BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN034J22

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611002.1|  PREDICTED: uncharacterized N-acetyltransfera...    282   2e-93   Nicotiana tomentosiformis
ref|XP_004238988.1|  PREDICTED: uncharacterized N-acetyltransfera...    276   5e-91   Solanum lycopersicum
ref|XP_009774327.1|  PREDICTED: uncharacterized N-acetyltransfera...    274   3e-90   Nicotiana sylvestris
ref|XP_006348605.1|  PREDICTED: uncharacterized N-acetyltransfera...    270   1e-88   Solanum tuberosum [potatoes]
ref|XP_011077765.1|  PREDICTED: uncharacterized N-acetyltransfera...    268   7e-88   Sesamum indicum [beniseed]
gb|KJB80537.1|  hypothetical protein B456_013G103300                    265   1e-86   Gossypium raimondii
ref|XP_010257855.1|  PREDICTED: uncharacterized N-acetyltransfera...    263   7e-86   Nelumbo nucifera [Indian lotus]
ref|XP_007045686.1|  Acyl-CoA N-acyltransferases superfamily protein    262   3e-85   
ref|XP_002514546.1|  N-acetyltransferase, putative                      261   6e-85   Ricinus communis
ref|XP_002312367.2|  hypothetical protein POPTR_0008s11270g             259   3e-84   Populus trichocarpa [western balsam poplar]
ref|XP_011021280.1|  PREDICTED: uncharacterized N-acetyltransfera...    259   3e-84   Populus euphratica
emb|CDP00509.1|  unnamed protein product                                259   3e-84   Coffea canephora [robusta coffee]
gb|EYU28918.1|  hypothetical protein MIMGU_mgv1a021888mg                257   9e-84   Erythranthe guttata [common monkey flower]
ref|XP_008389353.1|  PREDICTED: uncharacterized N-acetyltransfera...    256   3e-83   
ref|XP_008243760.1|  PREDICTED: uncharacterized N-acetyltransfera...    256   6e-83   Prunus mume [ume]
ref|XP_007225898.1|  hypothetical protein PRUPE_ppa011870mg             255   7e-83   Prunus persica
ref|XP_004135133.1|  PREDICTED: uncharacterized N-acetyltransfera...    255   1e-82   Cucumis sativus [cucumbers]
emb|CAN70315.1|  hypothetical protein VITISV_037700                     254   2e-82   Vitis vinifera
ref|XP_002271276.1|  PREDICTED: uncharacterized N-acetyltransfera...    253   3e-82   Vitis vinifera
ref|XP_008446500.1|  PREDICTED: uncharacterized N-acetyltransfera...    253   9e-82   Cucumis melo [Oriental melon]
ref|XP_010499070.1|  PREDICTED: uncharacterized N-acetyltransfera...    252   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_004298329.1|  PREDICTED: uncharacterized N-acetyltransfera...    251   2e-81   Fragaria vesca subsp. vesca
ref|XP_010551340.1|  PREDICTED: uncharacterized N-acetyltransfera...    251   4e-81   Tarenaya hassleriana [spider flower]
ref|NP_173946.1|  GCN5-like N-acetyltransferase                         251   5e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010091676.1|  putative N-acetyltransferase ycf52                 250   8e-81   Morus notabilis
ref|XP_010460334.1|  PREDICTED: uncharacterized N-acetyltransfera...    250   8e-81   Camelina sativa [gold-of-pleasure]
ref|XP_002893411.1|  hypothetical protein ARALYDRAFT_472794             249   1e-80   
gb|KDP31430.1|  hypothetical protein JCGZ_11806                         250   2e-80   Jatropha curcas
ref|XP_010681307.1|  PREDICTED: uncharacterized N-acetyltransfera...    249   2e-80   
ref|XP_006415906.1|  hypothetical protein EUTSA_v10008844mg             249   2e-80   Eutrema salsugineum [saltwater cress]
emb|CDY24382.1|  BnaCnng04490D                                          249   3e-80   Brassica napus [oilseed rape]
ref|XP_010460333.1|  PREDICTED: uncharacterized N-acetyltransfera...    249   3e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006304788.1|  hypothetical protein CARUB_v10012337mg             249   4e-80   Capsella rubella
ref|XP_006437813.1|  hypothetical protein CICLE_v10032841mg             248   4e-80   Citrus clementina [clementine]
ref|XP_010046607.1|  PREDICTED: uncharacterized N-acetyltransfera...    248   1e-79   Eucalyptus grandis [rose gum]
emb|CDY36081.1|  BnaA08g19670D                                          247   1e-79   Brassica napus [oilseed rape]
ref|XP_009109911.1|  PREDICTED: uncharacterized N-acetyltransfera...    247   1e-79   Brassica rapa
ref|XP_006484294.1|  PREDICTED: probable acetyltransferase NSI-like     248   2e-79   Citrus sinensis [apfelsine]
ref|XP_003518810.1|  PREDICTED: uncharacterized N-acetyltransfera...    246   3e-79   Glycine max [soybeans]
gb|EPS64722.1|  hypothetical protein M569_10056                         244   7e-79   Genlisea aurea
ref|XP_004490320.1|  PREDICTED: uncharacterized N-acetyltransfera...    245   8e-79   Cicer arietinum [garbanzo]
gb|KFK44561.1|  hypothetical protein AALP_AA1G273100                    241   2e-77   Arabis alpina [alpine rockcress]
ref|XP_007146372.1|  hypothetical protein PHAVU_006G035000g             239   1e-76   Phaseolus vulgaris [French bean]
ref|XP_009356485.1|  PREDICTED: uncharacterized N-acetyltransfera...    239   3e-76   Pyrus x bretschneideri [bai li]
ref|XP_007146370.1|  hypothetical protein PHAVU_006G034800g             239   3e-76   Phaseolus vulgaris [French bean]
gb|KDO70204.1|  hypothetical protein CISIN_1g048638mg                   233   8e-75   Citrus sinensis [apfelsine]
ref|XP_003589066.1|  N-acetyltransferase, putative                      225   7e-71   
ref|XP_006843307.1|  hypothetical protein AMTR_s00080p00183240          215   1e-66   Amborella trichopoda
ref|XP_008783054.1|  PREDICTED: uncharacterized N-acetyltransfera...    214   2e-66   Phoenix dactylifera
gb|ABK22519.1|  unknown                                                 215   2e-66   Picea sitchensis
ref|XP_010929077.1|  PREDICTED: uncharacterized N-acetyltransfera...    212   8e-66   
ref|XP_002993253.1|  hypothetical protein SELMODRAFT_449074             207   7e-64   
ref|XP_010667852.1|  PREDICTED: uncharacterized protein LOC104884847    204   1e-61   
ref|XP_001759132.1|  predicted protein                                  199   5e-61   
dbj|BAJ84880.1|  predicted protein                                      192   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85874.1|  predicted protein                                      192   4e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT03851.1|  Putative N-acetyltransferase ycf52                      192   7e-58   
ref|NP_001060765.1|  Os08g0102000                                       190   3e-57   
ref|XP_006659730.1|  PREDICTED: uncharacterized N-acetyltransfera...    190   4e-57   
ref|XP_003571288.1|  PREDICTED: uncharacterized N-acetyltransfera...    187   6e-56   Brachypodium distachyon [annual false brome]
ref|XP_009385425.1|  PREDICTED: uncharacterized N-acetyltransfera...    183   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004974291.1|  PREDICTED: uncharacterized N-acetyltransfera...    181   3e-53   
ref|NP_001143948.1|  uncharacterized protein LOC100276761               179   4e-53   
ref|XP_002444853.1|  hypothetical protein SORBIDRAFT_07g000310          178   5e-52   
ref|XP_002953791.1|  hypothetical protein VOLCADRAFT_64094              142   4e-39   Volvox carteri f. nagariensis
ref|XP_010497903.1|  PREDICTED: uncharacterized N-acetyltransfera...    138   2e-38   
ref|XP_010497917.1|  PREDICTED: uncharacterized N-acetyltransfera...    134   1e-36   
ref|XP_001700344.1|  histone acetyltransferase                          134   4e-36   Chlamydomonas reinhardtii
gb|KIZ00482.1|  putative acetyltransferase NSI                          135   7e-36   Monoraphidium neglectum
ref|XP_011397697.1|  putative acetyltransferase NSI                     134   8e-35   Auxenochlorella protothecoides
ref|YP_008144758.1|  N-acetyltransferase Ycf52                          129   8e-34   Grateloupia taiwanensis
ref|YP_007627293.1|  GCN5-like N-acetyltransferase                      129   8e-34   Chondrus crispus [carageen]
ref|XP_005849365.1|  hypothetical protein CHLNCDRAFT_143824             128   5e-33   Chlorella variabilis
ref|WP_023074761.1|  gcn5-related n-acetyltransferase                   127   6e-33   Leptolyngbya sp. Heron Island J
ref|WP_006517988.1|  acetyltransferase                                  125   2e-32   Leptolyngbya sp. PCC 7375
ref|WP_017320634.1|  N-acetyltransferase                                125   2e-32   cyanobacterium PCC 7702
ref|XP_003059249.1|  predicted protein                                  125   3e-32   Micromonas pusilla CCMP1545
ref|WP_016862307.1|  N-acetyltransferase                                125   3e-32   Fischerella muscicola
ref|WP_009459074.1|  MULTISPECIES: N-acetyltransferase                  125   3e-32   Fischerella thermalis
ref|WP_016867314.1|  N-acetyltransferase                                125   3e-32   Fischerella muscicola
ref|WP_015156799.1|  MULTISPECIES: N-acetyltransferase GCN5             124   4e-32   Cyanobacteria [blue-green bacteria]
ref|WP_026733123.1|  acetyltransferase                                  124   5e-32   Fischerella sp. PCC 9605
ref|WP_015195576.1|  GCN5-related N-acetyltransferase                   124   6e-32   Stanieria cyanosphaera
ref|WP_015188955.1|  GCN5-related N-acetyltransferase                   124   6e-32   Gloeocapsa sp. PCC 7428
ref|WP_006194872.1|  N-acetyltransferase                                124   8e-32   Nodularia spumigena
ref|WP_015127207.1|  N-acetyltransferase GCN5                           124   8e-32   Calothrix sp. PCC 7507
ref|WP_016879103.1|  N-acetyltransferase                                124   9e-32   Chlorogloeopsis fritschii
ref|WP_019508370.1|  hypothetical protein                               124   9e-32   Pleurocapsa sp. PCC 7319
gb|AFY65651.1|  GCN5-related N-acetyltransferase                        123   1e-31   Geitlerinema sp. PCC 7407
ref|NP_053802.1|  hypothetical protein PopuCp007                        124   1e-31   Porphyra purpurea
ref|WP_041041052.1|  acetyltransferase                                  123   1e-31   Tolypothrix campylonemoides
ref|WP_035159425.1|  acetyltransferase                                  123   1e-31   Calothrix sp. 336/3
ref|WP_017746697.1|  N-acetyltransferase                                123   1e-31   Scytonema hofmannii
ref|WP_041268286.1|  acetyltransferase                                  123   2e-31   Geitlerinema sp. PCC 7407
gb|KIJ80973.1|  acetyltransferase                                       123   2e-31   Scytonema tolypothrichoides VB-61278
ref|WP_007356742.1|  MULTISPECIES: N-acetyltransferase                  123   2e-31   Kamptonema
ref|WP_013322903.1|  N-acetyltransferase                                123   2e-31   Cyanothece sp. PCC 7822
ref|WP_012410213.1|  N-acetyltransferase                                123   2e-31   Nostoc punctiforme
ref|WP_017319274.1|  N-acetyltransferase                                123   2e-31   Mastigocladopsis repens
ref|WP_029634143.1|  acetyltransferase [                                123   2e-31   [Scytonema hofmanni] UTEX B 1581
ref|WP_006103871.1|  N-acetyltransferase                                123   2e-31   Coleofasciculus chthonoplastes
ref|WP_017310093.1|  MULTISPECIES: N-acetyltransferase                  123   2e-31   Hapalosiphonaceae
ref|WP_015210158.1|  acetyltransferase                                  123   2e-31   Cylindrospermum stagnale
ref|WP_015180317.1|  acetyltransferase                                  122   2e-31   Microcoleus sp. PCC 7113
ref|WP_017287556.1|  N-acetyltransferase                                122   3e-31   Leptolyngbya boryana
ref|WP_023175216.1|  ribosomal-protein-alanine N-acetyltransferase      122   3e-31   Gloeobacter kilaueensis
ref|WP_039748238.1|  acetyltransferase                                  123   3e-31   
ref|WP_010994290.1|  MULTISPECIES: N-acetyltransferase                  123   3e-31   Nostocaceae
ref|WP_015137735.1|  acetyltransferase                                  123   3e-31   Nostoc sp. PCC 7524
ref|WP_012598838.1|  N-acetyltransferase                                122   3e-31   Cyanothece sp. PCC 7424
ref|WP_013193107.1|  N-acetyltransferase                                122   4e-31   Trichormus azollae
ref|WP_027846182.1|  acetyltransferase                                  122   4e-31   
ref|WP_011142347.1|  N-acetyltransferase                                121   4e-31   Gloeobacter violaceus
gb|ACA99587.1|  acetyltransferase, GNAT family                          122   5e-31   Synechococcus sp. PCC 7002
ref|WP_017654960.1|  N-acetyltransferase                                122   5e-31   Fortiea contorta
ref|WP_012629487.1|  N-acetyltransferase                                122   5e-31   Cyanothece sp. PCC 7425
ref|WP_030007011.1|  MULTISPECIES: acetyltransferase                    122   5e-31   Synechococcus
ref|WP_036003362.1|  acetyltransferase                                  122   5e-31   [Leptolyngbya] sp. JSC-1
ref|WP_044105639.1|  acetyltransferase                                  122   5e-31   cyanobacterium endosymbiont of Epithemia turgida
ref|WP_011611289.1|  N-acetyltransferase                                122   6e-31   Trichodesmium erythraeum
ref|WP_039755814.1|  MULTISPECIES: acetyltransferase                    122   6e-31   Synechococcus
ref|WP_026720324.1|  acetyltransferase                                  122   6e-31   Fischerella sp. PCC 9431
ref|WP_010467952.1|  N-acetyltransferase                                122   8e-31   Acaryochloris sp. CCMEE 5410
ref|WP_012162317.1|  N-acetyltransferase                                121   8e-31   Acaryochloris marina
ref|WP_016949886.1|  N-acetyltransferase                                121   8e-31   Anabaena sp. PCC 7108
ref|WP_008181937.1|  N-acetyltransferase                                121   8e-31   Moorea producens
gb|KIE13246.1|  acetyltransferase                                       121   9e-31   Tolypothrix bouteillei VB521301
ref|WP_036533010.1|  acetyltransferase                                  121   9e-31   Neosynechococcus sphagnicola
ref|WP_028954121.1|  hypothetical protein                               121   9e-31   Synechocystis sp. PCC 7509
gb|ABB56805.1|  conserved hypothetical protein YCF52                    122   1e-30   Synechococcus elongatus PCC 7942
ref|WP_019499145.1|  hypothetical protein                               121   1e-30   Pseudanabaena sp. PCC 6802
ref|WP_019492439.1|  N-acetyltransferase                                121   1e-30   Calothrix sp. PCC 7103
ref|WP_015112398.1|  N-acetyltransferase GCN5                           121   1e-30   Nostoc sp. PCC 7107
ref|WP_009767781.1|  putative acetyltransferase                         120   1e-30   Oscillatoriales cyanobacterium JSC-12
ref|WP_036479271.1|  acetyltransferase                                  120   1e-30   Myxosarcina sp. GI1
ref|WP_015212802.1|  GCN5-related N-acetyltransferase                   120   2e-30   Anabaena cylindrica
ref|WP_027402293.1|  acetyltransferase                                  120   2e-30   Aphanizomenon flos-aquae
ref|WP_015079096.1|  acyl-CoA N-acyltransferase                         120   2e-30   Anabaena sp. 90
ref|WP_006631880.1|  N-acetyltransferase                                120   2e-30   Microcoleus vaginatus
ref|WP_039203157.1|  acetyltransferase                                  120   2e-30   Nostocales
ref|WP_015200285.1|  N-acetyltransferase GCN5                           120   2e-30   Calothrix parietina
ref|WP_039724734.1|  MULTISPECIES: acetyltransferase                    120   2e-30   Lyngbya confervoides
ref|WP_015117737.1|  acetyltransferase                                  120   2e-30   Rivularia sp. PCC 7116
ref|WP_006616008.1|  N-acetyltransferase                                120   2e-30   
gb|EAW35113.1|  GCN5-related N-acetyltransferase                        120   2e-30   Lyngbya sp. PCC 8106
ref|WP_017299606.1|  N-acetyltransferase                                120   3e-30   Nodosilinea nodulosa
ref|WP_040930240.1|  acetyltransferase                                  120   3e-30   
ref|WP_006623763.1|  MULTISPECIES: N-acetyltransferase                  120   4e-30   Arthrospira
gb|AFC39862.1|  hypothetical protein                                    119   4e-30   Porphyra umbilicalis
ref|WP_035986684.1|  acetyltransferase                                  119   4e-30   Leptolyngbya sp. KIOST-1
ref|WP_024545896.1|  acetyltransferase                                  119   5e-30   Synechococcus
ref|WP_017304728.1|  N-acetyltransferase                                119   5e-30   Spirulina subsalsa
ref|WP_039896818.1|  acetyltransferase                                  119   5e-30   Lyngbya sp. PCC 8106
ref|WP_009341982.1|  N-acetyltransferase                                119   5e-30   Aphanizomenonaceae
ref|WP_017662152.1|  hypothetical protein                               119   6e-30   Cyanobacteria [blue-green bacteria]
ref|WP_011432155.1|  N-acetyltransferase                                119   6e-30   Synechococcus sp. JA-2-3B'a(2-13)
ref|YP_063511.1|  conserved hypothetical plastid protein                119   7e-30   Gracilaria tenuistipitata var. liui
ref|WP_006528969.1|  acetyltransferase                                  119   7e-30   Gloeocapsa sp. PCC 73106
ref|WP_023066723.1|  acetyltransferase family protein                   119   8e-30   Lyngbya aestuarii
ref|WP_008233418.1|  N-acetyltransferase (GNAT) family, Syn7942_0...    119   9e-30   Richelia intracellularis
ref|WP_008317769.1|  acetyltransferase                                  118   1e-29   Leptolyngbya sp. PCC 6406
gb|AJH66055.1|  hypothetical protein                                    119   1e-29   Vertebrata lanosa
ref|WP_017713970.1|  hypothetical protein                               119   1e-29   Prochlorothrix hollandica
ref|WP_015126285.1|  acetyltransferase                                  119   1e-29   Synechococcus sp. PCC 6312
ref|WP_026222152.1|  hypothetical protein                               118   1e-29   filamentous cyanobacterium ESFC-1
ref|WP_015176063.1|  GCN5-related N-acetyltransferase                   118   1e-29   Oscillatoria nigro-viridis
ref|WP_006511245.1|  putative acetyltransferase                         118   1e-29   Xenococcus sp. PCC 7305
ref|YP_009019519.1|  hypothetical protein                               118   2e-29   Gracilaria salicornia
ref|WP_017327555.1|  hypothetical protein                               118   2e-29   Synechococcus sp. PCC 7336
ref|YP_007947720.1|  hypothetical protein 174                           117   4e-29   Pyropia haitanensis
ref|WP_011057519.1|  N-acetyltransferase                                117   4e-29   Thermosynechococcus
ref|WP_006454532.1|  N-acetyltransferase                                117   4e-29   Synechococcus sp. PCC 7335
ref|YP_009027476.1|  hypothetical chloroplast protein 174               117   4e-29   Pyropia perforata
ref|YP_536873.1|  hypothetical protein 174                              117   4e-29   Pyropia yezoensis
ref|WP_028083485.1|  acetyltransferase                                  117   4e-29   Dolichospermum circinale
ref|WP_024124731.1|  N-acetyltransferase GNAT family Ycf52              117   5e-29   Thermosynechococcus sp. NK55a
ref|WP_010873901.1|  N-acetyltransferase                                116   5e-29   Synechocystis
ref|WP_009627612.1|  GCN5-related N-acetyltransferase                   116   5e-29   Pseudanabaena
ref|WP_037217166.1|  acetyltransferase                                  116   6e-29   
gb|AIA20595.1|  hypothetical protein                                    116   7e-29   Pyropia perforata
emb|CDN11012.1|  N-acetyltransferase (GNAT) family, Syn7942_0773 ...    116   8e-29   Richelia intracellularis
ref|WP_015227833.1|  N-acetyltransferase GCN5                           116   8e-29   Halothece sp. PCC 7418
ref|WP_017718718.1|  N-acetyltransferase                                116   9e-29   Oscillatoria sp. PCC 10802
gb|KEI68973.1|  N-acetyltransferase ycf52                               116   9e-29   Planktothrix agardhii NIVA-CYA 126/8
ref|WP_011430988.1|  N-acetyltransferase                                116   1e-28   Synechococcus
gb|AIA21222.1|  hypothetical protein                                    115   1e-28   Pyropia kanakaensis
ref|WP_015144247.1|  acetyltransferase                                  115   1e-28   Pleurocapsa minor
ref|WP_042156520.1|  acetyltransferase                                  116   1e-28   Planktothrix agardhii
ref|WP_015134874.1|  N-acetyltransferase GCN5                           115   1e-28   Leptolyngbya sp. PCC 7376
gb|AJO68352.1|  hypothetical protein                                    115   1e-28   Gracilariopsis lemaneiformis
gb|KIZ07104.1|  putative acetyltransferase NSI                          115   1e-28   Monoraphidium neglectum
ref|WP_015167438.1|  acetyltransferase                                  115   2e-28   Synechococcus sp. PCC 7502
ref|WP_006276008.1|  N-acetyltransferase                                115   2e-28   Cylindrospermopsis
ref|WP_026797328.1|  acetyltransferase                                  115   2e-28   Planktothrix
ref|WP_026787559.1|  MULTISPECIES: acetyltransferase                    115   2e-28   Planktothrix
ref|WP_028947784.1|  acetyltransferase                                  115   2e-28   Synechocystis sp. PCC 6714
ref|WP_015147189.1|  acetyltransferase                                  114   4e-28   Oscillatoria acuminata
ref|WP_015223079.1|  N-acetyltransferase GCN5                           114   4e-28   
ref|WP_015203416.1|  N-acetyltransferase GCN5                           114   5e-28   Crinalium epipsammum
gb|AIA21428.1|  hypothetical protein                                    114   7e-28   Pyropia fucicola
ref|WP_012596334.1|  MULTISPECIES: N-acetyltransferase                  113   8e-28   Cyanothece
ref|XP_010529331.1|  PREDICTED: acetyltransferase NSI isoform X1        116   9e-28   Tarenaya hassleriana [spider flower]
ref|WP_015230881.1|  acetyltransferase                                  113   9e-28   Dactylococcopsis salina
ref|XP_002439969.1|  hypothetical protein SORBIDRAFT_09g023610          114   9e-28   
emb|CCQ60940.1|  N-acetyltransferase (GNAT) family, Syn7942_0773 ...    112   9e-28   Crocosphaera watsonii WH 0401
gb|EHJ10581.1|  hypothetical protein CWATWH0003_4692                    112   1e-27   Crocosphaera watsonii WH 0003
ref|WP_009547406.1|  MULTISPECIES: N-acetyltransferase                  113   1e-27   Cyanothece
ref|WP_008274971.1|  N-acetyltransferase                                113   1e-27   Cyanothece sp. CCY0110
ref|XP_002502571.1|  gcn5-related n-acetyltransferase                   115   1e-27   Micromonas commoda
ref|WP_041676949.1|  acetyltransferase                                  113   1e-27   Synechococcus elongatus
ref|XP_005643135.1|  histone acetyltransferase                          112   1e-27   Coccomyxa subellipsoidea C-169
gb|EEC79409.1|  hypothetical protein OsI_20361                          115   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_007140046.1|  hypothetical protein PHAVU_008G079900g             114   2e-27   Phaseolus vulgaris [French bean]
sp|A2Y5T7.2|NSI_ORYSI  RecName: Full=Probable acetyltransferase N...    115   2e-27   
ref|NP_001055858.2|  Os05g0481000                                       115   2e-27   
gb|KDO64174.1|  hypothetical protein CISIN_1g0258303mg                  113   2e-27   Citrus sinensis [apfelsine]
ref|WP_021830270.1|  N-acetyltransferase (GNAT) family, Syn7942_0...    112   2e-27   Crocosphaera watsonii
ref|WP_021833210.1|  N-acetyltransferase (GNAT) family, Syn7942_0...    112   2e-27   Crocosphaera watsonii
gb|EPS67510.1|  hypothetical protein M569_07266                         113   2e-27   Genlisea aurea
ref|XP_006481240.1|  PREDICTED: acetyltransferase NSI-like              114   2e-27   
dbj|BAD78953.1|  hypothetical protein YCF52                             113   3e-27   Synechococcus elongatus PCC 6301
ref|XP_008647422.1|  PREDICTED: uncharacterized protein LOC100194...    114   3e-27   
gb|KJB29848.1|  hypothetical protein B456_005G121100                    114   3e-27   Gossypium raimondii
ref|XP_006654548.1|  PREDICTED: probable acetyltransferase NSI-li...    114   3e-27   
ref|WP_015159597.1|  acetyltransferase                                  112   3e-27   Chamaesiphon minutus
ref|NP_001143827.1|  uncharacterized protein LOC100276606               114   3e-27   
gb|KJB29849.1|  hypothetical protein B456_005G121100                    113   3e-27   Gossypium raimondii
ref|XP_006429638.1|  hypothetical protein CICLE_v10012371mg             114   4e-27   Citrus clementina [clementine]
