum [American cotton]
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              394   1e-133   Phoenix dactylifera
gb|ABO47735.1|  alpha-tubulin                                           394   2e-133   Gossypium hirsutum [American cotton]
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              394   2e-133   Prunus mume [ume]
gb|AEG74028.1|  alpha-tubulin                                           394   2e-133   Apopellia endiviifolia (species B)
ref|XP_010112637.1|  Tubulin alpha-3 chain                              394   2e-133   Morus notabilis
ref|XP_001777081.1|  predicted protein                                  394   2e-133   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   394   2e-133   Gossypium arboreum [tree cotton]
emb|CDY42294.1|  BnaC02g09000D                                          394   2e-133   Brassica napus [oilseed rape]
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    394   2e-133   Tarenaya hassleriana [spider flower]
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              394   2e-133   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   394   2e-133   Eucalyptus grandis [rose gum]
gb|ABB16994.1|  unknown                                                 394   3e-133   Solanum tuberosum [potatoes]
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             394   3e-133   Capsella rubella
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               394   3e-133   Populus trichocarpa [western balsam poplar]
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   394   3e-133   Tarenaya hassleriana [spider flower]
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     394   3e-133   Eucalyptus grandis [rose gum]
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   394   3e-133   Elaeis guineensis
emb|CDX88875.1|  BnaA03g07740D                                          394   3e-133   
ref|NP_197478.1|  tubulin alpha-3                                       394   3e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              394   3e-133   Setaria italica
gb|AGG37286.1|  alpha-tubulin 4                                         394   3e-133   Salix arbutifolia
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    394   3e-133   Eleusine indica [crabgrass]
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              394   3e-133   Camelina sativa [gold-of-pleasure]
gb|AGY80453.1|  tubulin                                                 394   3e-133   Dendrocalamus latiflorus [sweet bamboo]
emb|CAD26891.1|  alpha-tubulin                                          394   3e-133   Miscanthus floridulus
gb|KHN47983.1|  Tubulin alpha-3 chain                                   392   3e-133   Glycine soja [wild soybean]
ref|NP_001242878.1|  uncharacterized protein LOC100806907               393   4e-133   Glycine max [soybeans]
ref|XP_001782790.1|  predicted protein                                  393   4e-133   
ref|NP_001237301.1|  tubulin A                                          393   4e-133   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             393   4e-133   Hordeum vulgare [barley]
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              393   4e-133   Brassica rapa
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    393   4e-133   
dbj|BAJ06363.1|  alpha-tubulin                                          393   4e-133   Alopecurus aequalis
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   393   4e-133   Brachypodium distachyon [annual false brome]
gb|ABD92942.1|  alpha tubulin-1D                                        393   4e-133   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              393   4e-133   Populus euphratica
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   393   4e-133   Brassica rapa
ref|NP_001060075.1|  Os07g0574800                                       393   4e-133   
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             393   5e-133   Phaseolus vulgaris [French bean]
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   393   5e-133   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001105324.1|  tubulin alpha-5 chain                              393   5e-133   Zea mays [maize]
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     393   5e-133   Populus trichocarpa [western balsam poplar]
gb|KJB80786.1|  hypothetical protein B456_013G115100                    393   5e-133   Gossypium raimondii
ref|NP_001105588.1|  tubulin alpha-6 chain                              393   5e-133   Zea mays [maize]
ref|XP_002532068.1|  tubulin alpha chain, putative                      393   5e-133   Ricinus communis
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              393   5e-133   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGI78243.1|  alpha tubulin 5                                         385   5e-133   Caragana korshinskii
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              393   5e-133   Oryza brachyantha
emb|CAD24765.1|  alpha-tubulin                                          393   6e-133   Miscanthus sinensis
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   393   6e-133   Phoenix dactylifera
gb|ABR67425.1|  alpha-tubulin 4                                         393   6e-133   Populus tremuloides
gb|AGD80034.1|  alpha-tubulin 1                                         393   6e-133   Hevea brasiliensis [jebe]
emb|CAD24767.1|  alpha-tubulin                                          393   6e-133   Miscanthus floridulus
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              393   7e-133   Elaeis guineensis
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              392   7e-133   Sesamum indicum [beniseed]
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             392   7e-133   Capsella rubella
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   392   7e-133   Nicotiana tomentosiformis
gb|KJB44614.1|  hypothetical protein B456_007G261000                    392   9e-133   Gossypium raimondii
emb|CAD24768.1|  alpha-tubulin                                          392   9e-133   Miscanthus floridulus
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              392   9e-133   Cicer arietinum [garbanzo]
ref|XP_003629736.1|  Alpha-tubulin                                      392   9e-133   Medicago truncatula
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   392   1e-132   Nelumbo nucifera [Indian lotus]
gb|KJB58759.1|  hypothetical protein B456_009G224800                    388   1e-132   Gossypium raimondii
gb|AAO63773.2|  alpha-tubulin 2                                         392   2e-132   Populus tremuloides
emb|CAD26890.1|  alpha-tubulin                                          392   2e-132   Miscanthus sinensis subsp. condensatus
gb|ABO47738.1|  alpha-tubulin                                           391   2e-132   Gossypium hirsutum [American cotton]
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              391   2e-132   Eucalyptus grandis [rose gum]
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             391   3e-132   Citrus clementina [clementine]
gb|AIC33057.1|  tubulin alpha-1 chain                                   391   3e-132   Panax ginseng [Asiatic ginseng]
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             388   3e-132   Anemia phyllitidis
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              391   4e-132   Nelumbo nucifera [Indian lotus]
gb|ABV55994.1|  alpha-tubulin 6                                         391   4e-132   Populus tremuloides
ref|XP_007014666.1|  Tubulin alpha-5                                    390   5e-132   Theobroma cacao [chocolate]
gb|AAW57309.1|  alpha-tubulin                                           384   5e-132   Ceratopteris richardii
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              390   5e-132   Cucumis sativus [cucumbers]
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              390   5e-132   Brassica rapa
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              390   5e-132   Tarenaya hassleriana [spider flower]
emb|CAB76917.1|  alpha-tubulin 4                                        384   6e-132   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAW57310.1|  alpha-tubulin                                           384   7e-132   Ceratopteris richardii
gb|KJB32211.1|  hypothetical protein B456_005G229600                    387   7e-132   Gossypium raimondii
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        390   7e-132   Cucumis melo [Oriental melon]
emb|CAD26886.1|  alpha-tubulin                                          390   9e-132   Miscanthus sinensis
ref|XP_010414865.1|  PREDICTED: tubulin alpha-1 chain                   390   1e-131   Camelina sativa [gold-of-pleasure]
emb|CAD24766.1|  alpha-tubulin                                          389   1e-131   Miscanthus sinensis
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             389   1e-131   Gossypium arboreum [tree cotton]
gb|KIY91712.1|  Tubulin alpha chain                                     382   2e-131   Monoraphidium neglectum
emb|CDP14299.1|  unnamed protein product                                389   2e-131   Coffea canephora [robusta coffee]
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         389   2e-131   Jatropha curcas
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              389   2e-131   Cucumis melo [Oriental melon]
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              389   2e-131   Cucumis sativus [cucumbers]
gb|ABD92943.1|  alpha tubulin-1B                                        389   3e-131   Triticum aestivum [Canadian hard winter wheat]
gb|AGV54721.1|  tubulin alpha-3 chain-like protein                      388   4e-131   Phaseolus vulgaris [French bean]
gb|AAW57306.1|  alpha-tubulin                                           381   4e-131   Ceratopteris richardii
gb|KHN46768.1|  Tubulin alpha-3 chain                                   388   4e-131   Glycine soja [wild soybean]
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              388   4e-131   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             388   5e-131   Phaseolus vulgaris [French bean]
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   384   6e-131   Citrus sinensis [apfelsine]
ref|XP_006301274.1|  hypothetical protein CARUB_v10021674mg             387   7e-131   Capsella rubella
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              387   7e-131   
gb|KHN06388.1|  Tubulin alpha-3 chain                                   386   7e-131   Glycine soja [wild soybean]
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                387   8e-131   Avena sativa [cultivated oat]
emb|CAD26888.1|  alpha-tubulin                                          387   8e-131   Miscanthus transmorrisonensis
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              387   9e-131   Glycine max [soybeans]
emb|CAJ38386.1|  alpha tubulin                                          380   1e-130   Plantago major [cart-track plant]
ref|XP_003624633.1|  Alpha-tubulin                                      387   1e-130   Medicago truncatula
gb|ABE01246.1|  alpha tubulin                                           387   1e-130   Camellia sinensis [black tea]
emb|CAA52158.1|  alpha tubulin                                          380   1e-130   Zea mays [maize]
gb|KJB58756.1|  hypothetical protein B456_009G224800                    385   1e-130   Gossypium raimondii
ref|XP_008621874.1|  tubulin alpha                                      380   2e-130   Saprolegnia diclina VS20
ref|XP_002959708.1|  alpha tubulin                                      379   2e-130   Volvox carteri f. nagariensis
gb|AHJ80819.1|  Tua1                                                    379   2e-130   Eragrostis tef [tef]
gb|AAO46127.1|  alpha-tubulin                                           379   2e-130   Streblomastix strix
gb|AHM93474.1|  alpha-tubulin                                           382   2e-130   Camellia chekiangoleosa
gb|AGZ90158.1|  tubulin alpha                                           384   2e-130   Litsea cubeba [may chang]
gb|AEN19681.1|  alpha-tubulin                                           384   3e-130   Cymbidium faberi
emb|CAD26892.1|  alpha-tubulin                                          386   3e-130   Miscanthus floridulus
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              385   4e-130   Brassica rapa
dbj|BAH19954.1|  AT1G50010                                              378   5e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KHG20487.1|  Tubulin alpha chain                                     385   5e-130   Gossypium arboreum [tree cotton]
gb|AIX10773.1|  alpha tubulin                                           385   5e-130   Panax notoginseng [san-qi]
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              385   5e-130   Sesamum indicum [beniseed]
gb|ADW83724.1|  alpha-tubulin                                           384   6e-130   Musa acuminata AAA Group [Cavendish banana]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   384   7e-130   Citrus sinensis [apfelsine]
ref|XP_002886753.1|  alpha-1 tubulin                                    385   7e-130   Arabidopsis lyrata subsp. lyrata
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     385   7e-130   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     385   7e-130   Pyrus x bretschneideri [bai li]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         385   7e-130   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           385   7e-130   Betula pendula [white birch]
gb|ABO47739.1|  alpha-tubulin                                           385   8e-130   Gossypium hirsutum [American cotton]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     385   8e-130   Eucalyptus grandis [rose gum]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             385   8e-130   Prunus persica
emb|CAN62392.1|  hypothetical protein VITISV_016172                     384   9e-130   Vitis vinifera
ref|XP_003608582.1|  Tubulin alpha-5 chain                              385   9e-130   Medicago truncatula
ref|XP_010093625.1|  Tubulin alpha chain                                385   9e-130   Morus notabilis
ref|XP_007515802.1|  alpha-tubulin                                      384   9e-130   Bathycoccus prasinos
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                385   9e-130   Elaeis guineensis
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        385   1e-129   Cucumis melo [Oriental melon]
gb|AAO46126.1|  alpha-tubulin                                           377   1e-129   Streblomastix strix
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          385   1e-129   Malus domestica [apple tree]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              385   1e-129   Cucumis sativus [cucumbers]
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                384   1e-129   Nelumbo nucifera [Indian lotus]
gb|AIX10966.1|  tubulin                                                 384   1e-129   Ornithogalum longebracteatum [sea-onion]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                384   1e-129   Prunus dulcis [sweet almond]
gb|ACN40181.1|  unknown                                                 384   1e-129   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     384   1e-129   Vitis vinifera
ref|NP_001289660.1|  tubulin alpha chain-like                           384   1e-129   Eucalyptus grandis [rose gum]
gb|ABO61400.1|  alpha tubulin                                           378   1e-129   Rhodomonas salina
gb|EYU20672.1|  hypothetical protein MIMGU_mgv1a004180mg                387   1e-129   Erythranthe guttata [common monkey flower]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                384   1e-129   Elaeis guineensis
ref|XP_002510010.1|  tubulin alpha chain, putative                      384   1e-129   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           384   1e-129   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         384   1e-129   Pseudotsuga menziesii var. menziesii
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             384   1e-129   Citrus clementina [clementine]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   384   1e-129   Nelumbo nucifera [Indian lotus]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             384   1e-129   Selaginella moellendorffii
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                384   1e-129   Phoenix dactylifera
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         384   1e-129   Jatropha curcas
ref|XP_002517492.1|  tubulin alpha chain, putative                      384   1e-129   Ricinus communis
ref|XP_002522104.1|  tubulin alpha chain, putative                      384   1e-129   Ricinus communis
gb|ABL61201.1|  alpha-tubulin                                           379   1e-129   Oxymonadida environmental sample
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                384   1e-129   Nelumbo nucifera [Indian lotus]
ref|XP_011398411.1|  Tubulin alpha chain                                382   1e-129   Auxenochlorella protothecoides
ref|XP_007018369.1|  Tubulin alpha-2 chain                              384   1e-129   Theobroma cacao [chocolate]
ref|NP_176654.1|  tubulin alpha-1 chain                                 384   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                384   1e-129   Phoenix dactylifera
ref|XP_007042689.1|  Tubulin alpha-2 chain                              384   1e-129   Theobroma cacao [chocolate]
gb|AAW57305.1|  alpha-tubulin                                           379   1e-129   Ceratopteris richardii
ref|XP_001764722.1|  predicted protein                                  384   1e-129   
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    384   1e-129   Gossypium hirsutum [American cotton]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     384   1e-129   Vitis vinifera
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     384   1e-129   Phoenix dactylifera
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    384   1e-129   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             384   1e-129   Citrus clementina [clementine]
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        384   1e-129   Glycine max [soybeans]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                384   1e-129   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              384   1e-129   Medicago truncatula
gb|ABO47740.1|  alpha-tubulin                                           384   1e-129   Gossypium hirsutum [American cotton]
gb|ABO47736.1|  alpha-tubulin                                           384   2e-129   Gossypium hirsutum [American cotton]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                384   2e-129   Vitis vinifera
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     384   2e-129   Nelumbo nucifera [Indian lotus]
gb|AGG37283.1|  alpha-tubulin 1                                         384   2e-129   Salix arbutifolia
gb|KHN08201.1|  Tubulin alpha chain                                     384   2e-129   Glycine soja [wild soybean]
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         384   2e-129   Jatropha curcas
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             384   2e-129   Populus trichocarpa [western balsam poplar]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                384   2e-129   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                384   2e-129   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     384   2e-129   Carthamus tinctorius
gb|KJB29387.1|  hypothetical protein B456_005G097800                    384   2e-129   Gossypium raimondii
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     384   2e-129   Populus euphratica
ref|XP_010099392.1|  Tubulin alpha chain                                384   2e-129   
gb|AGG37289.1|  alpha-tubulin 7                                         384   2e-129   Salix arbutifolia
gb|AAO46128.1|  alpha-tubulin                                           377   2e-129   Streblomastix strix
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          384   2e-129   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                384   2e-129   Pyrus x bretschneideri [bai li]
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             384   2e-129   
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                384   2e-129   Elaeis guineensis
gb|KHG18997.1|  Tubulin alpha chain                                     384   2e-129   Gossypium arboreum [tree cotton]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   384   2e-129   Fragaria vesca subsp. vesca
gb|ABL61224.1|  alpha-tubulin                                           379   2e-129   Oxymonadida environmental sample
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               384   2e-129   Pisum sativum [garden pea]
gb|AEW46684.1|  beta-tubulin                                            384   2e-129   Ulva linza
gb|AEQ75493.1|  alpha-tubulin                                           383   2e-129   Rosa multiflora [Japanese rose]
gb|ABL61216.1|  alpha-tubulin                                           379   2e-129   Oxymonadida environmental sample
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             384   2e-129   Eutrema salsugineum [saltwater cress]
gb|AEN19682.1|  alpha-tubulin                                           382   2e-129   Cymbidium faberi
ref|XP_005851144.1|  alpha-tubulin                                      384   2e-129   Chlorella variabilis
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             384   2e-129   Prunus persica
emb|CAB77671.1|  alpha-tubulin                                          384   3e-129   Miscanthus sinensis f. glaber
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             384   3e-129   Prunus persica
gb|ABL61215.1|  alpha-tubulin                                           379   3e-129   Oxymonadida environmental sample
gb|ABL61212.1|  alpha-tubulin                                           379   3e-129   Oxymonadida environmental sample
gb|ABO61420.1|  alpha tubulin                                           381   3e-129   prasinophyte sp. SL-175
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   384   3e-129   Malus domestica [apple tree]
gb|AGG37285.1|  alpha-tubulin 3                                         384   3e-129   Salix arbutifolia
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              384   3e-129   Fragaria vesca subsp. vesca
gb|ABQ59633.1|  alpha-tubulin 3                                         383   3e-129   Populus tremuloides
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   383   3e-129   Citrus sinensis [apfelsine]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                383   3e-129   Fragaria vesca subsp. vesca
gb|ABA41240.1|  alpha-tubulin                                           382   3e-129   Cyanophora paradoxa
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    383   4e-129   Gossypium hirsutum [American cotton]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   383   4e-129   Populus euphratica
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                383   4e-129   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 383   4e-129   Populus trichocarpa [western balsam poplar]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              383   4e-129   
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    383   4e-129   Glycine max [soybeans]
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            379   4e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    383   4e-129   
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             383   4e-129   Prunus persica
gb|ABA41238.1|  alpha-tubulin                                           381   4e-129   
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       382   4e-129   
gb|ABK92520.1|  unknown                                                 383   4e-129   
gb|KIZ03400.1|  Tubulin alpha chain                                     383   4e-129   
gb|ADJ00012.1|  tubulin alpha chain                                     375   4e-129   
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     383   4e-129   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        383   4e-129   
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             383   5e-129   
dbj|BAJ06364.1|  alpha-tubulin                                          383   5e-129   
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              383   5e-129   
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             383   5e-129   
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   383   5e-129   
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             383   5e-129   
gb|ABA41248.1|  alpha-tubulin                                           381   5e-129   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     383   5e-129   
gb|ABD92937.1|  alpha tubulin-4A                                        383   5e-129   
gb|ABD92936.1|  alpha tubulin-4D                                        383   5e-129   
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              383   5e-129   
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              383   6e-129   
gb|KEH43997.1|  tubulin beta-1 chain                                    383   6e-129   
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                383   6e-129   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   382   6e-129   
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          382   6e-129   
ref|XP_007047652.1|  Tubulin alpha-2 chain                              384   6e-129   
gb|AFW67749.1|  alpha tubulin4                                          378   7e-129   
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             382   7e-129   
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             382   7e-129   
gb|ABL61202.1|  alpha-tubulin                                           377   7e-129   
gb|EPS62716.1|  alpha-tubulin                                           381   8e-129   
gb|ABO61432.1|  alpha tubulin                                           380   8e-129   
ref|XP_002508010.1|  alpha tubulin 2                                    382   8e-129   
gb|ABL61219.1|  alpha-tubulin                                           377   9e-129   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             382   9e-129   
gb|ABL61213.1|  alpha-tubulin                                           377   1e-128   
gb|ETM52928.1|  tubulin alpha chain                                     380   1e-128   
emb|CAM58978.1|  alpha tubulin 5                                        374   1e-128   
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   382   1e-128   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             382   1e-128   
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     382   1e-128   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             382   1e-128   
prf||1503274A  alpha1 tubulin                                           382   1e-128
ref|XP_005643073.1|  tubulin alpha chain                                382   1e-128   
ref|XP_005651460.1|  tubulin alpha chain                                382   1e-128   
gb|ABL61217.1|  alpha-tubulin                                           377   1e-128   
gb|AEE98361.1|  alpha-tubulin                                           374   1e-128   
emb|CAB66336.1|  alpha-tubulin                                          382   1e-128   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                382   2e-128   
gb|AAB36609.1|  alpha-tubulin                                           379   2e-128   
gb|AGV54500.1|  tubulin A                                               382   2e-128   
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   382   2e-128   
dbj|BAC24800.1|  alpha tubulin                                          382   2e-128   
dbj|BAA92148.1|  alpha-tubulin                                          379   2e-128   
gb|ABL61203.1|  alpha-tubulin                                           376   2e-128   