gb|KJB29846.1|  hypothetical protein B456_005G121100                    113   4e-27   Gossypium raimondii
ref|XP_004492591.1|  PREDICTED: probable acetyltransferase NSI-like     113   5e-27   Cicer arietinum [garbanzo]
gb|KHG25134.1|  putative acetyltransferase NSI                          113   6e-27   Gossypium arboreum [tree cotton]
ref|XP_003551622.2|  PREDICTED: acetyltransferase NSI-like isofor...    112   6e-27   Glycine max [soybeans]
gb|EMT17836.1|  Putative acetyltransferase NSI                          113   8e-27   
ref|XP_006602733.1|  PREDICTED: acetyltransferase NSI-like isofor...    112   8e-27   Glycine max [soybeans]
ref|WP_012953854.1|  N-acetyltransferase                                110   1e-26   Candidatus Atelocyanobacterium thalassa
gb|KHN29481.1|  Acetyltransferase NSI                                   112   1e-26   Glycine soja [wild soybean]
ref|XP_006602732.1|  PREDICTED: acetyltransferase NSI-like isofor...    112   1e-26   Glycine max [soybeans]
gb|KJB29847.1|  hypothetical protein B456_005G121100                    112   1e-26   Gossypium raimondii
ref|WP_015164425.1|  N-acetyltransferase GCN5                           110   2e-26   Pseudanabaena sp. PCC 7367
ref|WP_040054220.1|  acetyltransferase                                  110   2e-26   
ref|YP_007878158.1|  GCN5-like N-acetyltransferase                      110   2e-26   Calliarthron tuberculosum
emb|CBI31163.3|  unnamed protein product                                111   2e-26   Vitis vinifera
ref|XP_002266361.2|  PREDICTED: acetyltransferase NSI isoform X2        111   2e-26   Vitis vinifera
ref|XP_001419783.1|  predicted protein                                  108   3e-26   Ostreococcus lucimarinus CCE9901
ref|XP_004302517.1|  PREDICTED: acetyltransferase NSI                   111   3e-26   Fragaria vesca subsp. vesca
ref|XP_010653125.1|  PREDICTED: acetyltransferase NSI isoform X1        111   3e-26   Vitis vinifera
ref|XP_011001650.1|  PREDICTED: acetyltransferase NSI isoform X3        110   3e-26   Populus euphratica
ref|XP_007033470.1|  Nuclear shuttle interacting isoform 2              111   3e-26   
ref|WP_015218622.1|  N-acetyltransferase GCN5                           109   3e-26   Cyanobacterium aponinum
ref|XP_010529340.1|  PREDICTED: acetyltransferase NSI isoform X2        112   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_004961729.1|  PREDICTED: probable acetyltransferase NSI-li...    111   4e-26   Setaria italica
ref|XP_011001649.1|  PREDICTED: acetyltransferase NSI isoform X2        110   4e-26   Populus euphratica
ref|WP_022607079.1|  putative acetyltransferase                         109   4e-26   Rubidibacter lacunae
ref|XP_008244540.1|  PREDICTED: acetyltransferase NSI-like              111   4e-26   Prunus mume [ume]
ref|XP_011001648.1|  PREDICTED: acetyltransferase NSI isoform X1        110   4e-26   Populus euphratica
ref|XP_003623643.1|  Acetyltransferase NSI                              110   4e-26   Medicago truncatula
ref|XP_002323094.2|  GCN5-related N-acetyltransferase family protein    110   4e-26   
ref|XP_011095175.1|  PREDICTED: acetyltransferase NSI                   110   4e-26   Sesamum indicum [beniseed]
ref|XP_006374057.1|  hypothetical protein POPTR_0016s14680g             110   4e-26   
ref|XP_006388093.1|  hypothetical protein POPTR_0344s00210g             110   4e-26   Populus trichocarpa [western balsam poplar]
ref|XP_006842578.1|  hypothetical protein AMTR_s00077p00156540          110   5e-26   
gb|EMS47305.1|  putative acetyltransferase NSI                          112   5e-26   Triticum urartu
ref|WP_017294698.1|  hypothetical protein                               108   5e-26   Geminocystis herdmanii
ref|XP_008803031.1|  PREDICTED: probable acetyltransferase NSI          107   5e-26   
ref|XP_008245229.1|  PREDICTED: LOW QUALITY PROTEIN: acetyltransf...    109   6e-26   
emb|CDY29931.1|  BnaC05g29050D                                          110   6e-26   Brassica napus [oilseed rape]
ref|XP_010478625.1|  PREDICTED: acetyltransferase NSI-like isofor...    110   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_004161707.1|  PREDICTED: acetyltransferase NSI-like              110   7e-26   
ref|XP_008463286.1|  PREDICTED: acetyltransferase NSI                   110   7e-26   Cucumis melo [Oriental melon]
ref|XP_010683439.1|  PREDICTED: acetyltransferase NSI isoform X2        110   7e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002531805.1|  N-acetyltransferase, putative                      110   7e-26   
ref|XP_009614145.1|  PREDICTED: probable acetyltransferase NSI          110   8e-26   Nicotiana tomentosiformis
ref|XP_010478624.1|  PREDICTED: acetyltransferase NSI-like isofor...    110   8e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009780441.1|  PREDICTED: acetyltransferase NSI                   110   8e-26   Nicotiana sylvestris
ref|XP_011400112.1|  Acetyltransferase NSI                              109   9e-26   Auxenochlorella protothecoides
ref|XP_010683438.1|  PREDICTED: acetyltransferase NSI isoform X1        110   9e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010244575.1|  PREDICTED: probable acetyltransferase NSI is...    110   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_010529349.1|  PREDICTED: acetyltransferase NSI isoform X3        110   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_003568235.1|  PREDICTED: probable acetyltransferase NSI          110   1e-25   
dbj|GAL93960.1|  N-acetyltransferase (GNAT) family, Syn7942_0773 ...    107   1e-25   
ref|XP_010461026.1|  PREDICTED: acetyltransferase NSI-like              110   1e-25   
ref|NP_001077641.1|  acetyltransferase NSI                              110   1e-25   
ref|XP_002505808.1|  predicted protein                                  108   1e-25   
emb|CDP06373.1|  unnamed protein product                                110   1e-25   
ref|XP_002893697.1|  hypothetical protein ARALYDRAFT_473390             109   1e-25   
ref|YP_008965755.1|  conserved hypothetical plastid protein             107   2e-25   
gb|KFK44966.1|  hypothetical protein AALP_AA1G326700                    109   2e-25   
ref|WP_002783886.1|  Uncharacterized N-acetyltransferase ycf52-like     107   2e-25   
gb|KGN54466.1|  hypothetical protein Csa_4G336250                       110   2e-25   
ref|XP_006362337.1|  PREDICTED: probable acetyltransferase NSI-like     109   2e-25   
ref|XP_010922794.1|  PREDICTED: probable acetyltransferase NSI is...    109   2e-25   
ref|WP_002736326.1|  N-acetyltransferase                                107   2e-25   
ref|XP_004249035.1|  PREDICTED: probable acetyltransferase NSI          109   2e-25   
ref|XP_006415258.1|  hypothetical protein EUTSA_v10008400mg             109   2e-25   
ref|XP_010499752.1|  PREDICTED: acetyltransferase NSI isoform X2        109   2e-25   
ref|WP_026786048.1|  hypothetical protein                               107   2e-25   
ref|XP_007206480.1|  hypothetical protein PRUPE_ppa018753mg             107   2e-25   
ref|XP_006305591.1|  hypothetical protein CARUB_v10010255mg             108   2e-25   
ref|WP_043937358.1|  hypothetical protein                               107   2e-25   
ref|XP_008388388.1|  PREDICTED: LOW QUALITY PROTEIN: acetyltransf...    108   2e-25   
ref|WP_042157748.1|  hypothetical protein                               107   3e-25   
ref|XP_009337806.1|  PREDICTED: acetyltransferase NSI-like              108   3e-25   
ref|WP_036843577.1|  acetyltransferase                                  105   3e-25   
ref|XP_007205871.1|  hypothetical protein PRUPE_ppa011215mg             108   3e-25   
gb|EYU42053.1|  hypothetical protein MIMGU_mgv1a012601mg                108   3e-25   
gb|KDP21844.1|  hypothetical protein JCGZ_00631                         108   4e-25   
ref|XP_002983198.1|  hypothetical protein SELMODRAFT_271611             108   4e-25   
ref|XP_009402204.1|  PREDICTED: probable acetyltransferase NSI is...    108   4e-25   
gb|EYU42052.1|  hypothetical protein MIMGU_mgv1a012601mg                108   5e-25   
ref|WP_008198782.1|  N-acetyltransferase                                106   5e-25   
gb|ADE77680.1|  unknown                                                 105   5e-25   
emb|CEG01952.1|  Acyl-CoA N-acyltransferase                             107   7e-25   
ref|XP_010036020.1|  PREDICTED: acetyltransferase NSI                   107   8e-25   
ref|WP_026794780.1|  MULTISPECIES: hypothetical protein                 105   1e-24   
gb|AAG50796.1|AC074309_13  unknown protein                              106   1e-24   
ref|WP_043939135.1|  hypothetical protein                               105   1e-24   
ref|NP_564387.1|  acetyltransferase NSI                                 107   1e-24   
ref|NP_973950.1|  acetyltransferase NSI                                 107   1e-24   
ref|XP_009145214.1|  PREDICTED: acetyltransferase NSI isoform X2        107   2e-24   
ref|XP_002956032.1|  hypothetical protein VOLCADRAFT_107031             106   2e-24   
gb|KEI68271.1|  Acetyltransferase                                       108   2e-24   
ref|XP_009402202.1|  PREDICTED: probable acetyltransferase NSI is...    106   2e-24   
ref|XP_010499751.1|  PREDICTED: acetyltransferase NSI isoform X1        106   3e-24   
ref|XP_001422459.1|  predicted protein                                  103   3e-24   
ref|WP_044258419.1|  acetyltransferase                                  102   4e-24   
emb|CDY35539.1|  BnaA05g16470D                                          105   4e-24   
ref|XP_007033469.1|  Nuclear shuttle interacting isoform 1              105   5e-24   
ref|XP_009145212.1|  PREDICTED: acetyltransferase NSI isoform X1        105   5e-24   
ref|XP_003063850.1|  predicted protein                                  103   8e-24   
gb|AFW78398.1|  hypothetical protein ZEAMMB73_013052                    106   1e-23   
ref|XP_008363943.1|  PREDICTED: LOW QUALITY PROTEIN: acetyltransf...    103   2e-23   
ref|WP_035371753.1|  acetyltransferase                                99.8    3e-23   
emb|CEF99072.1|  Acyl-CoA N-acyltransferase                             102   4e-23   
ref|XP_010098596.1|  putative LRR receptor-like serine/threonine-...    107   5e-23   
ref|XP_007033471.1|  Nuclear shuttle interacting isoform 3              102   6e-23   
ref|WP_011819940.1|  acetyltransferase                                  100   1e-22   
ref|WP_035832553.1|  acetyltransferase                                99.4    2e-22   
gb|KCW47543.1|  hypothetical protein EUGRSUZ_K01296                     100   2e-22   
ref|WP_032517745.1|  acetyltransferase                                99.4    2e-22   
ref|WP_011825487.1|  acetyltransferase                                99.0    3e-22   
ref|XP_007512261.1|  GCN5-related N-acetyltransferase                 99.4    3e-22   
ref|WP_011130562.1|  acetyltransferase                                98.6    3e-22   
ref|XP_001782491.1|  predicted protein                                99.8    4e-22   
ref|WP_025931565.1|  MULTISPECIES: acetyltransferase                  98.6    5e-22   
ref|WP_011818066.1|  acetyltransferase                                98.2    6e-22   
gb|EAR20116.1|  possible acetyltransferase                            98.6    6e-22   
ref|WP_038005557.1|  acetyltransferase                                97.8    7e-22   
ref|WP_026102667.1|  hypothetical protein                             97.8    7e-22   
ref|WP_012007380.1|  acetyltransferase                                97.8    9e-22   
ref|WP_019477744.1|  acetyltransferase                                97.4    9e-22   
ref|WP_011862578.1|  acetyltransferase                                97.8    9e-22   
gb|EAU73329.1|  possible acetyltransferase                            97.1    1e-21   
ref|WP_019474721.1|  acetyltransferase                                97.4    1e-21   
ref|WP_025929984.1|  acetyltransferase                                97.4    1e-21   
ref|WP_042850009.1|  acetyltransferase                                97.1    1e-21   
ref|WP_038023042.1|  acetyltransferase                                97.1    2e-21   
ref|WP_011124717.1|  MULTISPECIES: acetyltransferase                  97.1    2e-21   
ref|WP_025968554.1|  acetyltransferase                                97.1    2e-21   
gb|AAD45691.1|AF158628_1  hypothetical protein                        96.3    2e-21   
ref|WP_025927460.1|  MULTISPECIES: acetyltransferase                  97.1    2e-21   
ref|WP_011132196.1|  acetyltransferase                                97.1    2e-21   
ref|WP_025959725.1|  acetyltransferase                                97.1    2e-21   
ref|WP_025942801.1|  MULTISPECIES: acetyltransferase                  97.1    2e-21   
ref|WP_025928198.1|  acetyltransferase                                97.1    2e-21   
ref|WP_025958825.1|  acetyltransferase                                96.7    2e-21   
ref|WP_025952520.1|  acetyltransferase                                96.7    2e-21   
ref|WP_025978837.1|  acetyltransferase                                96.7    2e-21   
ref|WP_011376118.1|  acetyltransferase                                96.7    2e-21   
ref|WP_025891514.1|  MULTISPECIES: acetyltransferase                  96.7    2e-21   
ref|WP_025890542.1|  acetyltransferase                                96.7    2e-21   
ref|WP_025887864.1|  MULTISPECIES: acetyltransferase                  96.7    2e-21   
ref|WP_011932607.1|  acetyltransferase                                96.3    2e-21   
ref|WP_025925114.1|  MULTISPECIES: acetyltransferase                  96.7    2e-21   
ref|WP_025962273.1|  acetyltransferase                                96.7    3e-21   
ref|WP_025906495.1|  MULTISPECIES: acetyltransferase                  96.7    3e-21   
ref|WP_032522539.1|  acetyltransferase                                96.7    3e-21   
ref|WP_025942250.1|  MULTISPECIES: acetyltransferase                  96.3    3e-21   
ref|WP_036901902.1|  acetyltransferase                                95.9    3e-21   
ref|WP_032523695.1|  acetyltransferase                                95.9    4e-21   
ref|WP_025955389.1|  MULTISPECIES: acetyltransferase                  95.9    4e-21   
ref|WP_033829958.1|  acetyltransferase                                95.9    4e-21   
ref|WP_019478539.1|  acetyltransferase                                95.9    5e-21   
ref|WP_032514922.1|  acetyltransferase                                95.9    5e-21   
ref|WP_025894202.1|  MULTISPECIES: acetyltransferase                  95.9    5e-21   
ref|WP_025969111.1|  acetyltransferase                                95.9    5e-21   
gb|KGG12826.1|  N-acetyltransferase (GNAT) family                     95.9    5e-21   
ref|WP_006853329.1|  acetyltransferase                                95.5    6e-21   
ref|XP_010244574.1|  PREDICTED: probable acetyltransferase NSI is...  97.4    6e-21   
ref|WP_043326032.1|  acetyltransferase                                95.1    6e-21   
ref|WP_025924301.1|  MULTISPECIES: acetyltransferase                  95.5    6e-21   
ref|WP_025965475.1|  acetyltransferase                                95.5    6e-21   
ref|WP_025938071.1|  acetyltransferase                                95.5    6e-21   
ref|WP_011823344.1|  acetyltransferase                                95.5    7e-21   
ref|WP_025971888.1|  acetyltransferase                                95.1    1e-20   
ref|WP_032519351.1|  acetyltransferase                                94.7    1e-20   
ref|WP_036918144.1|  MULTISPECIES: acetyltransferase                  94.4    1e-20   
ref|WP_011619853.1|  acetyltransferase                                94.4    2e-20   
gb|AFY30498.1|  acetyltransferase                                     94.7    2e-20   
ref|WP_025962870.1|  acetyltransferase                                94.4    2e-20   
gb|KGG16395.1|  N-acetyltransferase (GNAT) family                     94.4    2e-20   
ref|WP_036906991.1|  acetyltransferase                                94.4    2e-20   
ref|XP_002987694.1|  hypothetical protein SELMODRAFT_126619           94.7    3e-20   
gb|AHF64072.1|  putative acetyltransferase                            93.6    3e-20   
ref|WP_025946673.1|  acetyltransferase                                94.0    3e-20   
ref|WP_032513858.1|  acetyltransferase                                94.0    3e-20   
ref|WP_032523448.1|  acetyltransferase                                93.6    3e-20   
ref|WP_011363951.1|  acetyltransferase                                92.8    5e-20   
ref|WP_006171048.1|  acetyltransferase                                92.8    5e-20   
ref|WP_011294523.1|  acetyltransferase                                92.8    6e-20   
ref|WP_038651798.1|  acetyltransferase                                92.8    6e-20   
ref|WP_029626243.1|  acetyltransferase                                92.4    8e-20   
gb|AII49903.1|  acetyltransferase                                     91.7    1e-19   
ref|WP_038555889.1|  acetyltransferase                                91.7    2e-19   
ref|WP_036914394.1|  MULTISPECIES: acetyltransferase                  91.3    2e-19   
ref|YP_002049541.1|  possible acetyltransferase                       90.9    3e-19   
ref|WP_032526859.1|  acetyltransferase                                90.9    3e-19   
ref|WP_025914375.1|  acetyltransferase                                90.9    3e-19   
ref|WP_029552861.1|  acetyltransferase                                90.5    4e-19   
ref|WP_019476620.1|  acetyltransferase                                90.1    7e-19   
ref|WP_006910477.1|  acetyltransferase                                88.6    2e-18   
ref|WP_012195118.1|  acetyltransferase                                89.0    2e-18   
ref|WP_011359685.1|  acetyltransferase                                88.6    2e-18   
ref|WP_036897597.1|  acetyltransferase                                88.6    2e-18   
ref|WP_043690459.1|  acetyltransferase                                88.2    3e-18   
gb|AII44901.1|  acetyltransferase                                     87.8    3e-18   
ref|WP_009790083.1|  acetyltransferase                                87.8    3e-18   
ref|WP_025953588.1|  acetyltransferase                                86.3    5e-18   
ref|WP_038001915.1|  acetyltransferase                                86.3    2e-17   
ref|XP_005645437.1|  hypothetical protein COCSUDRAFT_8782             84.7    2e-17   
gb|EAQ69793.1|  possible acetyltransferase                            86.3    2e-17   
ref|WP_043737909.1|  acetyltransferase                                84.7    5e-17   
ref|WP_011128404.1|  acetyltransferase                                84.7    5e-17   
emb|CAK27738.1|  Possible acetyltransferase                           84.3    8e-17   
ref|XP_004961728.1|  PREDICTED: probable acetyltransferase NSI-li...  83.2    5e-16   
ref|XP_006415257.1|  hypothetical protein EUTSA_v10008400mg           82.4    9e-16   
gb|EKE04721.1|  hypothetical protein ACD_20C00016G0009                80.5    1e-15   
ref|WP_025980293.1|  hypothetical protein                             77.4    4e-15   
ref|XP_004151216.1|  PREDICTED: acetyltransferase NSI-like            80.1    4e-15   
ref|WP_025940498.1|  hypothetical protein                             77.4    4e-15   
ref|XP_010244573.1|  PREDICTED: probable acetyltransferase NSI is...  80.5    5e-15   
gb|KHN40603.1|  Acetyltransferase NSI                                 80.1    8e-15   
ref|WP_040203475.1|  MULTISPECIES: GCN5 family acetyltransferase      78.2    8e-15   
ref|XP_010244576.1|  PREDICTED: probable acetyltransferase NSI is...  79.3    9e-15   
gb|AIA61238.1|  GNAT family acetyltransferase (chloroplast)           76.6    2e-14   
ref|XP_010922795.1|  PREDICTED: probable acetyltransferase NSI is...  77.0    6e-14   
ref|XP_005714358.1|  unnamed protein product                          77.4    6e-14   
ref|NP_849103.1|  GNAT family acetyltransferase                       75.9    6e-14   
gb|ADE77771.1|  unknown                                               76.3    7e-14   
ref|YP_009051143.1|  putative N-acetyltransferase                     74.3    3e-13   
ref|XP_003081232.1|  putative ORF174 (ISS)                            74.7    4e-13   
ref|WP_015053044.1|  hypothetical protein                             72.8    5e-13   
ref|WP_026575487.1|  GCN5 family acetyltransferase                    72.8    7e-13   
ref|WP_034676993.1|  GCN5 family acetyltransferase                    72.8    7e-13   
ref|WP_006511610.1|  hypothetical protein                             72.8    8e-13   
ref|WP_044748437.1|  GCN5 family acetyltransferase                    72.4    1e-12   
ref|XP_005536670.1|  hypothetical protein, conserved                  73.6    1e-12   
ref|WP_015785180.1|  MULTISPECIES: GCN5 family acetyltransferase      72.0    1e-12   
ref|WP_035984912.1|  acetyltransferase, N-acetylglutamate synthase    71.6    2e-12   
ref|XP_005849615.1|  hypothetical protein CHLNCDRAFT_57286            72.4    3e-12   
ref|WP_028413087.1|  GNAT family acetyltransferase                    70.5    4e-12   
ref|WP_013057360.1|  MULTISPECIES: GNAT family acetyltransferase      70.5    4e-12   
ref|WP_033579196.1|  GNAT family acetyltransferase                    70.5    5e-12   
ref|WP_023064031.1|  acetyltransferase family protein                 70.5    5e-12   
ref|WP_028408268.1|  GNAT family acetyltransferase                    70.1    5e-12   
ref|WP_016764405.1|  GNAT family acetyltransferase                    70.1    5e-12   
ref|WP_026676316.1|  GCN5 family acetyltransferase                    70.1    6e-12   
ref|WP_025900329.1|  hypothetical protein                             68.6    6e-12   
ref|WP_019504048.1|  hypothetical protein                             70.1    6e-12   
ref|WP_042992505.1|  GNAT family acetyltransferase                    69.3    9e-12   
ref|WP_025730930.1|  GCN5 family acetyltransferase                    69.3    1e-11   
ref|WP_040484797.1|  GCN5 family acetyltransferase                    68.9    1e-11   
ref|WP_013083454.1|  GNAT family acetyltransferase                    69.3    1e-11   
ref|WP_043982969.1|  GNAT family acetyltransferase                    68.9    1e-11   
ref|WP_026560072.1|  GNAT family acetyltransferase                    68.9    1e-11   
ref|WP_034651477.1|  GNAT family acetyltransferase                    68.9    1e-11   
gb|ERT03659.1|  acetyltransferase family protein                      68.2    2e-11   
ref|WP_025751658.1|  GNAT family acetyltransferase                    68.9    2e-11   
ref|WP_031537730.1|  GNAT family acetyltransferase                    68.6    2e-11   
ref|WP_025700980.1|  acetyltransferase                                68.6    2e-11   
ref|XP_007510767.1|  GCN5-related N-acetyltransferase                 70.5    2e-11   
ref|WP_036603639.1|  acetyltransferase                                68.2    3e-11   
ref|WP_008881006.1|  MULTISPECIES: GCN5 family acetyltransferase      67.8    3e-11   
ref|WP_015391494.1|  acetyltransferase family protein                 67.8    3e-11   
ref|WP_032086083.1|  GCN5 family acetyltransferase                    67.8    4e-11   
ref|WP_014459041.1|  GCN5 family acetyltransferase                    67.8    4e-11   
ref|WP_033580188.1|  GCN5 family acetyltransferase                    67.8    4e-11   
gb|ABB58281.1|  alr0113 (ycf52)-like                                  68.6    4e-11   
ref|WP_034269121.1|  GNAT family acetyltransferase                    67.8    4e-11   
ref|WP_015218599.1|  N-acetyltransferase GCN5                         67.8    4e-11   
ref|WP_038535209.1|  GCN5 family acetyltransferase                    67.4    4e-11   
ref|WP_009784608.1|  GCN5 family acetyltransferase                    67.4    6e-11   
dbj|BAD80037.1|  similar to alr0113 (ycf52)                           67.8    6e-11   
ref|WP_019229285.1|  hypothetical protein                             67.0    7e-11   
ref|WP_041933888.1|  GCN5 family acetyltransferase                    67.0    7e-11   
ref|WP_025908057.1|  GNAT family acetyltransferase                    66.6    8e-11   
ref|WP_044077321.1|  hypothetical protein                             66.6    9e-11   
ref|WP_039725306.1|  MULTISPECIES: hypothetical protein               66.6    1e-10   
ref|WP_033718411.1|  GCN5 family acetyltransferase                    66.2    1e-10   
ref|WP_013058155.1|  MULTISPECIES: GCN5 family acetyltransferase      66.2    1e-10   
ref|WP_017297960.1|  hypothetical protein                             66.6    1e-10   



>ref|XP_009611002.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Nicotiana 
tomentosiformis]
Length=195

 Score =   282 bits (722),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = +3

Query  3    ISARHVHTHFTLKPTTHRHYKSLavvaqeqqppiaaaaKFSISDEELQSRGFNLHTTFTN  182
            IS     T  TLKPTTH H++++ V +Q Q  P       SISDE L+S+GFNLH + TN
Sbjct  7    ISTHLPPTPLTLKPTTHHHHQNVTVSSQYQPIPTTV--NISISDESLKSKGFNLHRSITN  64

Query  183  LNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAKRPVAFARATGDGVFNAII  362
            LNLDHLNSVF AVGFPRRDT KIQLALE+TD+L W+E++K KRPVAFARATGDGVFNAII
Sbjct  65   LNLDHLNSVFVAVGFPRRDTTKIQLALENTDSLAWIEYEKTKRPVAFARATGDGVFNAII  124

Query  363  WDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGIRG  542
            WDVVVDP+FQGIGLGKAVMER+VT+LL+KGI+NIALYSEPRVLGFYR LGFVADPDGIRG
Sbjct  125  WDVVVDPNFQGIGLGKAVMERLVTELLEKGISNIALYSEPRVLGFYRPLGFVADPDGIRG  184

Query  543  MVYSRKQK  566
            MVYSRK+K
Sbjct  185  MVYSRKKK  192



>ref|XP_004238988.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Solanum 
lycopersicum]
Length=191

 Score =   276 bits (706),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 152/182 (84%), Gaps = 1/182 (1%)
 Frame = +3

Query  18   VHTHFTLKPTTHRHYKSLavvaqeqqppiaaaaKFSISDEELQSRGFNLHTTFTNLNLDH  197
            + T FTLKPT H H         +  P        SISDE L+S+GFNLH+T T+LNLDH
Sbjct  8    ISTPFTLKPTVH-HRNLTVFSQIQPIPIPFTTTNLSISDESLRSKGFNLHSTITDLNLDH  66

Query  198  LNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAKRPVAFARATGDGVFNAIIWDVVV  377
            LNSVF AVGFPRRDT KIQ+ALE+TD+LLW++++K KRPVAFARATGDGVFNAIIWDVVV
Sbjct  67   LNSVFVAVGFPRRDTEKIQIALENTDSLLWIQYEKTKRPVAFARATGDGVFNAIIWDVVV  126

Query  378  DPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGIRGMVYSR  557
            DP+FQGIGLGKAVMER+VTKLL KGITNIALYSEPRVLGFYR LGFVADPDGIRGMVYSR
Sbjct  127  DPNFQGIGLGKAVMERLVTKLLRKGITNIALYSEPRVLGFYRPLGFVADPDGIRGMVYSR  186

Query  558  KQ  563
            ++
Sbjct  187  RK  188



>ref|XP_009774327.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Nicotiana 
sylvestris]
Length=196

 Score =   274 bits (701),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = +3

Query  24   THFTLKPTTHRHYKSLavvaqeqqppiaaaaKFSISDEELQSRGFNLHTTFTNLNLDHLN  203
            T  +LKPTT  H   +     +  P        SISDE L+S+GFNLH + TNLNLDHLN
Sbjct  16   TALSLKPTTIHHRNVIVSSQYQPIPTTV---NISISDESLKSKGFNLHRSITNLNLDHLN  72

Query  204  SVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAKRPVAFARATGDGVFNAIIWDVVVDP  383
            SVF AVGFPRRDT KIQLALE+TD+L+W+E++K KRPVAFARATGDGVFNAIIWDVVVDP
Sbjct  73   SVFVAVGFPRRDTTKIQLALENTDSLMWIEYEKTKRPVAFARATGDGVFNAIIWDVVVDP  132

Query  384  SFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            +FQGIGLGKAVMER+VT+LL KGI NIALYSEPRVLGFYR LGFVADPDGIRGMVYSRK+
Sbjct  133  NFQGIGLGKAVMERLVTELLGKGINNIALYSEPRVLGFYRPLGFVADPDGIRGMVYSRKK  192

Query  564  K  566
            K
Sbjct  193  K  193



>ref|XP_006348605.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like [Solanum 
tuberosum]
Length=194

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 156/186 (84%), Gaps = 3/186 (2%)
 Frame = +3

Query  18   VHTHFTLKPTTH--RHYKSLav-vaqeqqppiaaaaKFSISDEELQSRGFNLHTTFTNLN  188
            +   FTLKPT H   H++++AV    +  P    A   SISDE L+S+GFN H T T+LN
Sbjct  7    ISISFTLKPTAHHHNHHRNVAVFSQIQPIPIPITATNLSISDESLRSKGFNFHRTITDLN  66

Query  189  LDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAKRPVAFARATGDGVFNAIIWD  368
            LDHLNSVF AVGFPRRDT KIQ+ALE+TD+LLW+E++K KRPVAFARATGDGVFNAIIWD
Sbjct  67   LDHLNSVFVAVGFPRRDTEKIQIALENTDSLLWIEYEKTKRPVAFARATGDGVFNAIIWD  126

Query  369  VVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGIRGMV  548
            VVVDP+FQGIGLGKAVMER+VT+LL KGITNIALYSEPRVLGFYR LGFVADPDGIRGMV
Sbjct  127  VVVDPNFQGIGLGKAVMERLVTELLRKGITNIALYSEPRVLGFYRPLGFVADPDGIRGMV  186

Query  549  YSRKQK  566
            YSR++ 
Sbjct  187  YSRRKN  192



>ref|XP_011077765.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Sesamum 
indicum]
Length=184

 Score =   268 bits (685),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            FS+SDE L SRGF  H T  NLNLDHLNSVFAAVGFPRRD  KI++ALEHTDALLW+E++
Sbjct  33   FSVSDESLSSRGFTFHRTIDNLNLDHLNSVFAAVGFPRRDPEKIRVALEHTDALLWIEYE  92

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K ++PVAFARATGDGVFNAIIWDVVVDP+FQGIGLGKAVMER+VT+LL+KGI NIALYSE
Sbjct  93   KTRKPVAFARATGDGVFNAIIWDVVVDPTFQGIGLGKAVMERLVTELLEKGINNIALYSE  152

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSRKQK
Sbjct  153  PRVLGFYRPLGFVADPDGIRGMVYSRKQK  181



>gb|KJB80537.1| hypothetical protein B456_013G103300 [Gossypium raimondii]
Length=173

 Score =   265 bits (676),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            K+SISD++L+SRGF L  T ++LNLDHLNSVF AVGFPRRDT KI+LALEHT ++LWVEH
Sbjct  21   KYSISDKDLESRGFFLRRTISDLNLDHLNSVFVAVGFPRRDTEKIKLALEHTQSILWVEH  80

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +K+++PVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMER+V +LL+KGI NI+LYS
Sbjct  81   KKSQKPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERLVEELLEKGICNISLYS  140

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRVLGFYR LGFVADPDGIRGMVYSRKQK
Sbjct  141  EPRVLGFYRPLGFVADPDGIRGMVYSRKQK  170



>ref|XP_010257855.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Nelumbo 
nucifera]
Length=190

 Score =   263 bits (672),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            KFSISD+EL+SRGFN   + ++LNLDHLNS+F AVGFPRRD  KI++ALE+T++LLW+E+
Sbjct  38   KFSISDQELESRGFNFRRSISDLNLDHLNSIFVAVGFPRRDPEKIRVALENTNSLLWIEY  97

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
             K KRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMER++ +LL KGITNIALYS
Sbjct  98   SKTKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERLLEELLQKGITNIALYS  157

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRVLGFYR LGF ADPDGIRGMVYSRKQK
Sbjct  158  EPRVLGFYRPLGFAADPDGIRGMVYSRKQK  187



>ref|XP_007045686.1| Acyl-CoA N-acyltransferases superfamily protein [Theobroma cacao]
 gb|EOY01518.1| Acyl-CoA N-acyltransferases superfamily protein [Theobroma cacao]
Length=216

 Score =   262 bits (670),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            K+SISD++L+SRGF L  T ++LNLDHLNSVF AVGFPRRD  KI+LALEHT+++LWVE+
Sbjct  64   KYSISDQDLESRGFFLRRTISDLNLDHLNSVFVAVGFPRRDPEKIKLALEHTESMLWVEY  123

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +K ++PVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMER+V +LL+KGI NIALYS
Sbjct  124  KKTQKPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERLVEELLEKGICNIALYS  183

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRVLGFYR LGFVADPDGIRGMVYSRKQ+
Sbjct  184  EPRVLGFYRPLGFVADPDGIRGMVYSRKQR  213



>ref|XP_002514546.1| N-acetyltransferase, putative [Ricinus communis]
 gb|EEF47652.1| N-acetyltransferase, putative [Ricinus communis]
Length=191

 Score =   261 bits (666),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            K+SISDE L+SRGF L  TF++LNLDHLNSVF AVGFP+RD  KI+LALE+T +LLWVEH
Sbjct  39   KYSISDEALESRGFLLRRTFSDLNLDHLNSVFVAVGFPKRDPEKIKLALENTSSLLWVEH  98

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +K ++PVAFARATGD VFNAIIWDVVVDPS+QGIGLGKAVMER+V +LL+KGI NIALYS
Sbjct  99   KKTQKPVAFARATGDNVFNAIIWDVVVDPSYQGIGLGKAVMERLVEELLEKGIVNIALYS  158

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRVLGFYR LGFVADPDGIRGMVYSRKQK
Sbjct  159  EPRVLGFYRPLGFVADPDGIRGMVYSRKQK  188



>ref|XP_002312367.2| hypothetical protein POPTR_0008s11270g [Populus trichocarpa]
 gb|EEE89734.2| hypothetical protein POPTR_0008s11270g [Populus trichocarpa]
Length=189

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            KFSISDE+L+SRGFNLH    +LNLDHLN VF AVGFPRRD  KI+LALE+T++LLWVE+
Sbjct  37   KFSISDEDLESRGFNLHRKIADLNLDHLNKVFVAVGFPRRDPQKIRLALENTNSLLWVEY  96

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +K ++PVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMER++ +LL+KGI NIALYS
Sbjct  97   KKTQKPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERLMEELLEKGIINIALYS  156

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            EPRVLGFYR LGFVADPDGI+GMVYSRK+
Sbjct  157  EPRVLGFYRPLGFVADPDGIKGMVYSRKK  185



>ref|XP_011021280.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Populus 
euphratica]
Length=189

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            KFSISDE+L+SRGFNLH    +LNLDHLN VF AVGFPRRD  KI+LALE+T++LLWVE+
Sbjct  37   KFSISDEDLESRGFNLHREIADLNLDHLNKVFVAVGFPRRDPQKIRLALENTNSLLWVEY  96

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +K ++PVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMER++ +LL+KGI NIALYS
Sbjct  97   KKTQKPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERLMEELLEKGIINIALYS  156

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            EPRVLGFYR LGFVADPDGI+GMVYSRK+
Sbjct  157  EPRVLGFYRPLGFVADPDGIKGMVYSRKK  185



>emb|CDP00509.1| unnamed protein product [Coffea canephora]
Length=194

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
             +ISDE L SRGF LH T   L+LDHLNSVF AVGFPRRDT KI++ALE++DALLW+E++
Sbjct  42   LTISDEALASRGFALHRTINKLDLDHLNSVFVAVGFPRRDTDKIRVALENSDALLWIEYE  101

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            KA+RPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMER+V  LL+KGITNIALYSE
Sbjct  102  KAERPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERLVNVLLEKGITNIALYSE  161

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSR+ +
Sbjct  162  PRVLGFYRPLGFVADPDGIRGMVYSRRTQ  190



>gb|EYU28918.1| hypothetical protein MIMGU_mgv1a021888mg, partial [Erythranthe 
guttata]
Length=173

 Score =   257 bits (656),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  132  DEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAKR  311
            +E L SRGF  H T  NLNLDHLNSVFAAVGFPRRD  KI++ALEHTDALLWVE  K  R
Sbjct  26   EESLSSRGFTFHRTVENLNLDHLNSVFAAVGFPRRDPEKIRIALEHTDALLWVESSKTSR  85

Query  312  PVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVL  491
            PVAFARATGDGVFNAIIWDVVVDP++QGIGLGKAVMER+VT+LL+KGI NIALYSEPRVL
Sbjct  86   PVAFARATGDGVFNAIIWDVVVDPNYQGIGLGKAVMERLVTQLLEKGINNIALYSEPRVL  145

Query  492  GFYRSLGFVADPDGIRGMVYSRKQK  566
            GFYR LGFV+DPDGIRGMVYSRKQK
Sbjct  146  GFYRPLGFVSDPDGIRGMVYSRKQK  170



>ref|XP_008389353.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Malus domestica]
Length=192

 Score =   256 bits (655),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            ++SISD++L +RGFNLH T   LNLDHLN VF AVGFP+RD  KI+ ALEHTD+LLW+E+
Sbjct  40   QYSISDQDLDTRGFNLHRTIAELNLDHLNKVFVAVGFPKRDPDKIRTALEHTDSLLWMEY  99

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +K KRPVAFARATGDGVFNAIIWDVVVDPSFQG+GLGKAVMER++ +L+ KGI NIALYS
Sbjct  100  RKTKRPVAFARATGDGVFNAIIWDVVVDPSFQGLGLGKAVMERLIEELVGKGICNIALYS  159

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRVLGFYR LGFVADPDGIRGMVYSRK K
Sbjct  160  EPRVLGFYRPLGFVADPDGIRGMVYSRKPK  189



>ref|XP_008243760.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Prunus 
mume]
Length=192

 Score =   256 bits (653),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SISD++L SRGF LH T   LNLDHLN VF AVGFP+RD  KI+ ALEHTDALLW+E++
Sbjct  41   YSISDQDLDSRGFLLHRTIAELNLDHLNKVFVAVGFPKRDPDKIRTALEHTDALLWMEYR  100

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K KRPVAFARATGDGVFNAIIWDVVVDPSFQG+GLGKAVMER+V +L+ KGI NIALYSE
Sbjct  101  KTKRPVAFARATGDGVFNAIIWDVVVDPSFQGLGLGKAVMERLVEELVAKGICNIALYSE  160

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSRK K
Sbjct  161  PRVLGFYRPLGFVADPDGIRGMVYSRKPK  189



>ref|XP_007225898.1| hypothetical protein PRUPE_ppa011870mg [Prunus persica]
 gb|EMJ27097.1| hypothetical protein PRUPE_ppa011870mg [Prunus persica]
Length=192

 Score =   255 bits (652),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SISD++L SRGF LH T   LNLDHLN VF AVGFP+RD  KI+ ALEHTDALLW+E++
Sbjct  41   YSISDQDLDSRGFLLHRTIAELNLDHLNKVFVAVGFPKRDPDKIRTALEHTDALLWMEYR  100

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K KRPVAFARATGDGVFNAIIWDVVVDPSFQG+GLGKAVMER+V +L+ KGI NIALYSE
Sbjct  101  KTKRPVAFARATGDGVFNAIIWDVVVDPSFQGLGLGKAVMERLVEELVAKGICNIALYSE  160

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSRK K
Sbjct  161  PRVLGFYRPLGFVADPDGIRGMVYSRKPK  189



>ref|XP_004135133.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like [Cucumis 
sativus]
 ref|XP_004155287.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like [Cucumis 
sativus]
 gb|KGN52013.1| hypothetical protein Csa_5G608010 [Cucumis sativus]
Length=194

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +S+SD +L+SRGF LH T ++LNLDHLNSVFAAVGFP+RD  KI++ALE+TDALLW+++ 
Sbjct  44   YSVSDRDLESRGFVLHRTVSDLNLDHLNSVFAAVGFPKRDPDKIRVALENTDALLWIQYG  103

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQG+GLGKAV+ERI+  LL KGI+NIALYSE
Sbjct  104  KTQRPVAFARATGDGVFNAIIWDVVVDPSFQGLGLGKAVIERIIEDLLRKGISNIALYSE  163

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSRK+K
Sbjct  164  PRVLGFYRPLGFVADPDGIRGMVYSRKKK  192



>emb|CAN70315.1| hypothetical protein VITISV_037700 [Vitis vinifera]
Length=182

 Score =   254 bits (649),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            FSISD+EL+SRGF+L  + ++LNLDHLNSVF AVGFP+RDT KI++ALE+T+++ WVE++
Sbjct  31   FSISDQELESRGFSLRRSVSDLNLDHLNSVFVAVGFPKRDTEKIRVALENTESVQWVEYR  90

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMER++ +LL KGITNI LYSE
Sbjct  91   KTQRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERLLEELLGKGITNIGLYSE  150

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            PRVLGFYR LGFVADPDGIRGMVYSRK+
Sbjct  151  PRVLGFYRPLGFVADPDGIRGMVYSRKR  178



>ref|XP_002271276.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Vitis vinifera]
Length=182

 Score =   253 bits (647),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            FSISD+EL+SRGF+L  +  +LNLDHLNSVF AVGFP+RDT KI++ALE+T+++ WVE++
Sbjct  31   FSISDQELESRGFSLRRSIADLNLDHLNSVFVAVGFPKRDTEKIRVALENTESVQWVEYR  90

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMER++ +LL KGITNI LYSE
Sbjct  91   KTQRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERLLEELLGKGITNIGLYSE  150

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            PRVLGFYR LGFVADPDGIRGMVYSRK+
Sbjct  151  PRVLGFYRPLGFVADPDGIRGMVYSRKR  178



>ref|XP_008446500.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Cucumis 
melo]
Length=193

 Score =   253 bits (645),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +S+SD++L+SRGF LH T ++LNLDHLNSVFAAVGFP+RD  KI++ALE+TDALLW+++ 
Sbjct  43   YSVSDKDLESRGFVLHRTVSDLNLDHLNSVFAAVGFPKRDPDKIRVALENTDALLWIQYG  102

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQG+GLGKAV+ERI+  L  KGI+NIALYSE
Sbjct  103  KTQRPVAFARATGDGVFNAIIWDVVVDPSFQGLGLGKAVIERIIEDLRRKGISNIALYSE  162

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSRK+K
Sbjct  163  PRVLGFYRPLGFVADPDGIRGMVYSRKKK  191



>ref|XP_010499070.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Camelina 
sativa]
Length=196

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SISDE+L+SRGF L  T   LNLD LNSVF AVGFPRRDTAKIQ+ALEHTDALLWVE++
Sbjct  45   YSISDEDLKSRGFLLRRTAEGLNLDQLNSVFVAVGFPRRDTAKIQVALEHTDALLWVEYE  104

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQ  GLGKAVMER++  L  KGI NIALYSE
Sbjct  105  KTRRPVAFARATGDGVFNAIIWDVVVDPSFQSCGLGKAVMERLIEDLQAKGICNIALYSE  164

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFV+DPDGI+GMV+ RKQ+
Sbjct  165  PRVLGFYRPLGFVSDPDGIKGMVFIRKQR  193



>ref|XP_004298329.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Fragaria 
vesca subsp. vesca]
Length=193

 Score =   251 bits (642),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            K+SISD++L SRGF LH T  +LNLDHLN VF AVGFP+RD AKI++AL+HTDALLW+E+
Sbjct  43   KYSISDQDLDSRGFLLHRTAADLNLDHLNKVFVAVGFPKRDPAKIRIALDHTDALLWLEY  102

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
             K  RPVAFARATGDGVFNAIIWDVVVDPSFQGIGLG+AVMER+V +L++KGI NIALYS
Sbjct  103  AKTNRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGRAVMERLVEELVEKGIGNIALYS  162

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            E RVLGFYR LGFVADPDGIRGMVYSRK K
Sbjct  163  EQRVLGFYRPLGFVADPDGIRGMVYSRKPK  192



>ref|XP_010551340.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Tarenaya 
hassleriana]
Length=192

 Score =   251 bits (641),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SI+D +L+S+GF L  +   LNLD LNSVF AVGFPRRD AKI +ALEHTDA+LWVE++
Sbjct  41   YSITDADLESKGFLLRRSAEGLNLDQLNSVFVAVGFPRRDPAKIAVALEHTDAILWVEYE  100

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNA++WDVVVDPSFQGIGLGKAVMER+V  L  +GI NIALYSE
Sbjct  101  KTRRPVAFARATGDGVFNAVVWDVVVDPSFQGIGLGKAVMERLVEDLQARGICNIALYSE  160

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSRKQK
Sbjct  161  PRVLGFYRPLGFVADPDGIRGMVYSRKQK  189



>ref|NP_173946.1| GCN5-like N-acetyltransferase [Arabidopsis thaliana]
 gb|AAG50691.1|AC079829_24 unknown protein [Arabidopsis thaliana]
 dbj|BAC42462.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63282.1| At1g26220 [Arabidopsis thaliana]
 gb|AEE30662.1| Acyl-CoA N-acyltransferase domain-containing protein [Arabidopsis 
thaliana]
Length=197

 Score =   251 bits (640),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SISDE+L+SRGF L  T   LNLD LNSVFAAVGFPRRDTAKI++AL+HTDALLWVE++
Sbjct  46   YSISDEDLESRGFLLRRTTEGLNLDQLNSVFAAVGFPRRDTAKIEVALQHTDALLWVEYE  105