gb|ABO47737.1|  alpha-tubulin                                           382   2e-128   
gb|AAB61233.1|  alpha-tubulin                                           379   2e-128   
gb|ABL61227.1|  alpha-tubulin                                           377   2e-128   
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                382   2e-128   
ref|XP_007512064.1|  alpha-tubulin                                      381   2e-128   
dbj|BAP59012.1|  alpha tubulin                                          381   2e-128   
gb|KHN42598.1|  Tubulin alpha-2 chain                                   381   2e-128   
ref|XP_003058621.1|  alpha tubulin                                      381   2e-128   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    381   2e-128   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             381   2e-128   
gb|ACK76232.1|  alpha-tubulin                                           381   2e-128   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              381   2e-128   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     381   2e-128   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 381   2e-128   
gb|ABO61428.1|  alpha tubulin                                           379   3e-128   
gb|ABA41241.1|  alpha-tubulin                                           379   3e-128   
gb|ABC59068.2|  alpha tubulin 1                                         381   3e-128   
gb|ABV55999.1|  alpha-tubulin 7                                         381   3e-128   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  381   3e-128   
gb|ABO47742.1|  alpha-tubulin                                           381   3e-128   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                381   3e-128   
gb|AAT09063.1|  alpha tubulin 1                                         381   3e-128   
gb|AFP25219.1|  alpha-tubulin                                           379   3e-128   
gb|ABU93324.1|  tubulin alpha subunit                                   381   3e-128   
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                382   4e-128   
gb|ACU20294.1|  unknown                                                 377   4e-128   
gb|ABA41244.1|  alpha-tubulin                                           379   4e-128   
gb|AAB86648.1|  alpha-tubulin                                           380   4e-128   
gb|AAX63396.1|  alpha-tubulin                                           380   4e-128   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    380   4e-128   
gb|ABL61214.1|  alpha-tubulin                                           375   4e-128   
gb|AAO46130.1|  alpha-tubulin                                           373   4e-128   
gb|ABL61226.1|  alpha-tubulin                                           375   4e-128   
ref|XP_001419217.1|  predicted protein                                  380   4e-128   
gb|EKF28172.1|  epsilon tubulin, putative                               373   4e-128   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             380   5e-128   
gb|AAB86649.1|  alpha-tubulin                                           380   5e-128   
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     380   5e-128   
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                380   5e-128   
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             380   5e-128   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             380   5e-128   
gb|ABL61204.1|  alpha-tubulin                                           375   5e-128   
ref|WP_039310890.1|  hypothetical protein                               380   6e-128   
gb|ABA41243.1|  alpha-tubulin                                           378   6e-128   
gb|EKF29047.1|  epsilon tubulin, putative                               372   6e-128   
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              379   6e-128   
emb|CCD11782.1|  unnamed protein product                                373   6e-128   
dbj|BAG99724.1|  unnamed protein product                                379   6e-128   
gb|AAB61232.1|  alpha-tubulin                                           378   6e-128   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             380   6e-128   
gb|ABQ59634.1|  alpha-tubulin 5                                         380   6e-128   
ref|XP_002951007.1|  alpha tubulin                                      380   6e-128   
emb|CBH08958.1|  alpha tubulin, (fragment)                              375   7e-128   
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              380   7e-128   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                380   8e-128   
ref|NP_001167663.1|  tubulin alpha-3 chain                              380   8e-128   
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    380   8e-128   
gb|AFC88832.1|  putative tubulin alpha-3 chain                          380   8e-128   
gb|AHJ80823.1|  Tua1                                                    380   8e-128   
gb|EJY81124.1|  Alpha tubulin,putative                                  380   8e-128   
gb|AGG37287.1|  alpha-tubulin 5                                         380   8e-128   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                380   8e-128   
dbj|BAJ06362.1|  alpha-tubulin                                          380   8e-128   
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   380   8e-128   
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              380   8e-128   
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              380   9e-128   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   380   9e-128   
gb|ABL61197.1|  alpha-tubulin                                           377   9e-128   
emb|CDW82295.1|  alpha tubulin                                          380   9e-128   
gb|ABL61218.1|  alpha-tubulin                                           375   9e-128   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             378   9e-128   
gb|AAP32191.1|  alpha-tubulin                                           377   1e-127   
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              379   1e-127   
gb|ABO61429.1|  alpha tubulin                                           377   1e-127   
emb|CAA06619.1|  alpha-tubulin 1                                        379   1e-127   
ref|XP_004489692.1|  PREDICTED: tubulin alpha-3 chain-like              379   1e-127   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                379   1e-127   
gb|AFK33477.1|  unknown                                                 376   1e-127   
ref|XP_001770881.1|  predicted protein                                  379   1e-127   
emb|CDY29334.1|  BnaA05g16010D                                          379   1e-127   
ref|XP_001691876.1|  alpha tubulin 1                                    379   1e-127   
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              379   1e-127   
gb|ETM30643.1|  tubulin alpha chain                                     379   1e-127   
gb|ABL61200.1|  alpha-tubulin                                           377   1e-127   
gb|ETM53018.1|  tubulin alpha chain                                     372   1e-127   
gb|EWC76931.1|  tubulin alpha chain                                     374   1e-127   
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   379   1e-127   
gb|AHJ80815.1|  Tua1                                                    379   2e-127   
gb|AEF79970.1|  alpha-tubulin protein                                   379   2e-127   
gb|AAT09064.1|  alpha tubulin 2                                         379   2e-127   
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          379   2e-127   
gb|ABO61398.1|  alpha tubulin                                           377   2e-127   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                379   2e-127   
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     379   2e-127   
emb|CDP02221.1|  unnamed protein product                                379   2e-127   
ref|NP_001291325.1|  tubulin alpha chain-like                           379   2e-127   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             374   2e-127   
emb|CDY66630.1|  BnaCnng51680D                                          379   2e-127   
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              379   2e-127   
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    379   2e-127   
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             379   2e-127   
gb|ABC97356.1|  alpha tubulin                                           379   2e-127   
gb|ABP65320.1|  alpha tubulin                                           379   2e-127   
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              379   2e-127   
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     379   2e-127   
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             379   2e-127   
gb|ABP65323.1|  alpha tubulin                                           379   2e-127   
dbj|BAK61741.1|  alpha tubulin 1                                        377   2e-127   
gb|ETO82054.1|  tubulin alpha chain                                     379   2e-127   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              379   2e-127   
gb|ABO61408.1|  alpha tubulin                                           377   2e-127   
tpg|DAA51109.1|  TPA: alpha tubulin                                     379   2e-127   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             379   2e-127   
emb|CCI45804.1|  unnamed protein product                                379   2e-127   
emb|CCI41153.1|  unnamed protein product                                379   2e-127   
ref|XP_008900864.1|  tubulin alpha chain                                379   2e-127   
emb|CAL80740.1|  alpha-tubulin                                          379   2e-127   
gb|ABL61205.1|  alpha-tubulin                                           378   2e-127   
ref|XP_008872990.1|  tubulin alpha chain                                379   2e-127   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     379   2e-127   
gb|ABB02631.1|  unknown                                                 379   2e-127   
gb|AAW58097.1|  alpha-tubulin                                           377   2e-127   
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     379   2e-127   
ref|XP_002904195.1|  alpha-tubulin, putative                            379   2e-127   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           379   2e-127   
gb|ACH68563.1|  alpha-tubulin                                           379   2e-127   
ref|XP_002904194.1|  alpha-tubulin                                      379   2e-127   
gb|ABL61209.1|  alpha-tubulin                                           378   3e-127   
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                379   3e-127   
ref|NP_193232.1|  tubulin alpha-6 chain                                 379   3e-127   
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              379   3e-127   
ref|XP_010104543.1|  Tubulin alpha chain                                378   3e-127   
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                379   3e-127   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             379   3e-127   
gb|ETM52951.1|  tubulin alpha chain                                     378   3e-127   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           378   3e-127   
emb|CAA62916.1|  alpha-tubulin                                          378   3e-127   
gb|AAB08791.1|  alpha tubulin                                           378   3e-127   
gb|ABG81329.1|  alpha-tubulin                                           376   3e-127   
emb|CEF99848.1|  Tubulin/FtsZ, 2-layer sandwich domain                  378   3e-127   
gb|AFP25223.1|  alpha-tubulin                                           375   3e-127   
gb|AAD02566.1|  alpha-tubulin                                           376   3e-127   
ref|NP_001275271.1|  alpha-tubulin-like protein                         378   3e-127   
gb|EPR58771.1|  alpha tubulin TUBA1                                     377   3e-127   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             378   3e-127   
gb|ABD92930.1|  alpha tubulin-2A                                        378   3e-127   
emb|CAB77672.1|  alpha-tubulin                                          378   3e-127   
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             378   3e-127   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      374   3e-127   
gb|ABK92552.1|  unknown                                                 378   4e-127   
emb|CCA20146.1|  alpha tubulin 1 putative                               378   4e-127   
gb|AAS66990.1|  alpha-tubulin                                           375   4e-127   
gb|ABL61210.1|  alpha-tubulin                                           377   4e-127   
emb|CDJ60085.1|  tubulin alpha chain, putative                          377   4e-127   
ref|XP_009842456.1|  tubulin alpha chain                                378   4e-127   
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          378   4e-127   
gb|AHJ80817.1|  Tua1                                                    378   4e-127   
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                378   4e-127   
ref|NP_001051132.1|  Os03g0726100                                       378   4e-127   
ref|XP_003082284.1|  TBA_CHLVU Tubulin alpha chain (ISS)                378   4e-127   
gb|AHC92565.1|  alpha tubulin subunit                                   375   4e-127   
ref|NP_171974.1|  tubulin alpha-4 chain                                 378   4e-127   
gb|ETW27380.1|  tubulin alpha chain                                     373   5e-127   
dbj|BAK61736.1|  alpha tubulin 1                                        376   5e-127   
gb|ABO61397.1|  alpha tubulin                                           376   5e-127   
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        378   5e-127   
gb|ABA41245.1|  alpha-tubulin                                           376   5e-127   
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    378   5e-127   