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQ  GLGKAVMER++  L  KGI NIALYSE
Sbjct  106  KTRRPVAFARATGDGVFNAIIWDVVVDPSFQSCGLGKAVMERLIEDLQVKGICNIALYSE  165

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFV+DPDGI+GMV+ RKQ+
Sbjct  166  PRVLGFYRPLGFVSDPDGIKGMVFIRKQR  194



>ref|XP_010091676.1| putative N-acetyltransferase ycf52 [Morus notabilis]
 gb|EXB44942.1| putative N-acetyltransferase ycf52 [Morus notabilis]
Length=195

 Score =   250 bits (639),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            FSIS+++L+SRGF L  T  +L+LD LNSVF AVGFPRRD AKI++ALE+TDA+LW+EH 
Sbjct  44   FSISEKDLESRGFVLRRTAEDLDLDQLNSVFLAVGFPRRDPAKIRIALENTDAMLWIEHA  103

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K K+ VAFARATGDGVFNAIIWDVVVDPS+QGIGLGKAVMER++ +L +KGI+NIALYSE
Sbjct  104  KTKKAVAFARATGDGVFNAIIWDVVVDPSYQGIGLGKAVMERLIQELQEKGISNIALYSE  163

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSRK K
Sbjct  164  PRVLGFYRPLGFVADPDGIRGMVYSRKNK  192



>ref|XP_010460334.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like [Camelina 
sativa]
Length=196

 Score =   250 bits (639),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SISDE+L+SRGF L  T   LNLD LNSVF AVGFPRRDTAKI++ALEHTDALLWVE++
Sbjct  45   YSISDEDLKSRGFLLRRTPEGLNLDQLNSVFVAVGFPRRDTAKIEVALEHTDALLWVEYE  104

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQ  GLGKAVMER++  L  KGI NIALYSE
Sbjct  105  KTRRPVAFARATGDGVFNAIIWDVVVDPSFQSCGLGKAVMERLIEDLQAKGICNIALYSE  164

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFV+DPDGI+GMV+ RKQ+
Sbjct  165  PRVLGFYRPLGFVSDPDGIKGMVFIRKQR  193



>ref|XP_002893411.1| hypothetical protein ARALYDRAFT_472794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69670.1| hypothetical protein ARALYDRAFT_472794 [Arabidopsis lyrata subsp. 
lyrata]
Length=197

 Score =   249 bits (637),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SISDE+L+SRGF L  T   LNLD LNSVF AVGFPRRDTAKI++AL+HTDALLWVE++
Sbjct  46   YSISDEDLESRGFILRRTAEGLNLDQLNSVFVAVGFPRRDTAKIEVALQHTDALLWVEYE  105

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQ  GLGKAVMER++  L  KGI NIALYSE
Sbjct  106  KTRRPVAFARATGDGVFNAIIWDVVVDPSFQSCGLGKAVMERLIEDLQAKGICNIALYSE  165

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFV+DPDGI+GMV+ RKQ+
Sbjct  166  PRVLGFYRPLGFVSDPDGIKGMVFIRKQR  194



>gb|KDP31430.1| hypothetical protein JCGZ_11806 [Jatropha curcas]
Length=223

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            K+SISD++LQSRGF L  T ++LNLDHLNS+F AVGFP+RD  +I+LALE+T++LLW+EH
Sbjct  71   KYSISDDDLQSRGFLLRRTISDLNLDHLNSIFVAVGFPKRDPERIKLALENTNSLLWIEH  130

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +K ++PVAFARATGD VFNAIIWDVVVDPS+QGIGLGKAVMER+V +LL+KGI NIALYS
Sbjct  131  KKTQKPVAFARATGDNVFNAIIWDVVVDPSYQGIGLGKAVMERLVDELLEKGIINIALYS  190

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYS  554
            EPRVLGFYR LGFVADPDGIRGMVYS
Sbjct  191  EPRVLGFYRPLGFVADPDGIRGMVYS  216



>ref|XP_010681307.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Beta vulgaris 
subsp. vulgaris]
Length=195

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +++SD  L+SRG  LH T   LNL+ LNSVF AVGFPRRD  KIQ+ALEHTD+L+WVE  
Sbjct  42   YTVSDTALESRGLILHRTPEGLNLNQLNSVFVAVGFPRRDPDKIQVALEHTDSLIWVESL  101

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K KRPVAFARATGDGVFNAIIWDVVVDP+FQGIGLGKAVMER++ +LL KGITNIALYSE
Sbjct  102  KTKRPVAFARATGDGVFNAIIWDVVVDPTFQGIGLGKAVMERLLEELLQKGITNIALYSE  161

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            PRVLGFYR +GFVADPDGIRGMVYSRKQ
Sbjct  162  PRVLGFYRPMGFVADPDGIRGMVYSRKQ  189



>ref|XP_006415906.1| hypothetical protein EUTSA_v10008844mg [Eutrema salsugineum]
 gb|ESQ34259.1| hypothetical protein EUTSA_v10008844mg [Eutrema salsugineum]
Length=192

 Score =   249 bits (636),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SI+DE+LQSRGF L  T   LNLD LNSVF AVGFPRRDTAKI++AL+HTDA+LWVE +
Sbjct  41   YSITDEDLQSRGFLLRRTPEGLNLDQLNSVFVAVGFPRRDTAKIEVALQHTDAMLWVECE  100

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQ +GLGKAVMER++  L  KGI NIALYSE
Sbjct  101  KTRRPVAFARATGDGVFNAIIWDVVVDPSFQSLGLGKAVMERLIEDLQRKGICNIALYSE  160

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFV+DPDGIRGMV+ RKQ+
Sbjct  161  PRVLGFYRPLGFVSDPDGIRGMVFVRKQR  189



>emb|CDY24382.1| BnaCnng04490D [Brassica napus]
Length=192

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SI+DE+LQS+GF L  T   LNLDHLNSVF AVGFPRRDTAKI++AL HTDA+LWVE++
Sbjct  41   YSITDEDLQSKGFLLRRTPEGLNLDHLNSVFVAVGFPRRDTAKIEVALRHTDAMLWVENE  100

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDP+FQ +GLGKAVMER++  L  KGI NIALYSE
Sbjct  101  KTRRPVAFARATGDGVFNAIIWDVVVDPTFQSLGLGKAVMERLIEDLRRKGICNIALYSE  160

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFV+DPDGIRGMV+ RKQ+
Sbjct  161  PRVLGFYRPLGFVSDPDGIRGMVFVRKQR  189



>ref|XP_010460333.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like [Camelina 
sativa]
 ref|XP_010477878.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like [Camelina 
sativa]
Length=196

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SISDE+L+SRGF L  T   LNLD LNSVF AVGFPRRDTAKI++ALEHTDALLWVE++
Sbjct  45   YSISDEDLKSRGFLLRRTPEGLNLDQLNSVFVAVGFPRRDTAKIEVALEHTDALLWVEYE  104

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAF RATGDGVFNAIIWDVVVDPSFQ  GLGKAVMER++  L  KGI NIALYSE
Sbjct  105  KTRRPVAFGRATGDGVFNAIIWDVVVDPSFQSCGLGKAVMERLIEDLQAKGICNIALYSE  164

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFV+DPDGI+GMV+ RKQ+
Sbjct  165  PRVLGFYRPLGFVSDPDGIKGMVFIRKQR  193



>ref|XP_006304788.1| hypothetical protein CARUB_v10012337mg [Capsella rubella]
 gb|EOA37686.1| hypothetical protein CARUB_v10012337mg [Capsella rubella]
Length=196

 Score =   249 bits (635),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SISDE+L+SRGF L  T   LNLD LNSVF AVGFPRRDTAKI++ALEHTDALLWVE++
Sbjct  45   YSISDEDLKSRGFLLRRTAEGLNLDQLNSVFVAVGFPRRDTAKIEVALEHTDALLWVEYE  104

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQ  GLGKAV+ER++  L  KGI NIALYSE
Sbjct  105  KTRRPVAFARATGDGVFNAIIWDVVVDPSFQSCGLGKAVIERLIEDLQAKGICNIALYSE  164

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFV+DPDGI+GMV+ RKQ+
Sbjct  165  PRVLGFYRPLGFVSDPDGIKGMVFIRKQR  193



>ref|XP_006437813.1| hypothetical protein CICLE_v10032841mg [Citrus clementina]
 gb|ESR51053.1| hypothetical protein CICLE_v10032841mg [Citrus clementina]
Length=189

 Score =   248 bits (634),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            KFSISD+EL+SRGF L  T ++L+++HLNSVF AVGFPRRD  KI++ALE+T +LLW+E+
Sbjct  36   KFSISDQELESRGFILRRTISDLDINHLNSVFVAVGFPRRDPDKIRVALENTSSLLWIEY  95

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +K +RPVAFARATGD VFNAI+WDVVVDPS+QG+GLGKAVMER++ +LL+KGI NIALYS
Sbjct  96   EKTRRPVAFARATGDDVFNAIVWDVVVDPSYQGMGLGKAVMERLIDELLEKGICNIALYS  155

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRVLGFYR LGFVADP GIRGMVYSRK K
Sbjct  156  EPRVLGFYRPLGFVADPGGIRGMVYSRKSK  185



>ref|XP_010046607.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Eucalyptus 
grandis]
 gb|KCW86431.1| hypothetical protein EUGRSUZ_B03096 [Eucalyptus grandis]
Length=204

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
             SISD EL+SRGF LH    +L+LD LN+VF AVGFPRRD  KI++ALEHTDAL+WV+ +
Sbjct  53   LSISDAELESRGFALHRDAASLDLDRLNAVFVAVGFPRRDPGKIRVALEHTDALVWVQQR  112

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            + ++PVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMER+V  LL +GI NIALYSE
Sbjct  113  RTEKPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERLVDDLLARGINNIALYSE  172

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSRKQK
Sbjct  173  PRVLGFYRPLGFVADPDGIRGMVYSRKQK  201



>emb|CDY36081.1| BnaA08g19670D [Brassica napus]
Length=192

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SI+DE+LQS+GF L  T   LNLDHLNSVF AVGFPRRDT KI++AL HTDA+LWVE++
Sbjct  41   YSITDEDLQSKGFLLRRTPEGLNLDHLNSVFVAVGFPRRDTGKIEVALRHTDAMLWVEYE  100

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDP+FQ +GLGKAVMER++  L  KGI NIALYSE
Sbjct  101  KTRRPVAFARATGDGVFNAIIWDVVVDPTFQSLGLGKAVMERLIEDLRRKGICNIALYSE  160

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFV+DPDGIRGMV+ RKQ+
Sbjct  161  PRVLGFYRPLGFVSDPDGIRGMVFVRKQR  189



>ref|XP_009109911.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Brassica 
rapa]
Length=196

 Score =   247 bits (631),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SI+DE+LQS+GF L  T   LNLDHLNSVF AVGFPRRDT KI++AL HTDA+LWVE++
Sbjct  45   YSITDEDLQSKGFLLRRTPEGLNLDHLNSVFVAVGFPRRDTGKIEVALRHTDAMLWVEYE  104

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDP+FQ +GLGKAVMER++  L  KGI NIALYSE
Sbjct  105  KTRRPVAFARATGDGVFNAIIWDVVVDPTFQSLGLGKAVMERLIEDLRRKGICNIALYSE  164

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFV+DPDGIRGMV+ RKQ+
Sbjct  165  PRVLGFYRPLGFVSDPDGIRGMVFVRKQR  193



>ref|XP_006484294.1| PREDICTED: probable acetyltransferase NSI-like [Citrus sinensis]
Length=236

 Score =   248 bits (634),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            KFSISD+EL+SRGF L  T ++L+++HLNSVF AVGFPRRD  KI++ALE+T +LLW+E+
Sbjct  83   KFSISDQELESRGFILRRTISDLDINHLNSVFVAVGFPRRDPDKIRVALENTSSLLWIEY  142

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +K +RPVAFARATGD VFNAI+WDVVVDPS+QG+GLGKAVMER++ +LL+KG+ NIALYS
Sbjct  143  EKTRRPVAFARATGDDVFNAIVWDVVVDPSYQGMGLGKAVMERLIDELLEKGVCNIALYS  202

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRVLGFYR LGFVADP GIRGMVYSRK K
Sbjct  203  EPRVLGFYRPLGFVADPGGIRGMVYSRKSK  232



>ref|XP_003518810.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like [Glycine 
max]
Length=192

 Score =   246 bits (628),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
             S+SD  L+SRGF+L      L+L+ LNSVFAAVGFPRRD  KI++ALEHT+A+LWVEH+
Sbjct  42   LSVSDTALESRGFSLRRGAEGLDLELLNSVFAAVGFPRRDPEKIRVALEHTEAVLWVEHR  101

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +RPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAV+ER++ +L  KGI+NIALYSE
Sbjct  102  KTRRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVIERLLRELRGKGISNIALYSE  161

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSRKQK
Sbjct  162  PRVLGFYRPLGFVADPDGIRGMVYSRKQK  190



>gb|EPS64722.1| hypothetical protein M569_10056, partial [Genlisea aurea]
Length=150

 Score =   244 bits (622),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +3

Query  123  SISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQK  302
            S+S + L SRGF  H +  +LNL+HLNSVF+AVGFPRRD  KI+LAL+HTDA++WVE++K
Sbjct  1    SVSADSLSSRGFEFHRSAEDLNLEHLNSVFSAVGFPRRDPEKIRLALDHTDAVVWVEYEK  60

Query  303  AKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEP  482
             KRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAV+ER+V  LL+ GI NIALYSEP
Sbjct  61   TKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVIERLVAALLEMGIQNIALYSEP  120

Query  483  RVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            RVLGFYR LGFVADPDGIRGMVYS K K
Sbjct  121  RVLGFYRRLGFVADPDGIRGMVYSTKHK  148



>ref|XP_004490320.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like [Cicer 
arietinum]
Length=191

 Score =   245 bits (625),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
             SISDE L+SRGF L  T   LNL+ LN VF AVGFPRRD  KI++ALEHTD+++WVE +
Sbjct  41   LSISDEALESRGFALRRTAEGLNLEALNKVFVAVGFPRRDPEKIRVALEHTDSMVWVEQR  100

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K +R VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAV+ER+V  LL +GI+NIALYSE
Sbjct  101  KTQRAVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVVERLVGDLLGRGISNIALYSE  160

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            PRVLGFYR LGFVADPDGIRGMVYSRKQK
Sbjct  161  PRVLGFYRPLGFVADPDGIRGMVYSRKQK  189



>gb|KFK44561.1| hypothetical protein AALP_AA1G273100 [Arabis alpina]
Length=186

 Score =   241 bits (616),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
            +SI+D++L+SRGF+L  T   LNLD LNSVF AVGFPRRDTAKI++ALEHTDALLW+E++
Sbjct  34   YSITDKDLESRGFHLRRTAQGLNLDQLNSVFVAVGFPRRDTAKIKVALEHTDALLWLEYE  93

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K ++PVAFARATGDGVFNAIIWDVVVDPSFQ +GLGKAVMER++  L  KGI NIALYSE
Sbjct  94   KTRKPVAFARATGDGVFNAIIWDVVVDPSFQSLGLGKAVMERLIDDLKVKGICNIALYSE  153

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            PRVLGFYR LGFV+DPDGIRGMV+ R +
Sbjct  154  PRVLGFYRPLGFVSDPDGIRGMVFIRNK  181



>ref|XP_007146372.1| hypothetical protein PHAVU_006G035000g [Phaseolus vulgaris]
 gb|ESW18366.1| hypothetical protein PHAVU_006G035000g [Phaseolus vulgaris]
Length=194

 Score =   239 bits (611),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
             S+SD  L+SRGF L      L+L+ LN+VF AVGFPRRD  KI+LALEHT A+LWVEH+
Sbjct  43   LSVSDTALESRGFLLRRGVEGLDLEELNAVFVAVGFPRRDPEKIRLALEHTQAVLWVEHR  102

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            + +RPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAV+ER+V +LL +GI+NIALYSE
Sbjct  103  RTQRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVIERLVKELLGRGISNIALYSE  162

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            PRVLGFYR LGF+ADPDGIRGMVYS++Q
Sbjct  163  PRVLGFYRPLGFIADPDGIRGMVYSKRQ  190



>ref|XP_009356485.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Pyrus x 
bretschneideri]
Length=192

 Score =   239 bits (609),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            ++SISD++L +RGFNLH T   LNLDHLN VF AVGFP+RD  KI+ ALEHTD+LLW+E+
Sbjct  40   QYSISDQDLDTRGFNLHRTIAELNLDHLNKVFVAVGFPKRDPDKIRTALEHTDSLLWMEY  99

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +K KRPVAFARATGDGVFNAIIWDVVVDPSFQG+GLG+AVMER++ +L+ KGI       
Sbjct  100  RKTKRPVAFARATGDGVFNAIIWDVVVDPSFQGLGLGRAVMERLIEELVGKGIXXXXXXX  159

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
             PRVLGFYR LGFVADPDGIRGMVYSRK K
Sbjct  160  XPRVLGFYRPLGFVADPDGIRGMVYSRKPK  189



>ref|XP_007146370.1| hypothetical protein PHAVU_006G034800g [Phaseolus vulgaris]
 gb|ESW18364.1| hypothetical protein PHAVU_006G034800g [Phaseolus vulgaris]
Length=194

 Score =   239 bits (609),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
             S+SD  L+SRGF L      L+L+ LN+VF AVGFPRRD  KI+LALEHT A+LWVEH+
Sbjct  43   LSVSDTALESRGFLLRRGAEGLDLEELNAVFVAVGFPRRDPEKIRLALEHTQAVLWVEHR  102

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            + +RPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAV+ER+V +LL +GI+NIALYSE
Sbjct  103  RTQRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVIERLVKELLGRGISNIALYSE  162

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            PRVLGFYR LGF+ADPDGIRGMVYS++Q
Sbjct  163  PRVLGFYRPLGFIADPDGIRGMVYSKRQ  190



>gb|KDO70204.1| hypothetical protein CISIN_1g048638mg, partial [Citrus sinensis]
Length=147

 Score =   233 bits (595),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  138  ELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAKRPV  317
            EL+SRGF L  T ++L+++HLNSVF AVGFPRRD  KI++ALE+T +LLW+E++K +RPV
Sbjct  1    ELESRGFILRRTISDLDINHLNSVFVAVGFPRRDPDKIRVALENTSSLLWIEYEKTRRPV  60

Query  318  AFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGF  497
            AFARATGD VFNAI+WDVVVDPS+QG+GLGKAVMER++ +LL+KG+ NIALYSEPRVLGF
Sbjct  61   AFARATGDDVFNAIVWDVVVDPSYQGMGLGKAVMERLIDELLEKGVCNIALYSEPRVLGF  120

Query  498  YRSLGFVADPDGIRGMVYSRKQK  566
            YR LGFVADP GIRGMVYSRK K
Sbjct  121  YRPLGFVADPGGIRGMVYSRKSK  143



>ref|XP_003589066.1| N-acetyltransferase, putative [Medicago truncatula]
 gb|AES59317.1| acyl-CoA N-acyltransferase domain protein [Medicago truncatula]
 gb|AFK47766.1| unknown [Medicago truncatula]
Length=192

 Score =   225 bits (573),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
             SISDE L+ RGF L  T   LNL+ LN +F AVGFPRRD  KI++ALEHTD+L+W++ +
Sbjct  40   LSISDETLEKRGFILRRTAEGLNLEALNKIFVAVGFPRRDPEKIRVALEHTDSLVWIQER  99

Query  300  KAKR-PVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            K++   VAFARATGDGVFNAIIWDVVVDPSFQG+GLGKAV+ER++  L+ +GITNI+LYS
Sbjct  100  KSQNNAVAFARATGDGVFNAIIWDVVVDPSFQGLGLGKAVVERLMRDLVGRGITNISLYS  159

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRVLGFYR LGFVADPDGIRGMVYS K K
Sbjct  160  EPRVLGFYRPLGFVADPDGIRGMVYSTKNK  189



>ref|XP_006843307.1| hypothetical protein AMTR_s00080p00183240 [Amborella trichopoda]
 gb|ERN04982.1| hypothetical protein AMTR_s00080p00183240 [Amborella trichopoda]
Length=227

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
             +ISD+EL SRGF +H    NL+ D LNSVF  VGFPRR   KI  AL++T +L+W+E  
Sbjct  76   LTISDQELASRGFIVHHNAENLDPDDLNSVFVKVGFPRRQKEKIVKALDNTPSLIWIEDT  135

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            ++K+ VAFARATGD +FNAIIWDVVVDPSFQG GLGKAVMER++  LL+KGI NIALY+E
Sbjct  136  RSKKLVAFARATGDDIFNAIIWDVVVDPSFQGFGLGKAVMERLLKGLLEKGIVNIALYAE  195

Query  480  PRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            P VLGFYR LGF ADPDGIRGMVYSR++K
Sbjct  196  PGVLGFYRPLGFAADPDGIRGMVYSRRKK  224



>ref|XP_008783054.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Phoenix 
dactylifera]
Length=203

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 4/153 (3%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTD-ALLWVEH  296
             S+SD EL+SRGF +  T   L+++ LN VFA VGFPRRD A+I+ ALEH   A++WVE 
Sbjct  46   LSVSDGELESRGFRVRRTAAGLDVESLNEVFARVGFPRRDPARIRRALEHAGGAVVWVED  105

Query  297  QKAK---RPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIA  467
             ++K   RPVAFARATGDGVFNA++WDVVV PSFQG+GLG+AVMER+V +L   G++NIA
Sbjct  106  ARSKAEGRPVAFARATGDGVFNAVVWDVVVAPSFQGMGLGRAVMERLVAELRGMGVSNIA  165

Query  468  LYSEPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            LY+EPRV+GFYR LGF ADPDGIRGMVYSRK +
Sbjct  166  LYAEPRVVGFYRPLGFAADPDGIRGMVYSRKNQ  198



>gb|ABK22519.1| unknown [Picea sitchensis]
Length=248

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            KFSISD +L SRGF LH +  NL+LD LN++F  VGFPRR   +++ AL +T ++LWVE 
Sbjct  96   KFSISDSQLSSRGFELHYSLDNLDLDELNALFVKVGFPRRQKDRLKRALHNTPSMLWVEE  155

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +++ + VAF+RATGD VFNAIIWDVVVDP  QGIGLGKA+MER++  LLDKGITNIALY+
Sbjct  156  KRSGKVVAFSRATGDDVFNAIIWDVVVDPGLQGIGLGKAIMERLMASLLDKGITNIALYA  215

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSR  557
            EP VLGFYR LGF ADPDGI+ MVYS+
Sbjct  216  EPHVLGFYRPLGFTADPDGIKAMVYSK  242



>ref|XP_010929077.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like isoform 
X1 [Elaeis guineensis]
Length=203

 Score =   212 bits (540),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 125/153 (82%), Gaps = 4/153 (3%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTD-ALLWVEH  296
             S+SD EL++RGF +  T T L++D LN VFA VGFPRRD  +I+ ALE    A++WVE 
Sbjct  47   LSVSDGELETRGFLVRRTATGLDVDALNEVFARVGFPRRDPTRIRRALEQAGGAVVWVEE  106

Query  297  QKAK---RPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIA  467
             ++K   RPVAFARATGDGVFNA++WDVVV+PSFQG+GLG+AVMER+V +L   G++NIA
Sbjct  107  TRSKAEGRPVAFARATGDGVFNAVVWDVVVEPSFQGMGLGRAVMERLVAELRGMGVSNIA  166

Query  468  LYSEPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            LY+EPRV+GFYR LGF ADPDGIRGMVYSRK++
Sbjct  167  LYAEPRVVGFYRPLGFAADPDGIRGMVYSRKKQ  199



>ref|XP_002993253.1| hypothetical protein SELMODRAFT_449074 [Selaginella moellendorffii]
 ref|XP_002994210.1| hypothetical protein SELMODRAFT_432148 [Selaginella moellendorffii]
 gb|EFJ04715.1| hypothetical protein SELMODRAFT_432148 [Selaginella moellendorffii]
 gb|EFJ05674.1| hypothetical protein SELMODRAFT_449074 [Selaginella moellendorffii]
Length=187