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   397 bits (1019),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  45   ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  104

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  105  YAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  164

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  165  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  224

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  225  DHKFDLMYSKRAFVHWYVGEGM  246



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   394 bits (1012),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  36   ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  95

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  96   YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  155

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  156  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  215

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  216  DHKFDLMYAKRAFVHWYVGEGM  237



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   393 bits (1009),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  17   ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  76

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  77   YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  136

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  137  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  196

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  197  DHKFDLMYAKRAFVHWYVGEGM  218



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   395 bits (1014),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  107  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSS  166

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  167  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  226

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  227  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  286

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  287  DHKFDLMYAKRAFVHWYVGEGM  308



>ref|XP_008386829.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=449

 Score =   399 bits (1024),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITS+VFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITSSVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 199/202 (99%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_009366459.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   397 bits (1021),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKT+RTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTRRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|KJB83378.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=404

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  167  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  226

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  227  YAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  286

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RI
Sbjct  287  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARI  346

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  347  DHKFDLMYSKRAFVHWYVGEGM  368



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   389 bits (1000),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICR+SLD+ERP+YTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  11   ICRKSLDIERPSYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  70

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  71   YAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  130

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  131  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  190

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  191  DHKFDLMYAKRAFVHWYVGEGM  212



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   390 bits (1003),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ RPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  46   ICRRSLDIGRPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  105

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  106  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  165

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  166  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  225

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  226  DHKFDLMYAKRAFVHWYVGEGM  247



>ref|XP_011034391.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=449

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+A
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_004295008.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   397 bits (1019),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_009375870.1| PREDICTED: tubulin alpha-3 chain [Pyrus x bretschneideri]
Length=449

 Score =   396 bits (1018),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>tpg|DAA41189.1| TPA: alpha tubulin5 [Zea mays]
Length=320

 Score =   392 bits (1006),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  82   ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  141

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  142  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  201

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  202  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  261

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  262  DHKFDLMYAKRAFVHWYVGEGM  283



>emb|CDP17586.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   396 bits (1018),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_008351479.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
Length=449

 Score =   396 bits (1018),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_008349406.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_008366135.1| PREDICTED: tubulin alpha-3 chain [Malus domestica]
 ref|XP_009339175.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   396 bits (1018),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays]
Length=320

 Score =   391 bits (1005),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  82   ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  141

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  142  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  201

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  202  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  261

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  262  DHKFDLMYAKRAFVHWYVGEGM  283



>gb|AHJ80821.1| Tua3, partial [Eragrostis tef]
Length=401

 Score =   394 bits (1013),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  163  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  222

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  223  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  282

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  283  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  342

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  343  DHKFDLMYAKRAFVHWYVGEGM  364



>ref|XP_011089722.1| PREDICTED: tubulin alpha-3 chain [Sesamum indicum]
Length=449

 Score =   396 bits (1017),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_007030078.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY10580.1| Tubulin alpha-5 [Theobroma cacao]
Length=482

 Score =   397 bits (1020),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  245  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  304

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVIS+AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  305  YAPVISSAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  364

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  365  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  424

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  425  DHKFDLMYSKRAFVHWYVGEGM  446



>ref|XP_011021469.1| PREDICTED: tubulin alpha-3 chain-like [Populus euphratica]
Length=449

 Score =   396 bits (1017),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+A
Sbjct  272  YAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|AGG37290.1| alpha-tubulin 8 [Salix arbutifolia]
Length=449

 Score =   395 bits (1016),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+A
Sbjct  272  YAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_002325422.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE99803.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   395 bits (1016),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+A
Sbjct  272  YAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_006858944.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
 gb|ERN20411.1| hypothetical protein AMTR_s00068p00090790 [Amborella trichopoda]
Length=449

 Score =   395 bits (1016),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 198/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   395 bits (1016),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICR+SLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRKSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_008240533.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Prunus mume]
Length=449

 Score =   395 bits (1016),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNA+
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAS  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINY+PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_007204346.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
 gb|EMJ05545.1| hypothetical protein PRUPE_ppa005649mg [Prunus persica]
Length=449

 Score =   395 bits (1016),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNA+
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAS  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINY+PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|KCW87067.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=381

 Score =   393 bits (1009),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  144  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  203

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  204  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  263

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  264  VATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  323

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  324  DHKFDLMYAKRAFVHWYVGEGM  345



>gb|KHG06160.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   395 bits (1015),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_009413318.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   395 bits (1015),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|ACN40824.1| unknown [Picea sitchensis]
Length=449

 Score =   395 bits (1015),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|EYU31677.1| hypothetical protein MIMGU_mgv1a006281mg [Erythranthe guttata]
Length=449

 Score =   395 bits (1015),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002303998.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|EEE78977.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   395 bits (1015),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|EYU23006.1| hypothetical protein MIMGU_mgv1a006283mg [Erythranthe guttata]
Length=449

 Score =   395 bits (1014),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|AGG37288.1| alpha-tubulin 6 [Salix arbutifolia]
Length=449

 Score =   395 bits (1014),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTY+NLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYSNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN++
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSS  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_011025144.1| PREDICTED: tubulin alpha-3 chain [Populus euphratica]
Length=450

 Score =   395 bits (1014),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   395 bits (1014),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNT+VAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002285721.1| PREDICTED: tubulin alpha-3 chain [Vitis vinifera]
Length=449

 Score =   395 bits (1014),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_009406530.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   395 bits (1014),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KJB83375.1| hypothetical protein B456_013G244600 [Gossypium raimondii]
Length=449

 Score =   395 bits (1014),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_009400845.1| PREDICTED: tubulin alpha-3 chain [Musa acuminata subsp. malaccensis]
Length=450

 Score =   395 bits (1014),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AHJ80820.1| Tua3, partial [Eragrostis tef]
Length=400

 Score =   393 bits (1009),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  162  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  221

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPE+T+AVFEPSSMMAKCDPRHGKYMACCLMYRGDV+PKDVNAA
Sbjct  222  YAPVISAEKAYHEQLSVPEVTNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVIPKDVNAA  281

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  282  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  341

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  342  DHKFDLMYAKRAFVHWYVGEGM  363



>gb|AGG37284.1| alpha-tubulin 2 [Salix arbutifolia]
Length=450

 Score =   395 bits (1014),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>emb|CDY44941.1| BnaA02g04460D [Brassica napus]
 emb|CDY44942.1| BnaA02g04470D [Brassica napus]
Length=450

 Score =   395 bits (1014),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_007205189.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
 gb|EMJ06388.1| hypothetical protein PRUPE_ppa005642mg [Prunus persica]
Length=450

 Score =   394 bits (1013),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>emb|CAD26887.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   394 bits (1013),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_006445597.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 ref|XP_006488930.1| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Citrus sinensis]
 gb|ESR58837.1| hypothetical protein CICLE_v10015224mg [Citrus clementina]
 gb|KDO54446.1| hypothetical protein CISIN_1g013113mg [Citrus sinensis]
Length=449

 Score =   394 bits (1013),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CAD26893.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   394 bits (1013),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABO47741.1| alpha-tubulin [Gossypium hirsutum]
Length=449

 Score =   394 bits (1013),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_008804327.1| PREDICTED: tubulin alpha-1 chain-like [Phoenix dactylifera]
Length=450

 Score =   394 bits (1013),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABO47735.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG06862.1| Tubulin alpha-6 chain [Gossypium arboreum]
 gb|KJB66054.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
 gb|KJB66055.1| hypothetical protein B456_010G125700 [Gossypium raimondii]
Length=449

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_008223650.1| PREDICTED: tubulin alpha-3 chain-like [Prunus mume]
Length=450

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|AEG74028.1| alpha-tubulin [Pellia endiviifolia (species B)]
 gb|AEG74032.1| alpha-tubulin [Pellia endiviifolia (species B)]
Length=448

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010112637.1| Tubulin alpha-3 chain [Morus notabilis]
 gb|EXC34492.1| Tubulin alpha-3 chain [Morus notabilis]
Length=449

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KHG06861.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=460

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  223  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  282

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  283  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  342

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RI
Sbjct  343  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARI  402

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  403  DHKFDLMYSKRAFVHWYVGEGM  424



>emb|CDY42294.1| BnaC02g09000D [Brassica napus]
 emb|CDY42295.1| BnaC02g09010D [Brassica napus]
Length=450

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010535933.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Tarenaya hassleriana]
Length=449

 Score =   394 bits (1011),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_009408459.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   394 bits (1012),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010044940.1| PREDICTED: tubulin alpha-3 chain [Eucalyptus grandis]
 gb|KCW87066.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=449

 Score =   394 bits (1011),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABB16994.1| unknown [Solanum tuberosum]
Length=467

 Score =   394 bits (1013),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  230  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  289

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  290  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  349

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  350  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  409

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  410  DHKFDLMYAKRAFVHWYVGEGM  431



>ref|XP_006286664.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
 ref|XP_010493056.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010493058.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 gb|EOA19562.1| hypothetical protein CARUB_v10002583mg [Capsella rubella]
Length=450

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICR+SLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRKSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/202 (98%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTY NLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYNNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+A
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D+KFDLMYSKRAFVHWYVGEGM
Sbjct  392  DYKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_010531152.1| PREDICTED: tubulin alpha-3 chain [Tarenaya hassleriana]
Length=449

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KCW87065.1| hypothetical protein EUGRSUZ_B03604 [Eucalyptus grandis]
Length=458

 Score =   394 bits (1012),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  221  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  280

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  281  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  340

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINY+PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  341  VATIKTKRTVQFVDWCPTGFKCGINYEPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  400

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  401  DHKFDLMYAKRAFVHWYVGEGM  422



>ref|XP_010923361.1| PREDICTED: tubulin alpha-3 chain [Elaeis guineensis]
Length=450

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CDX88875.1| BnaA03g07740D [Brassica napus]
 emb|CDX70890.1| BnaC03g09740D [Brassica napus]
Length=450

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|NP_197478.1| tubulin alpha-3 [Arabidopsis thaliana]
 ref|NP_197479.1| tubulin alpha-5 [Arabidopsis thaliana]
 ref|XP_002871906.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002873963.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006400538.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 ref|XP_006400540.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 ref|XP_010420793.1| PREDICTED: tubulin alpha-3 chain [Camelina sativa]
 sp|Q56WH1.2|TBA3_ARATH RecName: Full=Tubulin alpha-3 chain [Arabidopsis thaliana]
 sp|B9DHQ0.2|TBA5_ARATH RecName: Full=Tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAK32888.1|AF367301_1 AT5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAA32888.1| alpha-tubulin [Arabidopsis thaliana]
 gb|AAA32891.1| alpha-5 tubulin [Arabidopsis thaliana]
 gb|AAK64169.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAL38340.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85097.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31860.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN31861.1| putative tubulin alpha-5 chain [Arabidopsis thaliana]
 gb|AAN28834.1| At5g19770/T29J13_190 [Arabidopsis thaliana]
 gb|AAN65084.1| unknown protein [Arabidopsis thaliana]
 gb|EFH48165.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50222.1| tubulin alpha-3 [Arabidopsis lyrata subsp. lyrata]
 gb|AED92747.1| tubulin alpha-3 [Arabidopsis thaliana]
 gb|AED92748.1| tubulin alpha-5 [Arabidopsis thaliana]
 gb|ESQ41991.1| hypothetical protein EUTSA_v10013521mg [Eutrema salsugineum]
 gb|ESQ41993.1| hypothetical protein EUTSA_v10013523mg [Eutrema salsugineum]
 gb|KFK26213.1| tubulin alpha-3 alpha-5 chain [Arabis alpina]
 gb|KFK26214.1| hypothetical protein AALP_AA8G217400 [Arabis alpina]
Length=450

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_004958110.1| PREDICTED: tubulin alpha-3 chain-like [Setaria italica]
Length=450

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AGG37286.1| alpha-tubulin 4 [Salix arbutifolia]
Length=450

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>sp|O22349.1|TBA3_ELEIN RecName: Full=Tubulin alpha-3 chain; AltName: Full=Alpha-3-tubulin 
[Eleusine indica]
 gb|AAC05719.1| alpha-tubulin 3 [Eleusine indica]
Length=450

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010454260.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
 ref|XP_010454262.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=450

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AGY80453.1| tubulin [Dendrocalamus latiflorus]
Length=450

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CAD26891.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   394 bits (1011),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KHN47983.1| Tubulin alpha-3 chain [Glycine soja]
Length=423

 Score =   392 bits (1008),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  185  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  244

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  245  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  304

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  305  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  364

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  365  DHKFDLMYAKRAFVHWYVGEGM  386



>ref|NP_001242878.1| uncharacterized protein LOC100806907 [Glycine max]
 gb|ACU18050.1| unknown [Glycine max]
Length=450

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|NP_001237301.1| tubulin A [Glycine max]
 gb|AAX86047.1| tubulin A [Glycine max]
Length=450

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>sp|Q43473.1|TBA1_HORVU RecName: Full=Tubulin alpha-1 chain [Hordeum vulgare]
 emb|CAA67942.1| alpha-tubulin 1 [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_009126391.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_006579487.1| PREDICTED: tubulin A isoform X1 [Glycine max]
Length=449

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>dbj|BAJ06363.1| alpha-tubulin [Alopecurus aequalis]
Length=450

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_003562846.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=450

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABD92942.1| alpha tubulin-1D [Triticum aestivum]
 gb|ABD92944.1| alpha tubulin-1A [Triticum aestivum]
 gb|EMS54563.1| Tubulin alpha-1 chain [Triticum urartu]
 gb|EMT26472.1| Tubulin alpha-1 chain [Aegilops tauschii]
Length=450

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_011048194.1| PREDICTED: tubulin alpha-6 chain-like [Populus euphratica]
Length=450

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_009120857.1| PREDICTED: tubulin alpha-3 chain [Brassica rapa]
 emb|CDX92501.1| BnaA10g15400D [Brassica napus]
 emb|CDX92502.1| BnaA10g15410D [Brassica napus]
Length=450

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|NP_001060075.1| Os07g0574800 [Oryza sativa Japonica Group]
 sp|P28752.1|TBA1_ORYSJ RecName: Full=Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 emb|CAA77988.1| alpha 1 tubulin [Oryza sativa Japonica Group]
 emb|CAA62918.1| alfa-tubulin [Oryza sativa Japonica Group]
 dbj|BAC83168.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 dbj|BAD30236.1| Tubulin alpha-1 chain [Oryza sativa Japonica Group]
 gb|ABG78594.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF21989.1| Os07g0574800 [Oryza sativa Japonica Group]
 gb|EAZ04436.1| hypothetical protein OsI_26583 [Oryza sativa Indica Group]
 gb|EAZ40391.1| hypothetical protein OsJ_24840 [Oryza sativa Japonica Group]
 dbj|BAG90561.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91280.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97017.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17548.1| alpha tubulin [Oryza sativa]
Length=450

 Score =   393 bits (1010),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_007159433.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
 gb|ESW31427.1| hypothetical protein PHAVU_002G237400g [Phaseolus vulgaris]
Length=449

 Score =   393 bits (1010),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010673470.1| PREDICTED: tubulin alpha-3 chain [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   393 bits (1010),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICR+SLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRKSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|NP_001105324.1| tubulin alpha-5 chain [Zea mays]
 sp|Q02245.1|TBA5_MAIZE RecName: Full=Tubulin alpha-5 chain; AltName: Full=Alpha-5-tubulin 
[Zea mays]
 emb|CAA44862.1| alpha-tubulin #5 [Zea mays]
 gb|AAA33437.1| alpha-tubulin [Zea mays]
 gb|AAA16225.1| alpha-tubulin [Zea mays]
 emb|CAD20822.1| alpha tubulin [Zea mays]
 tpg|DAA41190.1| TPA: alpha tubulin5 [Zea mays]
Length=450