 Score =   207 bits (526),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 117/150 (78%), Gaps = 2/150 (1%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            KFS+SD++L SRGF LH +  N+NLD LN++F  VGFPRR   K+  ALEHT  +LWV  
Sbjct  39   KFSMSDDDLSSRGFQLHRSLDNINLDDLNALFVKVGFPRRQNEKLLRALEHTGTMLWV--  96

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
             KA   +AFARATGD VFNAIIWDVVVDP+FQGIGLGKAVMER++  L  KGITNI LY+
Sbjct  97   TKAGSVIAFARATGDDVFNAIIWDVVVDPAFQGIGLGKAVMERLMADLTRKGITNIVLYA  156

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EP VLGFY+ LGFV DPDGIR M  SR+++
Sbjct  157  EPNVLGFYKPLGFVVDPDGIRAMSLSRRRR  186



>ref|XP_010667852.1| PREDICTED: uncharacterized protein LOC104884847 [Beta vulgaris 
subsp. vulgaris]
Length=258

 Score =   204 bits (518),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 118/155 (76%), Gaps = 7/155 (5%)
 Frame = +3

Query  123  SISDEELQSRGFNLHT----TFTNLNLDHLNS---VFAAVGFPRRDTAKIQLALEHTDAL  281
            S+  EELQ+    L      +F  L  D  +    +F  +    RD  KIQ+ALEHTD+L
Sbjct  99   SLYLEELQNESTWLSAGKILSFEELPFDKSSEEVPIFPPLLMYLRDPDKIQVALEHTDSL  158

Query  282  LWVEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITN  461
            +WVE  K KRPVAFARATGDGVFNAIIWDVVVDP+FQGIGLGKAVMER++ +LL KGITN
Sbjct  159  IWVESLKTKRPVAFARATGDGVFNAIIWDVVVDPTFQGIGLGKAVMERLLEELLQKGITN  218

Query  462  IALYSEPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            IALYSEPRVLGFYR +GFVADPDGIRGMVYSRKQ 
Sbjct  219  IALYSEPRVLGFYRPMGFVADPDGIRGMVYSRKQN  253



>ref|XP_001759132.1| predicted protein [Physcomitrella patens]
 gb|EDQ76201.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   199 bits (505),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            KFS +DE+L+S GF  H+T  +L+LD LN++F+ V FP+RD  K+  ALE+T +L+W++ 
Sbjct  18   KFSQTDEDLESAGFTCHSTIEDLDLDQLNALFSKVSFPQRDKGKLLRALENTQSLVWIQE  77

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
             K  R + FARATGD VF+AIIWDVVVDP++QG+GLGK +MER++  L+  GI+NIALY+
Sbjct  78   IKTSRLIGFARATGDRVFHAIIWDVVVDPAYQGLGLGKVLMERLMADLMKMGISNIALYA  137

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            EP V+GFY+ +GF+ADPDGIR M YSR++
Sbjct  138  EPTVIGFYQPMGFIADPDGIRAMAYSRRR  166



>dbj|BAJ84880.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90907.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=199

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            + ++SD EL SRGF +  T   L++  LN VFA VGFPRR   +++ ALEH++ + W+  
Sbjct  46   QLTVSDSELSSRGFAVRRTAEGLDVAALNEVFARVGFPRRQEERLRRALEHSE-VAWLAS  104

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +   RPVAFARA GDGVFNA++WDVVV+PS QG+GLG+AVMER+V +L  KG+ NI LY+
Sbjct  105  EATGRPVAFARAAGDGVFNAVVWDVVVEPSCQGLGLGRAVMERLVAELRRKGVGNIVLYA  164

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRV+GFYR LGF  DPDGIRGM Y R ++
Sbjct  165  EPRVVGFYRPLGFAMDPDGIRGMAYYRSKQ  194



>dbj|BAJ85874.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=187

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            + ++SD EL SRGF +  T   L++  LN VFA VGFPRR   +++ ALEH++ + W+  
Sbjct  34   QLTVSDSELSSRGFAVRRTAEGLDVAALNEVFARVGFPRRQEERLRRALEHSE-VAWLAS  92

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +   RPVAFARA GDGVFNA++WDVVV+PS QG+GLG+AVMER+V +L  KG+ NI LY+
Sbjct  93   EATGRPVAFARAAGDGVFNAVVWDVVVEPSCQGLGLGRAVMERLVAELRRKGVGNIVLYA  152

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRV+GFYR LGF  DPDGIRGM Y R ++
Sbjct  153  EPRVVGFYRPLGFAMDPDGIRGMAYYRSKQ  182



>gb|EMT03851.1| Putative N-acetyltransferase ycf52 [Aegilops tauschii]
Length=199

 Score =   192 bits (487),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            + ++SD EL SRGF +  T   L++  LN VFA VGFPRR   +++ ALEH + + W+  
Sbjct  46   QLTVSDSELSSRGFAVRRTAEGLDVAALNEVFARVGFPRRQEERLRRALEHRE-VAWLAS  104

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            +   RPVAFARA GDGVFNA++WDVVV+PS QG+GLG+AVMER+V +L  KG+ NI LY+
Sbjct  105  EATGRPVAFARAAGDGVFNAVVWDVVVEPSCQGLGLGRAVMERLVAELRRKGVGNIVLYA  164

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRV+GFYR LGF  DPDGIRGM Y R ++
Sbjct  165  EPRVVGFYRPLGFAMDPDGIRGMAYYRSKQ  194



>ref|NP_001060765.1| Os08g0102000 [Oryza sativa Japonica Group]
 dbj|BAD03558.1| putative ORF174 [Oryza sativa Japonica Group]
 dbj|BAD33154.1| putative ORF174 [Oryza sativa Japonica Group]
 dbj|BAF22679.1| Os08g0102000 [Oryza sativa Japonica Group]
 gb|EAZ05280.1| hypothetical protein OsI_27483 [Oryza sativa Indica Group]
 gb|EAZ41221.1| hypothetical protein OsJ_25726 [Oryza sativa Japonica Group]
 dbj|BAG90782.1| unnamed protein product [Oryza sativa Japonica Group]
Length=200

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 115/151 (76%), Gaps = 4/151 (3%)
 Frame = +3

Query  123  SISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVE---  293
            S+SD EL +RGF +  + T L++  LN VFA VGFPRR   +++ ALEH++ ++W+E   
Sbjct  44   SVSDSELAARGFAVRRSSTGLDVGALNEVFARVGFPRRQEERLRRALEHSE-VVWLEDSA  102

Query  294  HQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALY  473
               A RPVAFARA GDGVFNA++WDVVV+PS QG+GLG+AVMER+V  L  KG++NIALY
Sbjct  103  SSSAGRPVAFARAAGDGVFNAVVWDVVVEPSCQGLGLGRAVMERLVADLRGKGVSNIALY  162

Query  474  SEPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            +EPRV+GFYR LGF  DPD IRGM + R ++
Sbjct  163  AEPRVVGFYRLLGFAMDPDAIRGMAFYRSRQ  193



>ref|XP_006659730.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like [Oryza 
brachyantha]
Length=198

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            + S+SD EL +RGF +  + + L++  LN VFA VGFPRR   +++ ALEH++ ++W+E 
Sbjct  46   EVSVSDSELAARGFAVRRSTSGLDVGALNEVFARVGFPRRQEERLRRALEHSE-VVWLE-  103

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
             +A RPVAFARA GDGVFNA++WDVVV+PS QG+GLG+AVMER+V +L  KG++NIALY+
Sbjct  104  -EAGRPVAFARAAGDGVFNAVVWDVVVEPSCQGLGLGRAVMERLVGELRAKGVSNIALYA  162

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            EPRV+GFYR LGF  DPD IRGM + R ++
Sbjct  163  EPRVVGFYRLLGFAMDPDAIRGMAFYRSRQ  192



>ref|XP_003571288.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Brachypodium 
distachyon]
Length=207

 Score =   187 bits (475),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 111/152 (73%), Gaps = 3/152 (2%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            + ++SD EL +RGF    T   L++  LN VFA VGFPRR  A+++ AL H++ + WV  
Sbjct  49   QLTVSDAELSARGFTARRTAEGLDVAALNEVFARVGFPRRQEARLRRALAHSE-VAWVAS  107

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
                RP+AFARA GDGVFNA++WDVVV+PS QG+GLG+AVMER+V  L  KG+ NI LY+
Sbjct  108  AATGRPLAFARAAGDGVFNAVVWDVVVEPSCQGLGLGRAVMERLVAGLRLKGVGNIVLYA  167

Query  477  EPRVLGFYRSLGFVADPDGIRGMVY--SRKQK  566
            EPRV+GFYR LGF  DPDGIRGM Y  SR+Q 
Sbjct  168  EPRVVGFYRPLGFAMDPDGIRGMAYYKSRQQN  199



>ref|XP_009385425.1| PREDICTED: uncharacterized N-acetyltransferase ycf52 [Musa acuminata 
subsp. malaccensis]
Length=209

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 119/154 (77%), Gaps = 5/154 (3%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTD-ALLWVEH  296
            F++SD EL++RGF +  +   L++  LN VFA VGFPRRD  +++ AL H   A++WVE 
Sbjct  53   FTVSDGELETRGFRVRRSSDGLDVAALNDVFARVGFPRRDPDRLRRALGHAGGAVVWVEE  112

Query  297  QK----AKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNI  464
             K      +PVAFARATGDGVFNA++WDVVV+PS QG+GLG+AVMER+V  L   G++NI
Sbjct  113  SKRGGGPGKPVAFARATGDGVFNAVVWDVVVEPSLQGMGLGRAVMERLVADLRRSGVSNI  172

Query  465  ALYSEPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            ALY+EPRV+GFYR LGF ADPDGI+GMVYSR+ +
Sbjct  173  ALYAEPRVVGFYRPLGFAADPDGIKGMVYSRRNQ  206



>ref|XP_004974291.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like [Setaria 
italica]
Length=227

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 4/153 (3%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            + ++SD EL SRGF++  T   +++  LN VFA VGFPRR   +++ ALEH+  ++W+  
Sbjct  69   RLTVSDAELASRGFSVRRTAEGIDVAALNEVFARVGFPRRQEERLRRALEHSR-VVWLSA  127

Query  297  ---QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIA  467
               ++A RPVAFARA GDGVFNA++WDVVV+PS QG+GLG+AVMER+V  L   G+ NI 
Sbjct  128  AVGEEAGRPVAFARAAGDGVFNAVVWDVVVEPSCQGLGLGRAVMERLVQDLRSDGVGNIV  187

Query  468  LYSEPRVLGFYRSLGFVADPDGIRGMVYSRKQK  566
            LY+E RV+GFYR L F  DPDGIRGM Y R ++
Sbjct  188  LYAEARVVGFYRLLDFAMDPDGIRGMAYYRSKQ  220



>ref|NP_001143948.1| uncharacterized protein LOC100276761 [Zea mays]
 gb|ACG36662.1| hypothetical protein [Zea mays]
Length=196

 Score =   179 bits (455),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            + ++SD EL+SRGF +  T   +++  LN VF  VGFPRR   +++ ALEH+  +     
Sbjct  43   RLTVSDAELESRGFAVRRTAEGIDVAALNEVFVRVGFPRRQEERLRRALEHSRVVWLSAG  102

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
            ++  RPVAFARA GDGVFNA++WDVVV+PS QG+GLG+AVMER+V +L   G+ NI LY+
Sbjct  103  EEEGRPVAFARAAGDGVFNAVVWDVVVEPSSQGLGLGRAVMERLVDELRRDGVANIVLYA  162

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRK  560
            E RV+GFYR L F  DPDGIRGM Y RK
Sbjct  163  ETRVVGFYRLLDFAMDPDGIRGMAYYRK  190



>ref|XP_002444853.1| hypothetical protein SORBIDRAFT_07g000310 [Sorghum bicolor]
 gb|EES14348.1| hypothetical protein SORBIDRAFT_07g000310 [Sorghum bicolor]
Length=233

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEH  296
            + ++SD EL+SRGF +  T   +++  LN VFA VGFPRR   +++ ALEH+  +     
Sbjct  69   RLTVSDAELESRGFAVRRTAEGIDVAALNEVFARVGFPRRQEERLRRALEHSRVVWLSAA  128

Query  297  QKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
             +  RPVAFARA GDGVFNA++WDVVV+PS QG+GLG+AVMER+V +L   G+ NI LY+
Sbjct  129  GEEGRPVAFARAAGDGVFNAVVWDVVVEPSCQGLGLGRAVMERLVDELRRDGVANIVLYA  188

Query  477  EPRVLGFYRSLGFVADPDGIRGMVYSRK  560
            E RV+GFYR L F  DPDGIRGM Y RK
Sbjct  189  ETRVVGFYRLLDFAMDPDGIRGMAYYRK  216



>ref|XP_002953791.1| hypothetical protein VOLCADRAFT_64094 [Volvox carteri f. nagariensis]
 gb|EFJ45115.1| hypothetical protein VOLCADRAFT_64094 [Volvox carteri f. nagariensis]
Length=167

 Score =   142 bits (359),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 94/130 (72%), Gaps = 4/130 (3%)
 Frame = +3

Query  189  LDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV----EHQKAKRPVAFARATGDGVFNA  356
            +  LN +F  VGFPRRD  ++++ALE+T  ++WV    + + A++ + FARAT DGV +A
Sbjct  29   ITELNELFEKVGFPRRDPDRLRVALENTYHIIWVRAARQSRLARQIIGFARATSDGVLSA  88

Query  357  IIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGI  536
             +WDV V+P +Q  GLG+A+MER+  KL++ GI  I LY+EP+V+G Y  LG+V DPDGI
Sbjct  89   TVWDVAVNPGWQRSGLGRALMERLTKKLVEDGIPTITLYAEPQVVGLYEKLGYVRDPDGI  148

Query  537  RGMVYSRKQK  566
            RGM + R++K
Sbjct  149  RGMAFQRRKK  158



>ref|XP_010497903.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like, partial 
[Camelina sativa]
Length=82

 Score =   138 bits (347),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  330  ATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSL  509
            ATGDGVFNAIIWDVVVDPSFQ  GLGKAVMER++  L  KGI NIALYSEPRVLGFYR L
Sbjct  1    ATGDGVFNAIIWDVVVDPSFQSCGLGKAVMERLIEDLQAKGICNIALYSEPRVLGFYRPL  60

Query  510  GFVADPDGIRGMVYSRKQK  566
            GFV+DPDGI+GMV+ RKQ+
Sbjct  61   GFVSDPDGIKGMVFIRKQR  79



>ref|XP_010497917.1| PREDICTED: uncharacterized N-acetyltransferase ycf52-like, partial 
[Camelina sativa]
Length=79

 Score =   134 bits (336),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  132  DEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAKR  311
            DE+L+SRGF L  T   LNLD LNSVF AVGFPRRDTAKI++ALEHTDALLWVE++K +R
Sbjct  1    DEDLKSRGFLLRRTPEGLNLDQLNSVFVAVGFPRRDTAKIEVALEHTDALLWVEYEKTRR  60

Query  312  PVAFARATGDGVFNAIIWD  368
            PVAFARATGDGVFNAIIWD
Sbjct  61   PVAFARATGDGVFNAIIWD  79



>ref|XP_001700344.1| histone acetyltransferase [Chlamydomonas reinhardtii]
 gb|EDO98186.1| histone acetyltransferase, partial [Chlamydomonas reinhardtii]
Length=133

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 6/122 (5%)
 Frame = +3

Query  219  VGFPRRDTAKIQLALEHTDALLWVEHQKAKR------PVAFARATGDGVFNAIIWDVVVD  380
            VGFPRRD  ++++ALE+T  ++WV   +  R       + FARAT DGV +A +WDV V+
Sbjct  1    VGFPRRDPDRLKVALENTYHVIWVRSTRQSRLAKNGQMIGFARATSDGVLSATVWDVAVN  60

Query  381  PSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGIRGMVYSRK  560
            P++Q  GLG+A+MER+  KL++ GI  I LY+EP+V+G Y  LG+V DP+GIRGM + RK
Sbjct  61   PAWQRSGLGRALMERLTKKLVEDGIPTITLYAEPQVVGLYEKLGYVRDPEGIRGMAFQRK  120

Query  561  QK  566
            +K
Sbjct  121  KK  122



>gb|KIZ00482.1| putative acetyltransferase NSI [Monoraphidium neglectum]
Length=214

 Score =   135 bits (341),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 101/170 (59%), Gaps = 26/170 (15%)
 Frame = +3

Query  129  SDEELQSRGFNLHTTFTNLNLDHLNSVF--------------------AAVGFPRRDTAK  248
            +D++ Q  G    ++   ++L  LN +F                    + VGFPRR+ A+
Sbjct  30   TDDDFQQLGVEFLSSADGIDLSELNELFEKASGGGCRGGHQRGPARAPSDVGFPRREPAR  89

Query  249  IQLALEHTDALLWVEHQKAKRP------VAFARATGDGVFNAIIWDVVVDPSFQGIGLGK  410
            +++ALE+T  ++WV   K  R       + FARAT DGVF+A IWDV V P++Q  GLG+
Sbjct  90   LRVALENTHRIVWVRSSKQSRVARLGQLLGFARATSDGVFSATIWDVAVAPAWQRSGLGR  149

Query  411  AVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGIRGMVYSRK  560
            A+MER+   L++ GI  I LY+EP+V+G YR LGF +D DGI+GM + RK
Sbjct  150  AMMERLTAGLVEDGIPTITLYAEPKVVGMYRKLGFRSDVDGIKGMAFQRK  199



>ref|XP_011397697.1| putative acetyltransferase NSI [Auxenochlorella protothecoides]
 gb|KFM24809.1| putative acetyltransferase NSI [Auxenochlorella protothecoides]
Length=241

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 88/151 (58%), Gaps = 7/151 (5%)
 Frame = +3

Query  129  SDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAK  308
            SDE     G     +    NLD LN +F  VGFPRRD AK   AL +T   +WV   +  
Sbjct  90   SDEHFAELGLAFEWSLAP-NLDELNDLFQRVGFPRRDKAKFAEALSNTHCTVWVRATRKS  148

Query  309  RP------VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIAL  470
            R       +AFARAT D    A IWDV V P +Q IGLG+A++ER++  L  +GI  I L
Sbjct  149  RMAREGQLLAFARATSDKALTATIWDVAVTPGWQRIGLGRALVERLLEALTSQGIPTITL  208

Query  471  YSEPRVLGFYRSLGFVADPDGIRGMVYSRKQ  563
            Y+EP V+G Y  +GFV DP G++G+ + +K+
Sbjct  209  YAEPGVVGMYEKMGFVCDPQGVKGLAFQQKR  239



>ref|YP_008144758.1| N-acetyltransferase Ycf52 [Grateloupia taiwanensis]
 gb|AGO19954.1| N-acetyltransferase Ycf52 [Grateloupia taiwanensis]
Length=179

 Score =   129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 97/144 (67%), Gaps = 5/144 (3%)
 Frame = +3

Query  135  EELQSRG--FNLHTTF-TNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQ  299
            E L+++G   N++ +  T++NL  L  +  AVG+ RR   K+++A+EH+     L+ E+ 
Sbjct  33   EHLENKGQAINIYMSVDTDINLYDLEELCDAVGWVRRPLKKVKMAIEHSFLTVSLFCEYN  92

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            K ++ + FARAT D  FNA IWDVV+ P FQG GLGK +M++ + +L    I+ I L+++
Sbjct  93   KKRKLIGFARATSDSAFNATIWDVVIHPDFQGKGLGKTLMDQTIKQLRSCDISTITLFAD  152

Query  480  PRVLGFYRSLGFVADPDGIRGMVY  551
            P V+ FYR+LGF+ DPDG++GM +
Sbjct  153  PHVISFYRNLGFITDPDGVKGMFW  176



>ref|YP_007627293.1| GCN5-like N-acetyltransferase [Chondrus crispus]
 emb|CCP38040.1| GCN5-like N-acetyltransferase [Chondrus crispus]
Length=182

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV--EHQKAKRPVAFARATGD  341
            +T  N+NL  L  +  +VG+ RR   K++LA++H+   + V  ++ K+K+ + FARAT D
Sbjct  50   STGKNINLYELEQLCDSVGWVRRPLKKVKLAIDHSFVTICVFYKNNKSKKLIGFARATSD  109

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
             VFNA IWDVV+ P+FQG GLGKA+M++IV +L    I+ I L+++P V+ FYR +GF+ 
Sbjct  110  TVFNATIWDVVIHPNFQGKGLGKALMDQIVIQLRYSDISTITLFADPHVVSFYRRIGFIT  169

Query  522  DPDGIRGMVY  551
            DPDGI+GM +
Sbjct  170  DPDGIKGMFW  179



>ref|XP_005849365.1| hypothetical protein CHLNCDRAFT_143824 [Chlorella variabilis]
 gb|EFN57263.1| hypothetical protein CHLNCDRAFT_143824 [Chlorella variabilis]
Length=200

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 92/153 (60%), Gaps = 6/153 (4%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
             S SDE+    G         L++  LN +F  VGFPRRD +++ LAL +T   +W+   
Sbjct  35   ISKSDEQFLEGGVEFVWGEEGLDVGELNDLFEKVGFPRRDPSRLALALANTYRTIWIRAA  94

Query  300  KAKRP------VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITN  461
            +  R       + FARAT DG  +A+IWDV V P++Q  GLG+A++ER+ + L+  GI  
Sbjct  95   RKSRLAREGQLLGFARATSDGALSAVIWDVSVAPAWQRGGLGRALVERLTSSLVHDGIAT  154

Query  462  IALYSEPRVLGFYRSLGFVADPDGIRGMVYSRK  560
            I LY+EP V+  Y  LG+V+DP+GIRG+ +  K
Sbjct  155  ITLYAEPGVVALYEKLGYVSDPEGIRGVAFQTK  187



>ref|WP_023074761.1| gcn5-related n-acetyltransferase [Leptolyngbya sp. Heron Island 
J]
 gb|ESA34344.1| gcn5-related n-acetyltransferase [Leptolyngbya sp. Heron Island 
J]
Length=173

 Score =   127 bits (318),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            + +T  N++L  L  +  AVG+ RR   K++ A++H+  +  +W +    KR + F+RAT
Sbjct  39   VFSTDRNIDLYELEELCDAVGWSRRPLRKVKKAIQHSFLVVTMWEQQGARKRLIGFSRAT  98

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV PSFQG GLGKA+M++++ KL  + I+N+ L+++P+V+ FY++LGF
Sbjct  99   SDHAFNATIWDVVVHPSFQGRGLGKALMQQLIKKLRSEDISNVTLFADPQVVNFYKNLGF  158

Query  516  VADPDGIRGMVY  551
            + DP+GI+GM +
Sbjct  159  MPDPEGIKGMFW  170



>ref|WP_006517988.1| acetyltransferase [Leptolyngbya sp. PCC 7375]
 gb|EKV03628.1| acetyltransferase [Leptolyngbya sp. PCC 7375]
Length=173

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 91/130 (70%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  N++L  L  +  AVG+ RR   K++ A++H+  +  +W +    KR + F+RAT D
Sbjct  41   STDRNIDLYELEELCDAVGWSRRPLRKVKKAIQHSFLVVTMWEQQGARKRLIGFSRATSD  100

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV PSFQG GLGKA+M++++ KL  + I+N+ L+++P V+ FY++LGF+ 
Sbjct  101  HAFNATIWDVVVHPSFQGRGLGKALMQQLIKKLRSEDISNVTLFADPHVVNFYKNLGFMP  160

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  161  DPEGIKGMFW  170



>ref|WP_017320634.1| N-acetyltransferase [cyanobacterium PCC 7702]
Length=183

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            + +T  +++L  L  +  AVG+ RR   K++ A+EH+  +  +W      +R + FARAT
Sbjct  49   IFSTERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVVSMWQVRGNKRRLIGFARAT  108

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYRSLGF
Sbjct  109  SDYAFNATIWDVVVHPEFQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRSLGF  168