 Score =   393 bits (1010),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002297631.1| alpha-tubulin 2 family protein [Populus trichocarpa]
 gb|ABK92439.1| unknown [Populus trichocarpa]
 gb|EEE82436.1| alpha-tubulin 2 family protein [Populus trichocarpa]
Length=450

 Score =   393 bits (1010),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|KJB80786.1| hypothetical protein B456_013G115100 [Gossypium raimondii]
Length=449

 Score =   393 bits (1009),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RI
Sbjct  332  VATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|NP_001105588.1| tubulin alpha-6 chain [Zea mays]
 sp|P33627.1|TBA6_MAIZE RecName: Full=Tubulin alpha-6 chain; AltName: Full=Alpha-6-tubulin 
[Zea mays]
 emb|CAA44863.1| alpha-tubulin #6 [Zea mays]
 gb|ACN35801.1| unknown [Zea mays]
 gb|AFE82989.1| tubulin alpha-5 [Saccharum hybrid cultivar]
 tpg|DAA63282.1| TPA: alpha tubulin6 [Zea mays]
Length=450

 Score =   393 bits (1009),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002532068.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF30323.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   393 bits (1009),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_009389058.1| PREDICTED: tubulin alpha-3 chain-like [Musa acuminata subsp. 
malaccensis]
Length=450

 Score =   393 bits (1009),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AGI78243.1| alpha tubulin 5, partial [Caragana korshinskii]
Length=240

 Score =   385 bits (989),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            IC+RSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  22   ICKRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  81

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  82   YAPVISAEKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  141

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+ IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNNTAVAEVFSRI
Sbjct  142  VSNIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAVAEVFSRI  201

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D KFDLMYSKRAFVHWYVGEGM
Sbjct  202  DQKFDLMYSKRAFVHWYVGEGM  223



>ref|XP_006657877.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=450

 Score =   393 bits (1009),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CAD24765.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   393 bits (1009),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_008813089.1| PREDICTED: tubulin alpha-3 chain [Phoenix dactylifera]
Length=450

 Score =   393 bits (1009),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABR67425.1| alpha-tubulin 4 [Populus tremuloides]
Length=450

 Score =   393 bits (1009),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIK+KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKSKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|AGD80034.1| alpha-tubulin 1 [Hevea brasiliensis]
Length=449

 Score =   393 bits (1009),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CAD24767.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   393 bits (1009),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRG+VVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGNVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010934670.1| PREDICTED: tubulin alpha-3 chain-like [Elaeis guineensis]
Length=450

 Score =   393 bits (1009),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_011075054.1| PREDICTED: tubulin alpha-3 chain-like [Sesamum indicum]
Length=449

 Score =   392 bits (1008),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRR+LD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRALDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_006286795.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
 gb|EOA19693.1| hypothetical protein CARUB_v10003470mg [Capsella rubella]
Length=450

 Score =   392 bits (1008),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICR+SLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRKSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLS+PEITSAVFEP SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSIPEITSAVFEPGSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_009622332.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009766182.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
Length=449

 Score =   392 bits (1008),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KA+HEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAFHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   392 bits (1008),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTY NLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYNNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGD+VPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDIVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNT+VAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CAD24768.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   392 bits (1008),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHG+YMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGRYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_004504311.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=449

 Score =   392 bits (1008),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_003629736.1| Alpha-tubulin [Medicago truncatula]
 gb|AET04212.1| tubulin beta-1 chain [Medicago truncatula]
Length=449

 Score =   392 bits (1008),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010257632.1| PREDICTED: tubulin alpha-3 chain [Nelumbo nucifera]
Length=449

 Score =   392 bits (1007),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRR+LD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRALDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   388 bits (997),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  102  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  161

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  162  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  221

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  222  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  281

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  282  DHKFDLMYAKRAFVHWYVGEGM  303



>gb|AAO63773.2| alpha-tubulin 2 [Populus tremuloides]
Length=450

 Score =   392 bits (1006),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAY EQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYREQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>emb|CAD26890.1| alpha-tubulin [Miscanthus sinensis subsp. condensatus]
Length=450

 Score =   392 bits (1006),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVI A KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVIPAEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABO47738.1| alpha-tubulin [Gossypium hirsutum]
 gb|KJB40985.1| hypothetical protein B456_007G086400 [Gossypium raimondii]
Length=449

 Score =   391 bits (1005),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNNTAVAEVF+RI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPAVVPGGDLAKVQRAVCMISNNTAVAEVFARI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_010054663.1| PREDICTED: tubulin alpha-3 chain-like [Eucalyptus grandis]
 gb|KCW89881.1| hypothetical protein EUGRSUZ_A02108 [Eucalyptus grandis]
Length=450

 Score =   391 bits (1005),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVP GDLAKVQRAVCMISNNTAV EVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMISNNTAVVEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_006443441.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
 ref|XP_006479124.1| PREDICTED: tubulin alpha-3 chain-like [Citrus sinensis]
 gb|ESR56681.1| hypothetical protein CICLE_v10020128mg [Citrus clementina]
Length=449

 Score =   391 bits (1005),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERP YTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPNYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQ+SVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN A
Sbjct  272  YAPVISAAKAYHEQISVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNTA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|AIC33057.1| tubulin alpha-1 chain [Panax ginseng]
Length=449

 Score =   391 bits (1004),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQ PTVVPGGDLAKVQRAVCMISNNTAV EVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQAPTVVPGGDLAKVQRAVCMISNNTAVVEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>sp|P33624.1|TBA2_ANEPH RecName: Full=Tubulin alpha-2 chain, partial [Anemia phyllitidis]
 emb|CAA48928.1| alpha tubulin 2, partial [Anemia phyllitidis]
Length=364

 Score =   388 bits (996),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 194/203 (96%), Positives = 201/203 (99%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    ICRRSL-DVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLS  178
            ICRRSL D+ERPTYTNLNRL+SQIISSLTTSLRFDGA+NVD+TEFQTNLVPYPRIHFMLS
Sbjct  127  ICRRSLLDIERPTYTNLNRLVSQIISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLS  186

Query  179  SYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNA  358
            SYAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNA
Sbjct  187  SYAPVISAAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNA  246

Query  359  AVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSR  538
            AVATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSR
Sbjct  247  AVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSR  306

Query  539  IDHKFDLMYSKRAFVHWYVGEGM  607
            IDHKFDLMY+K AFVHWYVGEGM
Sbjct  307  IDHKFDLMYAKLAFVHWYVGEGM  329



>ref|XP_010276368.1| PREDICTED: tubulin alpha-3 chain-like [Nelumbo nucifera]
Length=450

 Score =   391 bits (1004),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRR+LD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRALDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            Y+PVIS+ KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YSPVISSEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABV55994.1| alpha-tubulin 6 [Populus tremuloides]
Length=449

 Score =   391 bits (1004),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 196/202 (97%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTY NLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYNNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLS PEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+A
Sbjct  272  YAPVISAAKAYHEQLSGPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D+KFDLMYSKRAFVHWYVGEGM
Sbjct  392  DYKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_007014666.1| Tubulin alpha-5 [Theobroma cacao]
 gb|EOY32285.1| Tubulin alpha-5 [Theobroma cacao]
Length=449

 Score =   390 bits (1003),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KA+HEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAFHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VSTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   384 bits (985),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  27   ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  86

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  87   YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  146

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  147  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  206

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D+KFDLMY+KRAFVHWYVGEGM
Sbjct  207  DYKFDLMYAKRAFVHWYVGEGM  228



>ref|XP_004149645.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 ref|XP_004164931.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN54025.1| hypothetical protein Csa_4G268090 [Cucumis sativus]
Length=449

 Score =   390 bits (1003),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD++RPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIDRPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLALVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_009126389.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   390 bits (1003),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINV +TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVAITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLS+PEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSIPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010528739.1| PREDICTED: tubulin alpha-6 chain-like [Tarenaya hassleriana]
Length=450

 Score =   390 bits (1003),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 202/202 (100%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            IC+RSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICKRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKA+HEQLSVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAFHEQLSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   384 bits (987),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLTTSLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  50   ICRRSLDIERPTYTNLNRLVSQVISSLTTSLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  109

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  110  YAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  169

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+V EVFSRI
Sbjct  170  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRI  229

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  230  DHKFDLMYAKRAFVHWYVGEGM  251



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   384 bits (985),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  28   ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  87

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  88   YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  147

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  148  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  207

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D+KFDLMY+KRAFVHWYVGEGM
Sbjct  208  DYKFDLMYAKRAFVHWYVGEGM  229



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   387 bits (994),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  123  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  182

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  183  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  242

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  243  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  302

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  303  DHKFDLMYAKRAFVHWYVGEGM  324



>ref|XP_008449885.1| PREDICTED: tubulin alpha-3 chain isoform X1 [Cucumis melo]
Length=449

 Score =   390 bits (1002),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD++RPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIDRPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLA VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLALVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CAD26886.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   390 bits (1001),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TE QTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTESQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010414865.1| PREDICTED: tubulin alpha-1 chain [Camelina sativa]
Length=450

 Score =   390 bits (1001),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVIS+AKAYHEQ SVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN A
Sbjct  272  YAPVISSAKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNTA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>emb|CAD24766.1| alpha-tubulin [Miscanthus sinensis]
Length=450

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIH MLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHLMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIK KRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKAKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KHG19627.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=449

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHE +SVPEITS VFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEHISVPEITSVVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVF+RI
Sbjct  332  VATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFARI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   382 bits (980),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERP+YTNLNRL++Q+ISSLTTSLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  10   ICRRSLDIERPSYTNLNRLVAQVISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLSS  69

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNA+
Sbjct  70   YAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAS  129

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TAVAEVFSR+
Sbjct  130  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRL  189

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  190  DHKFDLMYAKRAFVHWYVGEGM  211



>emb|CDP14299.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   389 bits (999),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRR+LD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRALDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVIS+AKAYHEQLSVPEIT++VFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISSAKAYHEQLSVPEITNSVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VA+IKTKRTVQFVDWCPTGFKCGINYQPPTVVP GDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VASIKTKRTVQFVDWCPTGFKCGINYQPPTVVPCGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>gb|KDP42087.1| hypothetical protein JCGZ_01875 [Jatropha curcas]
Length=450

 Score =   389 bits (999),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQ+S+PEIT+AVFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAQKAYHEQISIPEITNAVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLA+VQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLARVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_008464962.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis melo]
Length=449

 Score =   389 bits (998),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVIS+AKAYHEQLSVPEIT+AVF+PSSMM KCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISSAKAYHEQLSVPEITNAVFDPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+TAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_004141134.1| PREDICTED: tubulin alpha-3 chain-like [Cucumis sativus]
 gb|KGN59749.1| Tubulin alpha-3 chain [Cucumis sativus]
Length=449

 Score =   389 bits (998),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVIS+AKAYHEQLSVPEIT+AVF+PSSMM KCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISSAKAYHEQLSVPEITNAVFDPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+TAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABD92943.1| alpha tubulin-1B [Triticum aestivum]
Length=450

 Score =   389 bits (998),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGI YQPP+VVPGGDLAKVQRAVCMISNNTAVAEVF RI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGIKYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFLRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AGV54721.1| tubulin alpha-3 chain-like protein [Phaseolus vulgaris]
Length=448

 Score =   388 bits (997),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICR+SLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRKSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNA+
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAS  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+ IK KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D+KFDLMY+KRAFVHWYVGEGM
Sbjct  392  DYKFDLMYAKRAFVHWYVGEGM  413



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   381 bits (978),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  18   ICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSS  77

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACC+MYRGDVVPKDVNA+
Sbjct  78   YAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCMMYRGDVVPKDVNAS  137

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T++AEVFSR+
Sbjct  138  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSIAEVFSRL  197

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  198  DHKFDLMYAKRAFVHWYVGEGM  219



>gb|KHN46768.1| Tubulin alpha-3 chain [Glycine soja]
Length=443

 Score =   388 bits (996),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+ IKTKRTVQFVDWCPTGFKCGINYQPPTVVP GDLAKVQRAVCMISNNTAVAEVF+RI
Sbjct  332  VSNIKTKRTVQFVDWCPTGFKCGINYQPPTVVPAGDLAKVQRAVCMISNNTAVAEVFARI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D+KFDLMY+KRAFVHWYVGEGM
Sbjct  392  DYKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010693818.1| PREDICTED: tubulin alpha-3 chain-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   388 bits (997),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            IC+RSL++ERPTYTNLNRLISQ++SSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICKRSLNIERPTYTNLNRLISQVVSSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMA CLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITTAVFEPSSMMAKCDPRHGKYMASCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_007161955.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
 gb|ESW33949.1| hypothetical protein PHAVU_001G111700g [Phaseolus vulgaris]
Length=448

 Score =   388 bits (996),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICR+SLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRKSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNA+
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAS  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+ IK KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D+KFDLMY+KRAFVHWYVGEGM
Sbjct  392  DYKFDLMYAKRAFVHWYVGEGM  413



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   384 bits (987),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  116  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  175

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KA+HEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  176  YAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  235

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  236  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  295

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  296  DHKFDLMYAKRAFVHWYVGEGM  317



>ref|XP_006301274.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
 gb|EOA34172.1| hypothetical protein CARUB_v10021674mg [Capsella rubella]
Length=450

 Score =   387 bits (995),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVIS+AKAYHEQ SVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN A
Sbjct  272  YAPVISSAKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNTA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VA IKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VANIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_004493170.1| PREDICTED: tubulin alpha-3 chain-like [Cicer arietinum]
Length=450

 Score =   387 bits (995),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 190/202 (94%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICR+SLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRKSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVIS+AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISSAKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+ IKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNNTAVAEVFSRI
Sbjct  332  VSNIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KHN06388.1| Tubulin alpha-3 chain [Glycine soja]
Length=421

 Score =   386 bits (992),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 193/199 (97%), Positives = 199/199 (100%), Gaps = 0/199 (0%)
 Frame = +2

Query  11   RSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSSYAP  190
            RSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSSYAP
Sbjct  187  RSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAP  246

Query  191  VISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAT  370
            VISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAT
Sbjct  247  VISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAT  306

Query  371  IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  550
            IKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  307  IKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  366

Query  551  FDLMYSKRAFVHWYVGEGM  607
            FDLMY+KRAFVHWYVGEGM
Sbjct  367  FDLMYAKRAFVHWYVGEGM  385



>sp|Q38771.1|TBA_AVESA RecName: Full=Tubulin alpha chain [Avena sativa]
 emb|CAA66075.1| alpha-tubulin [Avena sativa]
Length=447

 Score =   387 bits (995),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVD CPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VVTIKTKRTVQFVDXCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CAD26888.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=450

 Score =   387 bits (995),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTS+RFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSMRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCL+YRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLIYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDW PTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWRPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_003554022.1| PREDICTED: tubulin alpha-6 chain-like [Glycine max]
 gb|KHN34688.1| Tubulin alpha-3 chain [Glycine soja]
Length=451

 Score =   387 bits (995),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+ IK KRTVQFVDWCPTGFKCGINYQPPTVVP GDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VSNIKAKRTVQFVDWCPTGFKCGINYQPPTVVPAGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D+KFDLMY+KRAFVHWYVGEGM
Sbjct  392  DYKFDLMYAKRAFVHWYVGEGM  413



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   380 bits (977),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICR+SLD+ERPTYTNLNRLISQ+ISSLT SLRFDGA+NVD+ EFQTNLVPYPRIHFMLSS
Sbjct  32   ICRKSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSS  91

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT+  FEPSSMM KCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  92   YAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAA  151

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  152  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  211

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  212  DHKFDLMYAKRAFVHWYVGEGM  233



>ref|XP_003624633.1| Alpha-tubulin [Medicago truncatula]
 gb|ABK28851.1| alpha-tubulin [Medicago truncatula]
 gb|ABN08980.1| Tubulin/FtsZ, C-terminal [Medicago truncatula]
 gb|AES80851.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   387 bits (994),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 200/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICR+SLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRKSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVIS+AKAYHEQ+SVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISSAKAYHEQISVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V+ IKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNNTAVAEVFSRI
Sbjct  332  VSNIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABE01246.1| alpha tubulin [Camellia sinensis]
Length=449

 Score =   387 bits (994),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            IC+RSLD+ERPTYTNLNRLISQ+ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICKRSLDIERPTYTNLNRLISQVISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPK VNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKGVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNT VAEVFSRI
Sbjct  332  VGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTLVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   380 bits (975),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+ EFQTNLVPYPRIHFMLSS
Sbjct  17   ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSS  76

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  77   YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  136

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVFSRI
Sbjct  137  VATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRI  196

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  197  DHKFDLMYAKRAFVHWYVGEGM  218



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   385 bits (990),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  177  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  236

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  237  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  296

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  297  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  356

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  357  DHKFDLMYAKRAFVHWYVGEGM  378



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   380 bits (976),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLI+Q+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  32   ICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  91

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMA CLMYRGDVVPKDVNAA
Sbjct  92   YAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAA  151

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN +A+AEVFSRI
Sbjct  152  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRI  211

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  212  DHKFDLMYAKRAFVHWYVGEGM  233



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   379 bits (974),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLI+Q+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  16   ICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  75

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAP+ISA KAYHEQLSV EIT+A FEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  76   YAPIISAEKAYHEQLSVAEITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVVPKDVNAA  135

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+ E+FSR+
Sbjct  136  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIGEIFSRL  195

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  196  DHKFDLMYAKRAFVHWYVGEGM  217



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   379 bits (973),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+ EFQTNLVPYPRIHFMLSS
Sbjct  4    ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSS  63

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  64   YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  123

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+V EVFSRI
Sbjct  124  VATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRI  183

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  184  DHKFDLMYAKRAFVHWYVGEGM  205



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   379 bits (973),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLI Q+ISSLT SLRFDGA+NVDMTEFQTNLVPYPRIHFMLSS
Sbjct  11   ICRRSLDIERPTYTNLNRLIGQVISSLTASLRFDGALNVDMTEFQTNLVPYPRIHFMLSS  70

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVNAA
Sbjct  71   YAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAA  130

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRI
Sbjct  131  VATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRI  190

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  191  DHKFDLMYAKRAFVHWYVGEGM  212



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   382 bits (981),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+ EFQTNLVPYPRIHFMLSS
Sbjct  89   ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSS  148

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMM KCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  149  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAA  208

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  209  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  268

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  269  DHKFDLMYAKRAFVHWYVGEGM  290