Query  516  VADPDGIRGMVY  551
            V+DP+GI+GM +
Sbjct  169  VSDPEGIKGMFW  180



>ref|XP_003059249.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56381.1| predicted protein [Micromonas pusilla CCMP1545]
Length=167

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 93/140 (66%), Gaps = 11/140 (8%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---EHQKAK-----RPVAFARAT  335
            + +LD LN++FA VGFP+RD  +++ AL ++  ++WV   +  K++     + + FAR T
Sbjct  28   DADLDELNALFATVGFPQRDPVRLKRALVNSHLIVWVVATDKNKSRATHVGQVIGFARVT  87

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D VFN  IWDVVV P +QG G+G+ ++ER+V K+L++GI N++LY+EP V+  Y   GF
Sbjct  88   SDKVFNGTIWDVVVSPEWQGAGIGRGMVERLVDKMLEEGINNVSLYAEPAVVKLYNDCGF  147

Query  516  VADPDGIRGMVY---SRKQK  566
              DP G  GM +   SR++K
Sbjct  148  EIDPGGTTGMAFRVKSRRRK  167



>ref|WP_016862307.1| N-acetyltransferase [Fischerella muscicola]
Length=181

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARAT  335
            + +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT
Sbjct  47   VFSTERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKRRLIGFARAT  106

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYRSLGF
Sbjct  107  SDHAFNATIWDVVVHPEFQGQGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRSLGF  166

Query  516  VADPDGIRGMVY  551
            ++DP+GI+GM +
Sbjct  167  MSDPEGIKGMFW  178



>ref|WP_009459074.1| MULTISPECIES: N-acetyltransferase [Fischerella]
 gb|EHC10244.1| GCN5-related N-acetyltransferase [Fischerella sp. JSC-11]
Length=181

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  49   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKRRLIGFARATSD  108

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYRSLGF++
Sbjct  109  HAFNATIWDVVVHPDFQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRSLGFMS  168

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  169  DPEGIKGMFW  178



>ref|WP_016867314.1| N-acetyltransferase [Fischerella muscicola]
Length=181

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  49   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKRRLIGFARATSD  108

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYRSLGF++
Sbjct  109  HAFNATIWDVVVHPDFQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRSLGFMS  168

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  169  DPEGIKGMFW  178



>ref|WP_015156799.1| MULTISPECIES: N-acetyltransferase GCN5 [Cyanobacteria]
 gb|AFY90259.1| GCN5-related N-acetyltransferase [Chroococcidiopsis thermalis 
PCC 7203]
 gb|KIF21297.1| acetyltransferase [Scytonema millei VB511283]
Length=175

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 97/151 (64%), Gaps = 9/151 (6%)
 Frame = +3

Query  126  ISDEELQSRGFN-------LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL-  281
            + +E ++S GF+       + +T  N++L  L  +  AVG+ RR   K++ A++H+  + 
Sbjct  22   VEEEAVESMGFSALNGESIVFSTDRNIDLYELEELCDAVGWARRPLRKVKKAIQHSFLVV  81

Query  282  -LWVEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGIT  458
             +W      +R + FARAT D  FNA IWDVVV PSFQG GLGKA+M+  + KL  + I+
Sbjct  82   SMWQVRGTQRRLIGFARATSDHAFNATIWDVVVHPSFQGKGLGKALMKYAIKKLRAEDIS  141

Query  459  NIALYSEPRVLGFYRSLGFVADPDGIRGMVY  551
            NI L+++P V+ FYR +GF+ DP+GI+GM +
Sbjct  142  NITLFADPHVVDFYRGMGFMTDPEGIKGMFW  172



>ref|WP_026733123.1| acetyltransferase [Fischerella sp. PCC 9605]
Length=175

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  43   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKRRLIGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYRSLGF++
Sbjct  103  HAFNATIWDVVVHPDFQGRGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRSLGFMS  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|WP_015195576.1| GCN5-related N-acetyltransferase [Stanieria cyanosphaera]
 gb|AFZ37922.1| GCN5-related N-acetyltransferase [Stanieria cyanosphaera PCC 
7437]
Length=174

 Score =   124 bits (312),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 87/132 (66%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            + +T  +L+L  L  +   VG+ RR   K++ A++H+  +  +W    K KR + FARAT
Sbjct  40   VFSTERDLDLYELEELCDRVGWARRPLRKVKKAIQHSFLVVSMWEIKGKKKRLIGFARAT  99

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVVDP FQ  GLGKA+M+  + KL    I+NI L+++P+V+ FYR LGF
Sbjct  100  SDCAFNATIWDVVVDPDFQSQGLGKAMMKYTIKKLRSADISNITLFADPQVVNFYRRLGF  159

Query  516  VADPDGIRGMVY  551
            + DP+GI+GM +
Sbjct  160  MVDPEGIKGMFW  171



>ref|WP_015188955.1| GCN5-related N-acetyltransferase [Gloeocapsa sp. PCC 7428]
 gb|AFZ31083.1| GCN5-related N-acetyltransferase [Gloeocapsa sp. PCC 7428]
Length=184

 Score =   124 bits (312),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = +3

Query  123  SISDEELQSRGFNLHTTFTN---LNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLW  287
            S S + L+  G      F++   ++L  L  +  AVG+ RR   K++ A++H+   A +W
Sbjct  34   SPSSDRLEKSGEGDRIVFSSEREIDLYELEELCDAVGWSRRPLRKVKKAIQHSFLVASMW  93

Query  288  VEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIA  467
                  +R + FARAT D  FNA IWDVVV PSFQG GLGKA+M+ ++ KL  + I+NI 
Sbjct  94   EVRGTQRRLIGFARATSDHAFNATIWDVVVHPSFQGKGLGKALMKYMIKKLRSEDISNIT  153

Query  468  LYSEPRVLGFYRSLGFVADPDGIRGMVY  551
            L+++P V+ FYR LGF++DP+GI+GM +
Sbjct  154  LFADPHVVDFYRGLGFMSDPEGIKGMFW  181



>ref|WP_006194872.1| N-acetyltransferase [Nodularia spumigena]
 gb|EAW46660.1| GCN5-related N-acetyltransferase [Nodularia spumigena CCY9414]
 gb|AHJ30315.1| N-acetyltransferase (GNAT) family, Ycf52-like protein [Nodularia 
spumigena CCY9414]
Length=183

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  51   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P VL FYR +GF++
Sbjct  111  HAFNATIWDVVVHPDFQGQGLGKALMKYVLKKLRSEEISNVTLFADPHVLDFYRGMGFMS  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_015127207.1| N-acetyltransferase GCN5 [Calothrix sp. PCC 7507]
 gb|AFY31384.1| GCN5-related N-acetyltransferase [Calothrix sp. PCC 7507]
Length=184

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  52   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVATMWQVRGNKRRLIGFARATSD  111

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGK++M+ ++ KL  + I+N+ L+++P V+ FYR++GF+A
Sbjct  112  HAFNATIWDVVVHPDFQGKGLGKSLMKYVLKKLRSEEISNVTLFADPHVVDFYRTMGFMA  171

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  172  DPEGIKGMFW  181



>ref|WP_016879103.1| N-acetyltransferase [Chlorogloeopsis fritschii]
Length=183

 Score =   124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  51   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNQRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYRSLGF++
Sbjct  111  HAFNATIWDVVVHPDFQGKGLGKALMKYVLKKLRGEEISNVTLFADPHVVDFYRSLGFMS  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_019508370.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=174

 Score =   124 bits (310),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            + +T  ++NL  L  +   VG+ RR   K++ A+ H+  +  +W    K +R + FARAT
Sbjct  40   IFSTERDINLYELEELCDRVGWARRPLRKVKKAINHSFLVVSMWEVQGKKRRLIGFARAT  99

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVVDP+FQG GLGKA+M+  +++L  + I+NI L+++P+V+ FY+ LGF
Sbjct  100  SDHAFNATIWDVVVDPNFQGRGLGKAMMKYTISQLRSEDISNITLFADPQVVKFYQRLGF  159

Query  516  VADPDGIRGMVY  551
            + DP+GI+GM +
Sbjct  160  ILDPEGIKGMFW  171



>gb|AFY65651.1| GCN5-related N-acetyltransferase [Geitlerinema sp. PCC 7407]
Length=154

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 90/130 (69%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ A+EH+  +  +W +  + +R + F+RAT D
Sbjct  22   STDREIDLYELEELCDAVGWARRPLRKVKKAIEHSFLVVSMWEQRGERRRLIGFSRATSD  81

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVV+ P+FQG GLGKA+M  ++ KL ++ I+NI L+++P V+ FYR+LGF+ 
Sbjct  82   HAFNATIWDVVIHPNFQGKGLGKALMRHMIKKLRNEDISNITLFADPHVVDFYRTLGFMP  141

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  142  DPEGIKGMFW  151



>ref|NP_053802.1| hypothetical protein PopuCp007 [Porphyra purpurea]
 sp|P51192.1|YCF52_PORPU RecName: Full=Uncharacterized N-acetyltransferase ycf52 (chloroplast) 
[Porphyra purpurea]
 gb|AAC08078.1| ORF174 (chloroplast) [Porphyra purpurea]
Length=174

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV--EHQKAKRPVAFARATGDGVFN  353
            N+NL  L  +  +VG+ +R   K+++AL+H+  ++ +  ++  + R V FARAT D  FN
Sbjct  46   NINLYELEQLCDSVGWVKRPLKKVKIALKHSSIIISLIQKNDSSTRLVGFARATSDNGFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQG+GLGK VM +++ +L    I+ I L++EP V+ FYR LGF+ DPDG
Sbjct  106  ATIWDVVIHPDFQGLGLGKVVMHQLIKQLRQAEISTITLFAEPDVISFYRKLGFIKDPDG  165

Query  534  IRGMVY  551
            ++GM +
Sbjct  166  VKGMFW  171



>ref|WP_041041052.1| acetyltransferase [Tolypothrix campylonemoides]
 gb|KIJ73936.1| acetyltransferase [Tolypothrix campylonemoides VB511288]
Length=183

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  +VG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  51   STERDIDLYELEELCDSVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR+LGF++
Sbjct  111  HAFNATIWDVVVHPEFQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRTLGFMS  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_035159425.1| acetyltransferase [Calothrix sp. 336/3]
 gb|KFB85266.1| acetyltransferase [Calothrix sp. 336/3]
Length=177

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + FARAT D
Sbjct  45   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVATMWQVRGSKKRLIGFARATSD  104

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR LGF++
Sbjct  105  HAFNATIWDVVVHPDFQGNGLGKAMMKYMLRKLRSEEISNVTLFADPHVVDFYRGLGFMS  164

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  165  DPEGIKGMFW  174



>ref|WP_017746697.1| N-acetyltransferase [Scytonema hofmanni]
Length=183

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  +VG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  51   STERDIDLYELEELCDSVGWSRRPLRKVKKAIEHSFLVATMWQVRGNKRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG G GKA+M+ ++ KL  + I+N+ L+++P V+ FYR+LGF+A
Sbjct  111  HAFNATIWDVVVHPEFQGQGCGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRTLGFMA  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_041268286.1| acetyltransferase [Geitlerinema sp. PCC 7407]
Length=174

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 90/130 (69%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ A+EH+  +  +W +  + +R + F+RAT D
Sbjct  42   STDREIDLYELEELCDAVGWARRPLRKVKKAIEHSFLVVSMWEQRGERRRLIGFSRATSD  101

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVV+ P+FQG GLGKA+M  ++ KL ++ I+NI L+++P V+ FYR+LGF+ 
Sbjct  102  HAFNATIWDVVIHPNFQGKGLGKALMRHMIKKLRNEDISNITLFADPHVVDFYRTLGFMP  161

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  162  DPEGIKGMFW  171



>gb|KIJ80973.1| acetyltransferase [Scytonema tolypothrichoides VB-61278]
Length=183

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  +VG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  51   STERDIDLYELEELCDSVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P VL FYR LGF++
Sbjct  111  HAFNATIWDVVVHPDFQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVLDFYRGLGFMS  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_007356742.1| MULTISPECIES: N-acetyltransferase [Kamptonema]
 emb|CBN57544.1| GCN5-related N-acetyltransferase [ [[Oscillatoria] sp. PCC 6506]
Length=183

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            L +T  +++L  L  +  AVG+ RR   K++ A++H+  +  +W      +R + FARAT
Sbjct  49   LFSTDRDIDLYELEELCNAVGWSRRPLRKVKKAIQHSFLVVSMWEMRGAQRRLIGFARAT  108

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA +WDVVV P FQG GLGKA+M+ I+ KL  + I+NI L+++P V+ FYR+LGF
Sbjct  109  SDHAFNATLWDVVVHPEFQGSGLGKALMQYIIKKLRSEDISNITLFADPHVVDFYRNLGF  168

Query  516  VADPDGIRGMVY  551
            ++DP+GI+GM +
Sbjct  169  LSDPEGIKGMFW  180



>ref|WP_013322903.1| N-acetyltransferase [Cyanothece sp. PCC 7822]
 gb|ADN14798.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7822]
Length=174

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ ALEH+  +  +W      +R + FARAT D
Sbjct  42   STEREIDLYELEELCDAVGWARRPLRKVKKALEHSFLVVSMWEVRGNRRRLIGFARATSD  101

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV PSFQ  GLGKA+M+ ++ KL  + I+NI L+++P+V+ FYR LGFV 
Sbjct  102  YAFNATIWDVVVHPSFQNQGLGKALMKYMIKKLRSEDISNITLFADPQVIDFYRRLGFVL  161

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  162  DPEGIKGMFW  171



>ref|WP_012410213.1| N-acetyltransferase [Nostoc punctiforme]
 gb|ACC82242.1| GCN5-related N-acetyltransferase [Nostoc punctiforme PCC 73102]
Length=182

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + FARAT D
Sbjct  50   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNQKRLIGFARATSD  109

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQ  GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR++GF+A
Sbjct  110  HAFNATIWDVVVHPDFQSQGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRTMGFMA  169

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  170  DPEGIKGMFW  179



>ref|WP_017319274.1| N-acetyltransferase [Mastigocladopsis repens]
Length=182

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 92/140 (66%), Gaps = 2/140 (1%)
 Frame = +3

Query  138  ELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKR  311
            E Q     + +T  +++L  L  +  +VG+ RR   K++ A+EH+   A +W      KR
Sbjct  40   EHQQESRIVFSTERDIDLYELEELCDSVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKKR  99

Query  312  PVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVL  491
             + FARAT D  FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+
Sbjct  100  LIGFARATSDHAFNATIWDVVVHPEFQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVV  159

Query  492  GFYRSLGFVADPDGIRGMVY  551
             FY++LGF++DP+GI+GM +
Sbjct  160  DFYQTLGFMSDPEGIKGMFW  179



>ref|WP_029634143.1| acetyltransferase [[Scytonema hofmanni] UTEX B 1581]
Length=183

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARAT  335
            + +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT
Sbjct  49   VFSTERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVATMWQVRGTQRRLIGFARAT  108

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P FQ  GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR++GF
Sbjct  109  SDHAFNATIWDVVVHPDFQAKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRTMGF  168

Query  516  VADPDGIRGMVY  551
            VADP+GI+GM +
Sbjct  169  VADPEGIKGMFW  180



>ref|WP_006103871.1| N-acetyltransferase [Coleofasciculus chthonoplastes]
 gb|EDX73070.1| acetyltransferase, GNAT family [Coleofasciculus chthonoplastes 
PCC 7420]
Length=178

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            L +T    +L  L  +  AVG+ RR   K++ A++++  +  +W +    +R + FARAT
Sbjct  44   LFSTDREFDLYELEELCDAVGWSRRPMRKVRKAIQYSFLVVSMWQQRGNTRRLIGFARAT  103

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P FQG GLGKA+M+  + KL  + I+NI L+++P+V+ FYR +GF
Sbjct  104  SDHAFNATIWDVVVHPQFQGKGLGKALMKYTIKKLRSEDISNITLFADPQVVNFYRQMGF  163

Query  516  VADPDGIRGMVY  551
            +ADP+GI+GM +
Sbjct  164  MADPEGIKGMFW  175



>ref|WP_017310093.1| MULTISPECIES: N-acetyltransferase [Stigonematales]
 gb|KIY13045.1| acetyltransferase [Mastigocladus laminosus UU774]
Length=181

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  49   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKRRLIGFARATSD  108

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQ  GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYRSLGF++
Sbjct  109  HAFNATIWDVVVHPEFQSRGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRSLGFMS  168

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  169  DPEGIKGMFW  178



>ref|WP_015210158.1| acetyltransferase [Cylindrospermum stagnale]
 gb|AFZ26921.1| acetyltransferase [Cylindrospermum stagnale PCC 7417]
Length=183

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + FARAT D
Sbjct  51   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNQKRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGK++M+ ++ KL  + I+N+ L+++P V+ FYR++GF++
Sbjct  111  HAFNATIWDVVVHPDFQGQGLGKSLMKYVLKKLRSEEISNVTLFADPHVVDFYRTMGFMS  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_015180317.1| acetyltransferase [Microcoleus sp. PCC 7113]
 gb|AFZ16153.1| acetyltransferase [Microcoleus sp. PCC 7113]
Length=173

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A++H+  +  +W +    KR + FARAT D
Sbjct  41   STDRDIDLYELEELCDAVGWSRRPMRKVKKAIQHSFLVTSMWQQRGNTKRLIGFARATSD  100

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQ  GLGKA+M+ ++ KL ++ I+NI L+++P V+ FYR +GF+A
Sbjct  101  HAFNATIWDVVVHPDFQTKGLGKALMKYMIRKLRNEDISNITLFADPHVVNFYRRMGFMA  160

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  161  DPEGIKGMFW  170



>ref|WP_017287556.1| N-acetyltransferase [Leptolyngbya boryana]
Length=176

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ A++H+   A +W +    +R V FARAT D
Sbjct  44   STEREIDLYELEELCDAVGWSRRPLRKVKKAIQHSFLVASMWEQRGVQRRLVGFARATSD  103

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+NI L+++P V+ FYR+LGF+ 
Sbjct  104  HAFNATIWDVVVHPDFQGKGLGKALMKFMIKKLRSEDISNITLFADPHVVNFYRNLGFMQ  163

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  164  DPEGIKGMFW  173



>ref|WP_023175216.1| ribosomal-protein-alanine N-acetyltransferase [Gloeobacter kilaueensis]
 gb|AGY59902.1| ribosomal-protein-alanine N-acetyltransferase [Gloeobacter kilaueensis 
JS1]
Length=158

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 95/148 (64%), Gaps = 4/148 (3%)
 Frame = +3

Query  120  FSISDEELQSRGFN--LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVE  293
            F+ SD    S  +N    T+   ++L  L  +  AVG+ RR   K++ A++H+  ++ + 
Sbjct  8    FTGSDSASVSETYNNIFFTSDREIDLYALEELCDAVGWSRRPLRKVKKAIDHSFCVISMY  67

Query  294  HQKA--KRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIA  467
             Q+   K+ + FARAT D  FNA IWDVVV P +QG GLG+A+M+RI+ +L    I+NI 
Sbjct  68   EQRGEFKQLIGFARATSDHAFNATIWDVVVHPEYQGKGLGRALMDRIIAELRAADISNIT  127

Query  468  LYSEPRVLGFYRSLGFVADPDGIRGMVY  551
            L+++P V+ FYR LGF+ DP+GIRGM +
Sbjct  128  LFADPHVVDFYRRLGFIPDPEGIRGMFW  155



>ref|WP_039748238.1| acetyltransferase [Hassallia byssoidea]
 gb|KIF32760.1| acetyltransferase [Hassallia byssoidea VB512170]
Length=183

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARAT  335
            + +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT
Sbjct  49   VFSTERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVATMWQVRGTQRRLIGFARAT  108

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P FQ  GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR++GF
Sbjct  109  SDHAFNATIWDVVVHPDFQAKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRTMGF  168

Query  516  VADPDGIRGMVY  551
            VADP+GI+GM +
Sbjct  169  VADPEGIKGMFW  180



>ref|WP_010994290.1| MULTISPECIES: N-acetyltransferase [Nostocaceae]
 dbj|BAB77637.1| alr0113 [Nostoc sp. PCC 7120]
 gb|ABA21105.1| GCN5-related N-acetyltransferase [Anabaena variabilis ATCC 29413]
Length=183

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  51   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVATMWQVRGNQRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR++GF+ 
Sbjct  111  HAFNATIWDVVVHPDFQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRTMGFMP  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_015137735.1| acetyltransferase [Nostoc sp. PCC 7524]
 gb|AFY47281.1| putative acetyltransferase [Nostoc sp. PCC 7524]
Length=183

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  51   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNQRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR++GF+ 
Sbjct  111  HAFNATIWDVVVHPDFQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRTMGFMP  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_012598838.1| N-acetyltransferase [Cyanothece sp. PCC 7424]
 gb|ACK69893.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7424]
Length=174

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 91/138 (66%), Gaps = 4/138 (3%)
 Frame = +3

Query  144  QSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPV  317
            +SR F   +T   ++L  L  +  AVG+ RR   K++ ALEH+  +  +W      +R +
Sbjct  36   ESRIF--FSTDREIDLYELEELCDAVGWARRPLRKVKKALEHSFLVVSMWEVRGNRRRLI  93

Query  318  AFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGF  497
             FARAT D  FNA IWDVVV PSFQ  GLGKA+M+ ++ KL  + I+NI L+++P+V+ F
Sbjct  94   GFARATSDYAFNATIWDVVVHPSFQNKGLGKALMKYMIKKLRGEDISNITLFADPQVIDF  153

Query  498  YRSLGFVADPDGIRGMVY  551
            YR LGFV DP+GI+GM +
Sbjct  154  YRRLGFVLDPEGIKGMFW  171



>ref|WP_013193107.1| N-acetyltransferase [Trichormus azollae]
 gb|ADI66097.1| GCN5-related N-acetyltransferase ['Nostoc azollae' 0708]
Length=175

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARAT  335
            + +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT
Sbjct  41   VFSTERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKRRLIGFARAT  100

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P FQG G+GKA+M+ ++ KL  + I+N+ L+++P+V+ FYR++GF
Sbjct  101  SDHAFNATIWDVVVHPDFQGQGMGKALMKYVLKKLRSEEISNVTLFADPQVVDFYRTMGF  160

Query  516  VADPDGIRGMVY  551
            + DP+GI+GM +
Sbjct  161  MPDPEGIKGMFW  172



>ref|WP_027846182.1| acetyltransferase [Mastigocoleus testarum]
Length=175

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +L+L  L  +  AVG+ RR   K++ A+EH+  +  +W      +R + FARAT D
Sbjct  43   STGRDLDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVTTMWQVRGNKRRLIGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+ME ++ KL  + I+N+ L+++P V+ FY++LGF+ 
Sbjct  103  RAFNATIWDVVVHPDFQGKGLGKALMEYMLKKLRSEEISNVTLFADPHVVSFYQNLGFMP  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|WP_011142347.1| N-acetyltransferase [Gloeobacter violaceus]
 ref|NP_925297.1| hypothetical protein gvip324 [Gloeobacter violaceus PCC 7421]
 dbj|BAC90292.1| ycf52 [Gloeobacter violaceus PCC 7421]
Length=158

 Score =   121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = +3

Query  123  SISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQK  302
            S S  E+ S  F   +T  +++L  L  +  AVG+ RR   K++ A++H+  ++ +  Q+
Sbjct  13   SASGGEVHSNVF--FSTDRDIDLYALEELCDAVGWSRRPLRKVKKAIDHSFCVISMYEQR  70

Query  303  A--KRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYS  476
               K+ V FARAT D  FNA IWDVVV P FQG GLG+A+M+RIV +L    I+NI L++
Sbjct  71   GDFKQLVGFARATSDHAFNATIWDVVVHPEFQGKGLGRAMMDRIVAELRAADISNITLFA  130

Query  477  EPRVLGFYRSLGFVADPDGIRGMVY  551
            +P V+ FYR LGF+ DP+GI+GM +
Sbjct  131  DPHVVDFYRRLGFIPDPEGIKGMFW  155



>gb|ACA99587.1| acetyltransferase, GNAT family [Synechococcus sp. PCC 7002]
Length=170

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 97/151 (64%), Gaps = 11/151 (7%)
 Frame = +3

Query  123  SISDEELQSRG-----FNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL-  284
             ISD +L+S G     F+L     +L+L  L  +   VG+ RR   K++ A++H+  ++ 
Sbjct  20   QISDSQLESAGQPRIFFSLDR---DLDLYELEELCDQVGWARRPIRKVRKAIQHSFLVVT  76

Query  285  -W-VEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGIT  458
             W V + K +R + FARAT D  FNA +WDVV+ P FQ  GLGK +M+ I+ KL +  I+
Sbjct  77   VWEVRNSKRRRLIGFARATSDCAFNATVWDVVIHPQFQSQGLGKGLMQFIIKKLRESDIS  136

Query  459  NIALYSEPRVLGFYRSLGFVADPDGIRGMVY  551
            NI L+++P+V+ FYR LGF+ DP+GI+GM +
Sbjct  137  NITLFADPQVVEFYRRLGFILDPEGIKGMFW  167



>ref|WP_017654960.1| N-acetyltransferase [Microchaete sp. PCC 7126]
Length=180

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  48   STDRDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVATMWQMRGNHRRLIGFARATSD  107

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR +GF++
Sbjct  108  HAFNATIWDVVVHPDFQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRGMGFMS  167

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  168  DPEGIKGMFW  177



>ref|WP_012629487.1| N-acetyltransferase [Cyanothece sp. PCC 7425]
 gb|ACL46435.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 7425]
Length=178

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 87/126 (69%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFN  353
             ++L  L  +  AVG+ RR   K++ A++H+  +  +W +    +R + F+RAT D  FN
Sbjct  48   EIDLYELEELCDAVGWSRRPLRKVKKAIQHSFVVVTMWEQRGNYRRLIGFSRATSDHAFN  107

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVVV P FQG GLGKA+M++I+ +L ++ I+NI L+++P V+ FYR LGF+ DP+G
Sbjct  108  ATIWDVVVHPEFQGKGLGKALMKQIIKELRNEDISNITLFADPHVVNFYRGLGFMPDPEG  167

Query  534  IRGMVY  551
            I+GM +
Sbjct  168  IKGMFW  173



>ref|WP_030007011.1| MULTISPECIES: acetyltransferase [Synechococcus]
Length=168

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 97/151 (64%), Gaps = 11/151 (7%)
 Frame = +3

Query  123  SISDEELQSRG-----FNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL-  284
             ISD +L+S G     F+L     +L+L  L  +   VG+ RR   K++ A++H+  ++ 
Sbjct  18   QISDSQLESAGQPRIFFSLDR---DLDLYELEELCDQVGWARRPIRKVRKAIQHSFLVVT  74

Query  285  -W-VEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGIT  458
             W V + K +R + FARAT D  FNA +WDVV+ P FQ  GLGK +M+ I+ KL +  I+
Sbjct  75   VWEVRNSKRRRLIGFARATSDCAFNATVWDVVIHPQFQSQGLGKGLMQFIIKKLRESDIS  134

Query  459  NIALYSEPRVLGFYRSLGFVADPDGIRGMVY  551
            NI L+++P+V+ FYR LGF+ DP+GI+GM +
Sbjct  135  NITLFADPQVVEFYRRLGFILDPEGIKGMFW  165



>ref|WP_036003362.1| acetyltransferase [Leptolyngbya sp. JSC-1]
Length=171

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            L +T  +++L  L  +  AVG+ RR   K++ A++H+  +  +W +    +R + F+RAT
Sbjct  37   LFSTDRDIDLYELEELCDAVGWSRRPLRKVKKAIQHSFLVVSMWEQRGTQRRLIGFSRAT  96

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P FQG GLGKA+M +++ +L  + I+NI L+++P V+ FYR LGF
Sbjct  97   SDHAFNATIWDVVVHPDFQGKGLGKALMRQMIKRLRSEDISNITLFADPHVIDFYRGLGF  156

Query  516  VADPDGIRGMVY  551
            + DP+GI+GM +
Sbjct  157  MPDPEGIKGMFW  168



>ref|WP_044105639.1| acetyltransferase [cyanobacterium endosymbiont of Epithemia turgida]
 dbj|BAP17009.1| N-acetyltransferase [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=175

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  ++NL  L  +  AVG+ RR   K++ AL H+  +  +W   +  +R V FARAT D
Sbjct  43   STERDINLYELEELCNAVGWARRPLRKVKQALHHSFIVVSMWEVEKNQRRLVGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVVV PS Q  GLGKA+++ ++ KL +K I+NI L+++P+V+ FYR LGFV 
Sbjct  103  HAFNATVWDVVVHPSCQNKGLGKALIKYMIHKLRNKNISNITLFADPQVIDFYRRLGFVL  162

Query  522  DPDGIRGMVY  551
            +P+GI+GM +
Sbjct  163  EPEGIKGMFW  172



>ref|WP_011611289.1| N-acetyltransferase [Trichodesmium erythraeum]
 gb|ABG50914.1| GCN5-related N-acetyltransferase [Trichodesmium erythraeum IMS101]
Length=183

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 90/138 (65%), Gaps = 2/138 (1%)
 Frame = +3

Query  144  QSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPV  317
            +S G    TT  ++++  L  +  AVG+ RR   K++ A++H+  +  +W      +R +
Sbjct  43   RSNGRIFFTTDRDIDIYELEDLCNAVGWSRRPLRKVKKAIQHSFLVVSMWQMRGSQRRLI  102

Query  318  AFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGF  497
             FARAT D  FNA +WDVVV P FQ  GLGKA+M  I+ KL  + I+NI L+++P V+ F
Sbjct  103  GFARATSDHAFNATLWDVVVHPDFQSKGLGKALMNYIIKKLRSEDISNITLFADPHVVDF  162

Query  498  YRSLGFVADPDGIRGMVY  551
            YR+LGF++DP+GI+GM +
Sbjct  163  YRNLGFISDPEGIKGMFW  180



>ref|WP_039755814.1| MULTISPECIES: acetyltransferase [Synechococcus]
 gb|AJD58663.1| acetyltransferase [Synechococcus sp. UTEX 2973]
Length=182

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L ++  AVG+ RR   K++ AL+++  +  LW +  + +R + FARAT D
Sbjct  50   STRRDIDLQELEALCDAVGWSRRPVRKVRRALDNSFLVVSLWEQLAQQRRLIGFARATSD  109

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVV++PSFQG GLG+ +ME ++ +L    I NI L+++P V+ FYR LGFV 
Sbjct  110  HAFNATIWDVVINPSFQGQGLGRVLMEYVIAQLQQAEIPNITLFADPHVVDFYRRLGFVL  169

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  170  DPEGIKGMFW  179



>ref|WP_026720324.1| acetyltransferase [Fischerella sp. PCC 9431]
Length=181

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARAT  335
            + +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT
Sbjct  47   VFSTERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKRRLIGFARAT  106

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P FQ  GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR+LGF
Sbjct  107  SDHAFNATIWDVVVHPEFQAKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRTLGF  166

Query  516  VADPDGIRGMVY  551
            ++DP+GI+GM +
Sbjct  167  MSDPEGIKGMFW  178



>ref|WP_010467952.1| N-acetyltransferase [Acaryochloris sp. CCMEE 5410]
Length=183

 Score =   122 bits (305),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 93/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFT---NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--L  284
             SIS     S+      TF+    ++L  L  +  AVG+ RR   K++ AL+H+  +  +
Sbjct  30   LSISSNGRGSKSTQSKITFSKDREIDLYELEELCDAVGWSRRPIRKVKKALKHSFIVVSM  89

Query  285  WVEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNI  464
            W +     R + F+RAT D  FNA IWDVVV P FQG GLGKA+M++I+ +L  + I+NI
Sbjct  90   WEQRGSYNRLIGFSRATSDHTFNATIWDVVVHPDFQGQGLGKALMKQIIKELRREDISNI  149

Query  465  ALYSEPRVLGFYRSLGFVADPDGIRGMVY  551
             L+++P V+ FYR LGF+ DP+GI+GM +
Sbjct  150  TLFADPHVVNFYRDLGFMPDPEGIKGMFW  178



>ref|WP_012162317.1| N-acetyltransferase [Acaryochloris marina]
 gb|ABW26807.1| acetyltransferase, gnat family [Acaryochloris marina MBIC11017]
Length=183

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 93/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFT---NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--L  284
             SIS     S+      TF+    ++L  L  +  AVG+ RR   K++ AL+H+  +  +
Sbjct  30   LSISSNGRGSKSAQSKITFSKDREIDLYELEELCDAVGWSRRPIRKVKKALKHSFIVVSM  89

Query  285  WVEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNI  464
            W +     R + F+RAT D  FNA IWDVVV P FQG GLGKA+M++I+ +L  + I+NI
Sbjct  90   WEQRGSYNRLIGFSRATSDHTFNATIWDVVVHPDFQGQGLGKALMKQIIKELRREDISNI  149

Query  465  ALYSEPRVLGFYRSLGFVADPDGIRGMVY  551
             L+++P V+ FYR LGF+ DP+GI+GM +
Sbjct  150  TLFADPHVVNFYRDLGFMPDPEGIKGMFW  178



>ref|WP_016949886.1| N-acetyltransferase [Anabaena sp. PCC 7108]
Length=175

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + FARAT D
Sbjct  43   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNQKRLIGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGK +M+ ++ KL  + I+N+ L+++P V+ FYR++GF+ 
Sbjct  103  HAFNATIWDVVVHPDFQGQGLGKTLMKYVLKKLRSEEISNVTLFADPHVVDFYRTMGFMP  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|WP_008181937.1| N-acetyltransferase [Moorea producens]
 gb|EGJ33560.1| acetyltransferase [Moorea producens 3L]
Length=173

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ A++H+  +  +W +    +R + FARAT D
Sbjct  41   STTREIDLYELEELCDAVGWSRRPLRKVKKAIQHSFLVTSMWYQRGNTRRLIGFARATSD  100

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQ  GLGKA+M  ++ KL  + I+NI L+++P+V+ FYR +GF+ 
Sbjct  101  HAFNATIWDVVVHPDFQAKGLGKALMRYMIKKLRSQDISNITLFADPQVVSFYRKMGFMP  160

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  161  DPEGIKGMFW  170



>gb|KIE13246.1| acetyltransferase [Tolypothrix bouteillei VB521301]
Length=183

 Score =   121 bits (304),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  +VG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  51   STERDIDLYELEELCDSVGWSRRPLRKVKKAIEHSFLVATMWQVRGNKRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG G GKA+M+ ++ KL  + I+N+ L+++P V+ FYR+LGF+ 
Sbjct  111  HAFNATIWDVVVHPEFQGKGCGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRTLGFMP  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_036533010.1| acetyltransferase [Neosynechococcus sphagnicola]
 gb|KGF72760.1| acetyltransferase [Neosynechococcus sphagnicola sy1]
Length=175

 Score =   121 bits (303),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 90/130 (69%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ AL+ +  ++  W +    +R V FARAT D
Sbjct  43   STEREIDLYELEELCDAVGWSRRPMRKVRKALQFSFLVMTIWEQRSSQRRLVGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVV+ P++QG GLGKA+M++++ +L  + I+NI L+++P+V+ FYR LGF++
Sbjct  103  HAFNATIWDVVIHPTYQGKGLGKAMMKQMIKQLRTEDISNITLFADPQVVDFYRGLGFMS  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|WP_028954121.1| hypothetical protein [Synechocystis sp. PCC 7509]
Length=177

 Score =   121 bits (304),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 84/125 (67%), Gaps = 2/125 (2%)
 Frame = +3

Query  183  LNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGDGVFNA  356
            ++L  L  +  AVG+ RR   K++ A+E +   A +W      KR + FARAT D  FNA
Sbjct  50   IDLYELEELCDAVGWSRRPLRKVKKAIEFSFLVASMWEVRGTGKRLIGFARATSDHAFNA  109

Query  357  IIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGI  536
             IWDVVV P FQG GLGKA+M+ ++ KL  + I+N+ L+++P+V+ FYR LGF ADP+GI
Sbjct  110  TIWDVVVHPDFQGKGLGKAMMKYMIKKLRSEDISNVTLFADPQVVDFYRGLGFTADPEGI  169

Query  537  RGMVY  551
            +GM +
Sbjct  170  KGMFW  174



>gb|ABB56805.1| conserved hypothetical protein YCF52 [Synechococcus elongatus 
PCC 7942]
Length=201

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L ++  AVG+ RR   K++ AL+++  +  LW +  + +R + FARAT D
Sbjct  69   STRRDIDLQELEALCDAVGWSRRPVRKVRRALDNSFLVVSLWEQLAQQRRLIGFARATSD  128

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVV++PSFQG GLG+ +ME ++ +L    I NI L+++P V+ FYR LGFV 
Sbjct  129  HAFNATIWDVVINPSFQGQGLGRVLMEYVIAQLQQAEIPNITLFADPHVVDFYRRLGFVL  188

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  189  DPEGIKGMFW  198



>ref|WP_019499145.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=167

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKA--KRPVAFARATGD  341
            +T  N++L  L  +  +VG+ RR   K++ A+EH+  ++ +  Q+    R + FARAT D
Sbjct  35   STDRNIDLYELEELCDSVGWARRPIRKVRKAIEHSFVVITIREQRGSFNRLIGFARATSD  94

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGKA+M+ +V +L    I+NI+L+++  V+ FYR LGF A
Sbjct  95   RAFNATIWDVVVHPEFQGRGLGKALMQEVVKELRRADISNISLFADAHVVDFYRQLGFNA  154

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  155  DPEGIKGMFW  164



>ref|WP_019492439.1| N-acetyltransferase [Calothrix sp. PCC 7103]
Length=182

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  50   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNQRRLIGFARATSD  109

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P +QG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR LGF+ 
Sbjct  110  HAFNATIWDVVVHPDYQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRGLGFMP  169

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  170  DPEGIKGMFW  179



>ref|WP_015112398.1| N-acetyltransferase GCN5 [Nostoc sp. PCC 7107]
 gb|AFY42174.1| GCN5-related N-acetyltransferase [Nostoc sp. PCC 7107]
Length=180

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  48   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNQRRLIGFARATSD  107

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P +QG GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR +GF++
Sbjct  108  HAFNATIWDVVVHPDYQGKGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRGMGFMS  167

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  168  DPEGIKGMFW  177



>ref|WP_009767781.1| putative acetyltransferase [Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ68669.1| putative acetyltransferase [Oscillatoriales cyanobacterium JSC-12]
Length=172

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 96/149 (64%), Gaps = 6/149 (4%)
 Frame = +3

Query  123  SISDEELQSRGFN----LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--L  284
            SIS E +++ G      L +   +++L  L  +  AVG+ RR   K++ A++H+  +  +
Sbjct  21   SISGEAVEASGDRGSQILFSIDRDIDLYELEELCDAVGWSRRPLRKVRKAIQHSFLVVSM  80

Query  285  WVEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNI  464
            W +    +R + F+RAT D  FNA IWDVVV P FQ  GLGKA+M+ ++ KL  + I+NI
Sbjct  81   WEQRGTQRRLIGFSRATSDHAFNATIWDVVVHPDFQSRGLGKALMKYVIKKLRSEDISNI  140

Query  465  ALYSEPRVLGFYRSLGFVADPDGIRGMVY  551
             L+++P V+ FYR LGF++DP+GI+GM +
Sbjct  141  TLFADPHVVDFYRRLGFISDPEGIKGMFW  169



>ref|WP_036479271.1| acetyltransferase [Myxosarcina sp. GI1]
Length=174

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFN  353
            N++L  L  +   VG+ RR   K++ A++H+  +  +W  + + +R + FARAT DG FN
Sbjct  46   NIDLYELEELCDRVGWARRPLRKVKKAIQHSFLVVSMWEINGEKRRLIGFARATSDGAFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVVVDP FQ  GLGKA+M+  + +L    I+NI L+++P V+ FYR LGF+ DP+G
Sbjct  106  ATIWDVVVDPGFQNRGLGKAMMKFTIDRLRKADISNITLFADPHVVDFYRRLGFILDPEG  165

Query  534  IRGMVY  551
            I+GM +
Sbjct  166  IKGMFW  171



>ref|WP_015212802.1| GCN5-related N-acetyltransferase [Anabaena cylindrica]
 gb|AFZ56148.1| GCN5-related N-acetyltransferase [Anabaena cylindrica PCC 7122]
Length=175

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + FARAT D
Sbjct  43   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNHKRLIGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQ  GLGKA+M+ ++ KL  + I+N+ L+++P V+ FYR++GF+ 
Sbjct  103  HAFNATIWDVVVHPDFQSQGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYRTMGFMP  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|WP_027402293.1| acetyltransferase [Aphanizomenon flos-aquae]
Length=175

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + FARAT D
Sbjct  43   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKKRLIGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQ  GLGKA+M+ ++ KL  + I+N+ L+++P V+ FY+++GF++
Sbjct  103  HAFNATIWDVVVHPDFQSRGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYKTMGFMS  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|WP_015079096.1| acyl-CoA N-acyltransferase [Anabaena sp. 90]
 gb|AFW93932.1| acyl-CoA N-acyltransferase [Anabaena sp. 90]
Length=175

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + FARAT D
Sbjct  43   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKKRLIGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQ  GLGKA+M+ ++ KL  + I+N+ L+++P V+ FY+++GF++
Sbjct  103  HAFNATIWDVVVHPDFQSRGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYKTMGFMS  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMYW  172



>ref|WP_006631880.1| N-acetyltransferase [Microcoleus vaginatus]
 gb|EGK89195.1| GCN5-related N-acetyltransferase [Microcoleus vaginatus FGP-2]
Length=183

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFN  353
            +++L  L  +  AVG+ RR   K++ A++H+  +  +W      +R V FARAT D  FN
Sbjct  55   DIDLYELEELCNAVGWSRRPLRKVKKAIQHSFLVVSMWEMRGSQRRLVGFARATSDHAFN  114

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A +WDVVV P +QG G+GKA+M+ I+ KL  + I+NI L+++P+V+ FYR+LGF++DP+G
Sbjct  115  ATLWDVVVHPDYQGKGMGKALMKYIIKKLRSEDISNITLFADPQVVDFYRNLGFMSDPEG  174

Query  534  IRGMVY  551
            I+GM +
Sbjct  175  IKGMFW  180



>ref|WP_039203157.1| acetyltransferase [Aphanizomenon flos-aquae]
 gb|KHG40397.1| acetyltransferase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=175

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + FARAT D
Sbjct  43   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKKRLIGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQ  GLGKA+M+ ++ KL  + I+N+ L+++P V+ FY+++GF++
Sbjct  103  HAFNATIWDVVVHPDFQSRGLGKALMKYVLKKLRSEEISNVTLFADPHVVDFYKTMGFMS  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|WP_015200285.1| N-acetyltransferase GCN5 [Calothrix parietina]
 gb|AFZ03672.1| GCN5-related N-acetyltransferase [Calothrix sp. PCC 6303]
Length=181

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R + FARAT D
Sbjct  49   STEREIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNQRRLIGFARATSD  108

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG G+GKA+M+ ++ KL  + I+N+ L+++P V+ FYR +GF+ 
Sbjct  109  HAFNATIWDVVVHPDFQGKGMGKALMKYMLKKLRSEEISNVTLFADPHVVDFYRGMGFMT  168

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  169  DPEGIKGMFW  178



>ref|WP_039724734.1| MULTISPECIES: acetyltransferase [Oscillatoriophycideae]
 gb|KIF20410.1| acetyltransferase [Aphanocapsa montana BDHKU210001]
 gb|KIF42371.1| acetyltransferase [Lyngbya confervoides BDU141951]
Length=174

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 96/146 (66%), Gaps = 3/146 (2%)
 Frame = +3

Query  123  SISDEELQSRGFNL-HTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVE  293
            ++++   Q RG  +  +T  +++L  L  +  AVG+ RR   K++ A+EH+  +  +W  
Sbjct  26   TLTEVSSQDRGAQIVFSTERDIDLYELEELCDAVGWARRPIRKVRKAIEHSFLVVTMWEV  85

Query  294  HQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALY  473
                +R + F+RAT D  FNA IWDVVV P +QG GLGK +M++++ KL  + I+N+ L+
Sbjct  86   QGNRRRLIGFSRATSDHAFNATIWDVVVHPDYQGKGLGKTLMKQLIKKLRSEDISNVTLF  145

Query  474  SEPRVLGFYRSLGFVADPDGIRGMVY  551
            ++P V+ FYR+LGF+ DP+GI+GM +
Sbjct  146  ADPHVVDFYRNLGFMPDPEGIKGMFW  171



>ref|WP_015117737.1| acetyltransferase [Rivularia sp. PCC 7116]
 gb|AFY54161.1| acetyltransferase [Rivularia sp. PCC 7116]
Length=177

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      +R V FARAT D
Sbjct  45   STERDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVATMWQVRGNRRRLVGFARATSD  104

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P  QG G+GKA+M+ ++ KL  + I+N+ L+++P V+ FYR+LGF++
Sbjct  105  HAFNATIWDVVVHPDVQGKGMGKALMKYVLKKLRSEDISNVTLFADPHVVDFYRNLGFMS  164

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  165  DPEGIKGMFW  174



>ref|WP_006616008.1| N-acetyltransferase [Arthrospira sp. PCC 8005]
 emb|CCE18543.1| GCN5-related N-acetyltransferase [Arthrospira sp. PCC 8005]
 emb|CDM97276.1| GCN5-related N-acetyltransferase [Arthrospira sp. PCC 8005]
Length=167

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A++H+  +  +W      +R + FARAT D
Sbjct  35   STDRDIDLYELEELCNAVGWSRRPLRKVKKAIQHSFLVVSMWQMRGNQRRLIGFARATSD  94

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVVV P FQ  GLGKA+M  I+ KL    I+NI L+++P V+ FYR+LGF++
Sbjct  95   HAFNATLWDVVVHPDFQNKGLGKALMRFIIKKLRSDDISNITLFADPHVVEFYRNLGFIS  154

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  155  DPEGIKGMFW  164



>gb|EAW35113.1| GCN5-related N-acetyltransferase [Lyngbya sp. PCC 8106]
Length=172

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 90/138 (65%), Gaps = 2/138 (1%)
 Frame = +3

Query  144  QSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPV  317
             S G    +T  +++L  L  + +AVG+ RR   K++ A++++  +  +W    K +R +
Sbjct  32   NSNGRIFFSTDRDIDLYELEELCSAVGWSRRPLRKVKKAIQYSFLVVSMWQLQGKQRRLI  91

Query  318  AFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGF  497
             FARAT D  FNA +WDVVV P FQ  GLGKA+M+ I+ KL    I+NI L+++P V+ F
Sbjct  92   GFARATSDHAFNATLWDVVVHPDFQNRGLGKALMKFIIKKLRSDDISNITLFADPHVVDF  151

Query  498  YRSLGFVADPDGIRGMVY  551
            YR+LGF+ DP+GI+GM +
Sbjct  152  YRNLGFIPDPEGIKGMFW  169



>ref|WP_017299606.1| N-acetyltransferase [Nodosilinea nodulosa]
Length=173

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +L+L  L  +  AVG+ RR   K++ A++H+  +  +W +    +R V F+RAT D
Sbjct  41   STDRDLDLYELEELCNAVGWARRPIRKVKKAIQHSYLVVTMWEQRGARRRLVGFSRATSD  100

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGK +M +++ KL  + I+N+ L+++P+V+ FY+ LGF+ 
Sbjct  101  HAFNATIWDVVVHPDFQGRGLGKELMRQLIKKLRSEDISNVTLFADPQVVDFYKGLGFMP  160