>gb|AGZ90158.1| tubulin alpha, partial [Litsea cubeba]
Length=387

 Score =   384 bits (986),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  185  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  244

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  245  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  304

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  305  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  364

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  365  DHKFDLMYAKRAFVHWYVGEGM  386



>gb|AEN19681.1| alpha-tubulin [Cymbidium faberi]
 gb|AEN19683.1| alpha-tubulin [Cymbidium faberi]
 gb|AEN19684.1| alpha-tubulin [Cymbidium faberi]
Length=401

 Score =   384 bits (987),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  200  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  259

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  260  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  319

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  320  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  379

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  380  DHKFDLMYSKRAFVHWYVGEGM  401



>emb|CAD26892.1| alpha-tubulin [Miscanthus floridulus]
Length=450

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNL+RLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLSRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVI A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKD NAA
Sbjct  272  YAPVICAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDDNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRTVQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_009131752.1| PREDICTED: tubulin alpha-3 chain-like [Brassica rapa]
Length=450

 Score =   385 bits (990),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/202 (95%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V   + KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VGLSRLKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   378 bits (970),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSL +ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  10   ICRRSLSIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  69

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KA+HEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  70   YAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  129

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  130  VGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  189

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  190  DHKFDLMYAKRAFVHWYVGEGM  211



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSV EIT+  FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_011078787.1| PREDICTED: tubulin alpha-1 chain-like [Sesamum indicum]
Length=451

 Score =   385 bits (989),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 191/202 (95%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTY NLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYANLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDV PKDVN A
Sbjct  272  YAPVISAAKAYHEQLSVPEITTAVFEPSSMMAKCDPRHGKYMACCLMYRGDVAPKDVNTA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKR VQFVDWCPTGFKCGINYQPPTVVPGGDLA+V+RAVCMISNNTAVAEVFSRI
Sbjct  332  VATIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLARVKRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFD+MY+KRAFVHWYVGEGM
Sbjct  392  DHKFDVMYAKRAFVHWYVGEGM  413



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   384 bits (987),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  184  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  243

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  244  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  303

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  304  VATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  363

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  364  DHKFDLMYAKRAFVHWYVGEGM  385



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   384 bits (987),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  193  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  252

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  253  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  312

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  313  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  372

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  373  DHKFDLMYAKRAFVHWYVGEGM  394



>ref|XP_002886753.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63012.1| alpha-1 tubulin [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   385 bits (989),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/202 (94%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQTISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVIS+AKAYHEQ SV EIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN A
Sbjct  272  YAPVISSAKAYHEQFSVSEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNTA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VA IKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VAAIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   385 bits (988),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   385 bits (988),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   385 bits (988),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   385 bits (988),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   385 bits (988),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   385 bits (988),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   385 bits (988),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   384 bits (987),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  197  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  256

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  257  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  316

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  317  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  376

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  377  DHKFDLMYAKRAFVHWYVGEGM  398



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   385 bits (988),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   385 bits (988),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   384 bits (985),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLI+Q+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  177  ICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  236

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  237  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  296

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VA+IKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSR+
Sbjct  297  VASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRL  356

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  357  DHKFDLMYAKRAFVHWYVGEGM  378



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   385 bits (988),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AAO46126.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   377 bits (968),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLI Q+ISSLT SLRFDGA+NVDMTEFQTNLVPYPRIHFMLSS
Sbjct  11   ICRRSLDIERPTYTNLNRLIGQVISSLTASLRFDGALNVDMTEFQTNLVPYPRIHFMLSS  70

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVNAA
Sbjct  71   YAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAA  130

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            V TIKTKRT+QFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRI
Sbjct  131  VTTIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRI  190

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  191  DHKFDLMYAKRAFVHWYVGEGM  212



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   385 bits (988),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABO61400.1| alpha tubulin, partial [Rhodomonas salina]
Length=282

 Score =   378 bits (971),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRR+LD+ERPTYTNLNRLI+Q ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFML+S
Sbjct  81   ICRRNLDIERPTYTNLNRLIAQCISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLTS  140

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAP+ISA KAYHEQLSV EIT+A FEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  141  YAPIISAEKAYHEQLSVAEITNATFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVNAA  200

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCM+SN+TAVAEVFSR+
Sbjct  201  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMVSNSTAVAEVFSRL  260

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  261  DHKFDLMYAKRAFVHWYVGEGM  282



>gb|EYU20672.1| hypothetical protein MIMGU_mgv1a004180mg [Erythranthe guttata]
Length=540

 Score =   387 bits (995),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/202 (96%), Positives = 201/202 (99%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQIISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  303  ICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  362

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKA+HEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  363  YAPVISAAKAFHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  422

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNNTAV EVFSRI
Sbjct  423  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTAVVEVFSRI  482

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            +HKFDLMY+KRAFVHWYVGEGM
Sbjct  483  NHKFDLMYAKRAFVHWYVGEGM  504



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLISQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLISQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   379 bits (973),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLI+Q+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  60   ICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSS  119

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVNAA
Sbjct  120  YAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAA  179

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRI
Sbjct  180  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRI  239

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D KFDLMY+KRAFVHWYVGEGM
Sbjct  240  DRKFDLMYAKRAFVHWYVGEGM  261



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   382 bits (982),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLI+Q+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  156  ICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDITEFQTNLVPYPRIHFMLSS  215

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  216  YAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  275

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VAT+KTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSR+
Sbjct  276  VATVKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRL  335

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  336  DHKFDLMYAKRAFVHWYVGEGM  357



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|NP_176654.1| tubulin alpha-1 chain [Arabidopsis thaliana]
 sp|P11139.1|TBA1_ARATH RecName: Full=Tubulin alpha-1 chain [Arabidopsis thaliana]
 gb|AAD38249.1|AC006193_5 alpha1 tubulin [Arabidopsis thaliana]
 gb|AAA32880.1| alpha-1-tubulin [Arabidopsis thaliana]
 gb|AAL24085.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AAM14311.1| putative alpha-tubulin protein [Arabidopsis thaliana]
 gb|AEE34279.1| tubulin alpha-1 chain [Arabidopsis thaliana]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/202 (93%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTY+NLNRLISQ ISSLTTSLRFDGAINVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYSNLNRLISQTISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVIS+AKAYHEQ SVPEIT++VFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVN A
Sbjct  272  YAPVISSAKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNTA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VA IK KRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRI
Sbjct  332  VAAIKAKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMYSKRAFVHWYVGEGM
Sbjct  392  DHKFDLMYSKRAFVHWYVGEGM  413



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   379 bits (973),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/202 (91%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD++RPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  68   ICRRSLDIDRPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  127

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  128  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  187

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA+CMISN+T+VAEVFSRI
Sbjct  188  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAICMISNSTSVAEVFSRI  247

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D KFDLMY KRAFVHWYVGEGM
Sbjct  248  DFKFDLMYCKRAFVHWYVGEGM  269



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYTKRAFVHWYVGEGM  413



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   384 bits (986),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  217  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  276

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  277  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  336

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  337  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  396

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  397  DHKFDLMYAKRAFVHWYVGEGM  418



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISAAKAYHEQLSV EIT+  FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAAKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV E+T++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   384 bits (987),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  228  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  287

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  288  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  347

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  348  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  407

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  408  DHKFDLMYAKRAFVHWYVGEGM  429



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV E+T++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|AAO46128.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   377 bits (967),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 183/202 (91%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLI Q+ISSLT SLRFDGA+NVDMTEFQTNLVPYPRIHFMLSS
Sbjct  11   ICRRSLDIERPTYTNLNRLIGQVISSLTASLRFDGALNVDMTEFQTNLVPYPRIHFMLSS  70

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVNAA
Sbjct  71   YAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAA  130

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRI
Sbjct  131  VATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRI  190

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFD MY+KRAFVHWYVGEGM
Sbjct  191  DHKFDSMYAKRAFVHWYVGEGM  212



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_002324047.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
 gb|EEF04180.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
Length=454

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/202 (92%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  215  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  274

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV E+T++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  275  YAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  334

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  335  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  394

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  395  DHKFDLMYAKRAFVHWYVGEGM  416



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   384 bits (986),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 198/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRL+SQ+ISSLT SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  212  ICRRSLDIERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSS  271

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA
Sbjct  272  YAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  331

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRI
Sbjct  332  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRI  391

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            DHKFDLMY+KRAFVHWYVGEGM
Sbjct  392  DHKFDLMYAKRAFVHWYVGEGM  413



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   379 bits (973),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/202 (90%), Positives = 197/202 (98%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    ICRRSLDVERPTYTNLNRlisqiisslttslRFDGAINVDMTEFQTNLVPYPRIHFMLSS  181
            ICRRSLD+ERPTYTNLNRLI+Q+ISS+T SLRFDGA+NVD+TEFQTNLVPYPRIHFMLSS
Sbjct  75   ICRRSLDIERPTYTNLNRLIAQVISSMTASLRFDGALNVDITEFQTNLVPYPRIHFMLSS  134

Query  182  YAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAA  361
            YAPVISA KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVNAA
Sbjct  135  YAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAA  194

Query  362  VATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  541
            VATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRI
Sbjct  195  VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRI  254

Query  542  DHKFDLMYSKRAFVHWYVGEGM  607
            D KFDLMY+KRAFVHWYVGEGM
Sbjct  255  DRKFDLMYAKRAFVHWYVGEGM  276



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800