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  161  DPEGIKGMFW  170



>ref|WP_040930240.1| acetyltransferase [Prochloron didemni]
Length=175

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T T+++L  L  +   VG+ RR   K++ AL+++  +  +W    K +R + FARAT D
Sbjct  43   STETDIDLYDLEELCDRVGWARRPLRKVRKALQYSFLVVTMWEVRGKRRRLIGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDV +DP FQ  GLGK++M+ ++ KL  + I+NI L+++P+V+ FYR LGF+ 
Sbjct  103  RAFNATIWDVAIDPEFQNQGLGKSLMKYMIKKLRGQDISNITLFADPQVINFYRRLGFML  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|WP_006623763.1| MULTISPECIES: N-acetyltransferase [Arthrospira]
 gb|EDZ96083.1| GCN5-related N-acetyltransferase [Arthrospira maxima CS-328]
 dbj|BAI91849.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|EKD08332.1| GCN5-related N-acetyltransferase [Arthrospira platensis C1]
 gb|KDR55542.1| acetyltransferase [Arthrospira platensis str. Paraca]
Length=182

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A++H+  +  +W      +R + FARAT D
Sbjct  50   STDRDIDLYELEELCNAVGWSRRPLRKVKKAIQHSFLVVSMWQMRGNQRRLIGFARATSD  109

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVVV P FQ  GLGKA+M  I+ KL    I+NI L+++P V+ FYR+LGF++
Sbjct  110  HAFNATLWDVVVHPDFQNKGLGKALMRFIIKKLRSDDISNITLFADPHVVEFYRNLGFIS  169

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  170  DPEGIKGMFW  179



>gb|AFC39862.1| hypothetical protein [Porphyra umbilicalis]
Length=174

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV--EHQKAKRPVAFARATGDGVFN  353
            N+NL  L  +  +VG+ +R   K+++AL+++  ++ +  ++    R V FARAT D  FN
Sbjct  46   NINLYELEQLCDSVGWVKRPLKKVKIALKNSSIIISLIQKNDSDTRLVGFARATSDNGFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQG+GLGK VM +++ +L    I+ I L++EP V+ FYR LGF+ DPDG
Sbjct  106  ATIWDVVIHPDFQGLGLGKVVMHQLIQQLRQAEISTITLFAEPDVISFYRKLGFIRDPDG  165

Query  534  IRGMVY  551
            ++GM +
Sbjct  166  VKGMFW  171



>ref|WP_035986684.1| acetyltransferase [Leptolyngbya sp. KIOST-1]
Length=173

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +L+L  L  +  AVG+ RR   K++ A++H+  +  +W +    +R V F+RAT D
Sbjct  41   STDRDLDLYELEELCNAVGWARRPIRKVKKAIQHSYLVVTMWEQRGARRRLVGFSRATSD  100

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLGK +M +++ KL  + I+N+ L+++P+V+ FY+ LGF+ 
Sbjct  101  HAFNATIWDVVVHPDFQGRGLGKELMRQLIKKLRSEDISNVTLFADPQVVDFYKRLGFMP  160

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  161  DPEGIKGMFW  170



>ref|WP_024545896.1| acetyltransferase [Synechococcus sp. NKBG15041c]
Length=168

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 97/151 (64%), Gaps = 11/151 (7%)
 Frame = +3

Query  123  SISDEELQSRG-----FNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL-  284
             ++D +L+S G     F+L     +L+L  L  +   VG+ RR   K++ A++H+  ++ 
Sbjct  18   QLNDSQLESAGQPRIFFSLDR---DLDLYELEELCDQVGWARRPIRKVRKAIQHSFLVVT  74

Query  285  -W-VEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGIT  458
             W V + K +R + FARAT D  FNA +WDVV+ P FQ  GLGK +M+ I+ KL +  I+
Sbjct  75   VWEVRNDKRRRLIGFARATSDCAFNATVWDVVIHPQFQSQGLGKGLMQFIIKKLRESDIS  134

Query  459  NIALYSEPRVLGFYRSLGFVADPDGIRGMVY  551
            NI L+++P+V+ FYR LGF+ DP+GI+GM +
Sbjct  135  NITLFADPQVVDFYRRLGFILDPEGIKGMFW  165



>ref|WP_017304728.1| N-acetyltransferase [Spirulina subsalsa]
Length=176

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ AL+H+  +  +W +    +R + FARAT D
Sbjct  44   STEREIDLYELEELCDAVGWARRPLRKVRKALQHSFLVVSMWEQRGVRRRLIGFARATSD  103

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV PS+Q  GLGKA+M+  + KL  + I+NI L+++P V+ FYR LGF+ 
Sbjct  104  HAFNATIWDVVVHPSYQSQGLGKALMQYTIKKLRSEDISNITLFADPHVVDFYRRLGFIL  163

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  164  DPEGIKGMFW  173



>ref|WP_039896818.1| acetyltransferase [Lyngbya sp. PCC 8106]
Length=182

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 90/138 (65%), Gaps = 2/138 (1%)
 Frame = +3

Query  144  QSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPV  317
             S G    +T  +++L  L  + +AVG+ RR   K++ A++++  +  +W    K +R +
Sbjct  42   NSNGRIFFSTDRDIDLYELEELCSAVGWSRRPLRKVKKAIQYSFLVVSMWQLQGKQRRLI  101

Query  318  AFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGF  497
             FARAT D  FNA +WDVVV P FQ  GLGKA+M+ I+ KL    I+NI L+++P V+ F
Sbjct  102  GFARATSDHAFNATLWDVVVHPDFQNRGLGKALMKFIIKKLRSDDISNITLFADPHVVDF  161

Query  498  YRSLGFVADPDGIRGMVY  551
            YR+LGF+ DP+GI+GM +
Sbjct  162  YRNLGFIPDPEGIKGMFW  179



>ref|WP_009341982.1| N-acetyltransferase [Raphidiopsis brookii]
 gb|EFA73884.1| GCN5-related N-acetyltransferase [Raphidiopsis brookii D9]
Length=175

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A++H+   A +W      KR + FARAT D
Sbjct  43   STERDIDLYELEELCDAVGWSRRPLRKVKRAIDHSFLVASMWQIGGSKKRLIGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQ  GLGKA+M+ ++ KL ++GI+N+ L+++  V+ FYR++GF++
Sbjct  103  HAFNATIWDVVVHPDFQNQGLGKALMKFVLKKLRNEGISNVTLFADAHVVDFYRTMGFIS  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|WP_017662152.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=175

 Score =   119 bits (298),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 91/138 (66%), Gaps = 4/138 (3%)
 Frame = +3

Query  144  QSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPV  317
            QSR F   +T  N++L  L  +  +VG+ RR   K++ ALE++  +  +W      KR +
Sbjct  37   QSRIF--FSTDRNIDLYELEELCDSVGWARRPLRKVRRALENSFLVVSMWEIRGARKRLI  94

Query  318  AFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGF  497
             FARAT D  FNA +WDV + P FQG GLG+A+M  +++KL  + I+NI L+++P V+ F
Sbjct  95   GFARATSDYAFNATVWDVAIRPEFQGKGLGRALMNYLISKLRREDISNITLFADPHVVDF  154

Query  498  YRSLGFVADPDGIRGMVY  551
            YR LGF++DP+GI+GM +
Sbjct  155  YRGLGFMSDPEGIKGMFW  172



>ref|WP_011432155.1| N-acetyltransferase [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD01496.1| acetyltransferase, GNAT family [Synechococcus sp. JA-2-3B'a(2-13)]
Length=174

 Score =   119 bits (298),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFN  353
            NL+L  L  +  AVG+ RR   K++ AL+H+  +  +W +    +R + FARAT D  FN
Sbjct  46   NLDLYELEELCDAVGWSRRPIHKVRKALQHSFLVVSMWQQRGSYRRLIGFARATSDHAFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVVV P FQG GLGK +ME+++ +L  + I+NI L+++  V+ FY  LGF ADP+G
Sbjct  106  ATIWDVVVHPDFQGRGLGKRLMEKVIHELRARDISNITLFADQGVVSFYERLGFTADPEG  165

Query  534  IRGMVY  551
            I+GM +
Sbjct  166  IKGMFW  171



>ref|YP_063511.1| conserved hypothetical plastid protein [Gracilaria tenuistipitata 
var. liui]
 sp|Q6B949.1|YCF52_GRATL RecName: Full=Uncharacterized N-acetyltransferase ycf52 (chloroplast) 
[Gracilaria tenuistipitata var. liui]
 gb|AAT79586.1| conserved hypothetical plastid protein [Gracilaria tenuistipitata 
var. liui]
Length=182

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 94/142 (66%), Gaps = 5/142 (4%)
 Frame = +3

Query  141  LQSRG--FNLHTTFTN-LNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKA  305
            L+ RG   N++ +F + +NL  L  +  +VG+ RR   K+++A++++   A L+ E  K 
Sbjct  38   LEGRGTIVNVYLSFNSYVNLHDLEKLCDSVGWVRRPLKKVKIAIDNSFVTASLFYEQNKK  97

Query  306  KRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPR  485
            K  + FARAT D  FNA IWDVV+ P FQG GLGK +M +I+ +L  + I  I L+++P+
Sbjct  98   KFLIGFARATSDTSFNATIWDVVIHPDFQGQGLGKMLMAQIIKQLRYEDINTITLFADPQ  157

Query  486  VLGFYRSLGFVADPDGIRGMVY  551
            V+ FY+ LGF+ DPDG++GM +
Sbjct  158  VVNFYKHLGFITDPDGVKGMFW  179



>ref|WP_006528969.1| acetyltransferase [Gloeocapsa sp. PCC 73106]
 gb|ELR98168.1| acetyltransferase [Gloeocapsa sp. PCC 73106]
Length=173

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 93/146 (64%), Gaps = 4/146 (3%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVE  293
            F+  D   QSR   + +T  +++L  L  +   VG+ RR   K++ AL+H+  +  +W  
Sbjct  27   FTTGDIPGQSR--IIFSTERDIDLYELEELCDLVGWARRPLRKVKKALQHSFLIISMWEV  84

Query  294  HQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALY  473
            + K +R + FARAT D  FNA +WDVVV P FQ  GLGKA+M+ ++  L  + I+NI L+
Sbjct  85   NGKKRRLIGFARATSDHAFNATVWDVVVHPDFQSQGLGKAMMKYMIKNLRSQDISNITLF  144

Query  474  SEPRVLGFYRSLGFVADPDGIRGMVY  551
            ++P V+ FYR LGF+ DP+GI+GM +
Sbjct  145  ADPDVIDFYRRLGFILDPEGIKGMFW  170



>ref|WP_023066723.1| acetyltransferase family protein [Lyngbya aestuarii]
 gb|ERT07086.1| acetyltransferase family protein [Lyngbya aestuarii BL J]
Length=182

 Score =   119 bits (298),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 90/138 (65%), Gaps = 2/138 (1%)
 Frame = +3

Query  144  QSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPV  317
             S G    +T  +++L  L  + +AVG+ RR   K++ A++++  +  +W    K +R +
Sbjct  42   NSNGRIFFSTDRDIDLYELEELCSAVGWSRRPLRKVKKAIQYSFLVVSMWQLQGKKRRLI  101

Query  318  AFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGF  497
             FARAT D  FNA +WDVVV P FQ  G+GKA+M+ I+ KL    I+NI L+++P V+ F
Sbjct  102  GFARATSDHAFNATLWDVVVHPDFQNRGMGKALMKFIIKKLRSDDISNITLFADPHVIDF  161

Query  498  YRSLGFVADPDGIRGMVY  551
            YR+LGF+ DP+GI+GM +
Sbjct  162  YRNLGFIPDPEGIKGMFW  179



>ref|WP_008233418.1| N-acetyltransferase (GNAT) family, Syn7942_0773 homolog, Ycf52 
protein [Richelia intracellularis]
 emb|CCH67184.1| N-acetyltransferase (GNAT) family, Syn7942_0773 homolog, Ycf52 
protein [Richelia intracellularis HH01]
Length=175

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            + +T   ++L  L  +  AVG+ RR   K++ A+EH+  +  +W      K  + FARAT
Sbjct  41   IFSTEREIDLYQLEELCDAVGWSRRPLRKVKKAIEHSFLVVSMWQVQNTQKHLIGFARAT  100

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P FQG GLGK +M+ I+ +L  + I+N+ L+++P V+ FY+SLGF
Sbjct  101  SDHAFNATIWDVVVHPKFQGKGLGKVLMQYILKQLRSEEISNVTLFADPDVVEFYQSLGF  160

Query  516  VADPDGIRGMVY  551
            + DP+GI+GM +
Sbjct  161  MPDPEGIKGMFW  172



>ref|WP_008317769.1| acetyltransferase [Leptolyngbya sp. PCC 6406]
Length=174

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ A++H+  +  +W +    KR + F+RAT D
Sbjct  42   STDREIDLYELEELCDAVGWARRPIRKVRKAIQHSFLVVSMWEQRGSRKRLIGFSRATSD  101

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P +QG GLGK +M++++ KL  + I+N+ L+++P V+ FYR+LGF+ 
Sbjct  102  HAFNATIWDVVVHPDYQGKGLGKTLMKQLIKKLRSEDISNVTLFADPHVVDFYRTLGFMP  161

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  162  DPEGIKGMFW  171



>gb|AJH66055.1| hypothetical protein [Vertebrata lanosa]
Length=176

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 83/125 (66%), Gaps = 2/125 (2%)
 Frame = +3

Query  183  LNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGDGVFNA  356
            +NL+ L  +  AVG+ RR   K++ ALE++     ++    K +R + FAR T DG FNA
Sbjct  49   VNLEKLEKLCDAVGWVRRPLKKVKFALENSFLTISMFCYEGKNERLIGFARVTSDGSFNA  108

Query  357  IIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGI  536
             IWDVV+ P FQG GLGK +M  ++ +L +  I+ I L+++P V+ FY+++GF+ DPDG+
Sbjct  109  TIWDVVIHPEFQGNGLGKLLMNEVIKELREYDISTITLFADPEVIKFYKNVGFIIDPDGV  168

Query  537  RGMVY  551
            +GM +
Sbjct  169  KGMFW  173



>ref|WP_017713970.1| hypothetical protein [Prochlorothrix hollandica]
Length=182

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 92/143 (64%), Gaps = 4/143 (3%)
 Frame = +3

Query  129  SDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQK  302
            SD    SR F   +T   L+L  L  + ++VG+ RR   K++ AL+++  +  +W +  K
Sbjct  39   SDAATDSRIF--FSTDRTLDLYELEELCSSVGWSRRPLRKVRKALQNSFLVVSMWEQRGK  96

Query  303  AKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEP  482
             +R + FARAT D  FNA IWDVVV PS QG GLGKA+M+  + KL ++ I+NI L+++P
Sbjct  97   RRRLIGFARATSDHAFNATIWDVVVRPSSQGQGLGKALMQHTIKKLRNEDISNITLFADP  156

Query  483  RVLGFYRSLGFVADPDGIRGMVY  551
             V+ FY  LGF  DP+GI+GM +
Sbjct  157  HVVQFYEGLGFNPDPEGIKGMFW  179



>ref|WP_015126285.1| acetyltransferase [Synechococcus sp. PCC 6312]
 gb|AFY62748.1| putative acetyltransferase [Synechococcus sp. PCC 6312]
Length=178

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 85/125 (68%), Gaps = 2/125 (2%)
 Frame = +3

Query  183  LNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFNA  356
            +++  L  +  AVG+ RR   K++ A+EH+  +  +W +    +R + F+RAT D  FNA
Sbjct  49   IDVQELEELCDAVGWSRRPLRKVKKAIEHSFIVVSMWEQRGSYRRLIGFSRATSDHAFNA  108

Query  357  IIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGI  536
             IWDVVV P FQ  GLGKA+M++I+ +L  + I+NI L+++P V+ FYR+LGF  DP+GI
Sbjct  109  TIWDVVVHPQFQQRGLGKALMQQIIKELRREDISNITLFADPGVVNFYRNLGFRPDPEGI  168

Query  537  RGMVY  551
            +GM +
Sbjct  169  KGMFW  173



>ref|WP_026222152.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=169

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            + +T   ++L  L  +  AVG+ RR   K++ AL H+  +  +W +    +R + FARAT
Sbjct  35   IFSTDREIDLYELEELCDAVGWARRPLKKVKKALHHSFLVVSMWEDRGAKRRLIGFARAT  94

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P +Q  GLGKA+M+  + KL  + I+NI L+++P+V+ FYR LGF
Sbjct  95   SDCAFNATIWDVVVHPEYQSRGLGKALMKFTIKKLKSEDISNITLFADPQVIDFYRRLGF  154

Query  516  VADPDGIRGMVY  551
            + DP+GI+GM +
Sbjct  155  MLDPEGIKGMFW  166



>ref|WP_015176063.1| GCN5-related N-acetyltransferase [Oscillatoria nigro-viridis]
 gb|AFZ06763.1| GCN5-related N-acetyltransferase [Oscillatoria nigro-viridis 
PCC 7112]
Length=183

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 86/126 (68%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFN  353
            +++L  L  +  AVG+ RR   K++ A+ H+  +  +W      +R V FARAT D  FN
Sbjct  55   DIDLYELEELCNAVGWSRRPLRKVKKAIVHSFLVVSMWEMRGSQRRLVGFARATSDHAFN  114

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A +WDVVV P +QG G+GKA+M+ I+ KL  + I+NI L+++P V+ FYR+LGF+ADP+G
Sbjct  115  ATLWDVVVHPDYQGKGMGKALMKYIIKKLRSEDISNITLFADPHVVDFYRNLGFMADPEG  174

Query  534  IRGMVY  551
            I+GM +
Sbjct  175  IKGMFW  180



>ref|WP_006511245.1| putative acetyltransferase [Xenococcus sp. PCC 7305]
 gb|ELS01689.1| putative acetyltransferase [Xenococcus sp. PCC 7305]
Length=178

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 87/132 (66%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            + +T  ++++  L  +   VG+ RR   K++ A++++  +  +W    K +R + FARAT
Sbjct  44   MFSTERDIDIYELEELCDRVGWARRPLRKVRKAIQNSFLVVSMWEIKGKRRRLIGFARAT  103

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVVDP FQ  GLGKA+M+  + KL    I+NI L+++P+V+ FYR LGF
Sbjct  104  SDCAFNATIWDVVVDPGFQNQGLGKAMMKYTIKKLRTADISNITLFADPQVVNFYRRLGF  163

Query  516  VADPDGIRGMVY  551
            + DP+GI+GM +
Sbjct  164  LVDPEGIKGMFW  175



>ref|YP_009019519.1| hypothetical protein (chloroplast) [Gracilaria salicornia]
 gb|AHH24487.1| hypothetical protein (chloroplast) [Gracilaria salicornia]
Length=181

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 85/125 (68%), Gaps = 2/125 (2%)
 Frame = +3

Query  183  LNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGDGVFNA  356
            +NL  L  +  +VG+ RR   K++ A++++     L+ EH K K  + FARAT D  FNA
Sbjct  54   INLYELEKLCDSVGWVRRPLKKVKTAIDNSFLTVSLFYEHNKRKFLIGFARATSDTSFNA  113

Query  357  IIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGI  536
             IWDVV+ P FQG GLGK +M++I+ +L  + I+ I L+++P+V+ FY+ LGF+ DPDG+
Sbjct  114  TIWDVVIHPEFQGQGLGKILMDQIIKQLRYEDISTITLFADPQVVSFYKHLGFITDPDGV  173

Query  537  RGMVY  551
            +GM +
Sbjct  174  KGMFW  178



>ref|WP_017327555.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=178

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFN  353
            +++L  L  +  AVG+ RR   K++ A++H+  +  +W E    +R + FARAT D  FN
Sbjct  49   DIDLYELEELCDAVGWARRPIRKVKKAIQHSFLVVTMWREQGNYRRLIGFARATSDHTFN  108

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A +WDVV+ P +Q  GLGKA+M+R++  L  + I+NI L+++P V+GFY  LGF  DPDG
Sbjct  109  ATVWDVVLHPDYQNKGLGKALMQRVIDDLRSQDISNITLFADPDVVGFYEHLGFNPDPDG  168

Query  534  IRGMVY  551
            I+GM +
Sbjct  169  IKGMFW  174



>ref|YP_007947720.1| hypothetical protein 174 (chloroplast) [Pyropia haitanensis]
 gb|AGG36969.1| hypothetical protein 174 (chloroplast) [Pyropia haitanensis]
Length=174

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQK--AKRPVAFARATGDGVFN  353
            N+NL  L  +  +VG+ +R   K+++AL+++  ++ +  +K    + V FARAT D  FN
Sbjct  46   NINLYELEQLCDSVGWVKRPLKKVKIALKNSSIIISLIQKKDTNTKLVGFARATSDNGFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQG+GLGK V+ +++ +L    I+ I L++EP V+ FY+ LGF+ DPDG
Sbjct  106  ATIWDVVIHPDFQGLGLGKVVIHQLIKQLRQAEISTITLFAEPDVVSFYKKLGFIKDPDG  165

Query  534  IRGMVY  551
            ++GM +
Sbjct  166  VKGMFW  171



>ref|WP_011057519.1| N-acetyltransferase [Thermosynechococcus elongatus]
 ref|NP_682472.1| hypothetical protein tlr1682 [Thermosynechococcus elongatus BP-1]
 dbj|BAC09234.1| ycf52 [Thermosynechococcus elongatus BP-1]
Length=174

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFN  353
            ++++  L  +  AVG+ RR   K++ A++H+  +  +W +    +R + F+RAT D  FN
Sbjct  44   DIDVYELEELCDAVGWSRRPIRKVKKAIQHSFLVISMWEQRGAYRRLIGFSRATSDHAFN  103

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVVV P FQG GLGK +M +I+ +L  + I+NI L+++P V+ FYR LGF  DP+G
Sbjct  104  ATIWDVVVHPEFQGRGLGKELMRQIIKELRSEDISNITLFADPHVVDFYRQLGFRPDPEG  163

Query  534  IRGMVY  551
            I+GM +
Sbjct  164  IKGMFW  169



>ref|WP_006454532.1| N-acetyltransferase [Synechococcus sp. PCC 7335]
 gb|EDX84786.1| acetyltransferase, GNAT family [Synechococcus sp. PCC 7335]
Length=172

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ A++++  +  +W +    KR + F+RAT D
Sbjct  40   STDRTIDLYELEELCDAVGWSRRPIRKVRKAIQNSFLVITMWEQKGNRKRLIGFSRATSD  99

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P FQG GLG+A+M++++ KL  + I+N+ L+++P V+ FY+ LGF+ 
Sbjct  100  HAFNATIWDVVVHPEFQGKGLGRALMKQLIKKLRSEDISNVTLFADPDVVNFYKQLGFMP  159

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  160  DPEGIKGMFW  169



>ref|YP_009027476.1| hypothetical chloroplast protein 174 [Pyropia perforata]
 gb|AGQ17034.1| hypothetical chloroplast protein 174 [Pyropia perforata]
 gb|AHB34970.1| hypothetical chloroplast protein 174 (chloroplast) [Pyropia perforata]
 gb|AHB35179.1| hypothetical chloroplast protein 174 (chloroplast) [Pyropia perforata]
 gb|AIA19341.1| hypothetical protein [Pyropia perforata]
 gb|AIA19550.1| hypothetical protein [Pyropia perforata]
 gb|AIA19759.1| hypothetical protein [Pyropia perforata]
 gb|AIA19968.1| hypothetical protein [Pyropia perforata]
 gb|AIA20177.1| hypothetical protein [Pyropia perforata]
 gb|AIA20386.1| hypothetical protein [Pyropia perforata]
 gb|AIA20804.1| hypothetical protein [Pyropia perforata]
 gb|AIA21013.1| hypothetical protein [Pyropia perforata]
Length=174

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQK--AKRPVAFARATGDGVFN  353
            N+NL  L  +  +VG+ +R   K+++AL+++  ++ +  +K    + V FARAT D  FN
Sbjct  46   NINLYELEQLCDSVGWVKRPLKKVKIALKNSSIIISLVEKKDTNTKLVGFARATSDNGFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQG+GLGK V+ +++ +L    I+ I L++EP V+ FY+ LGF+ DPDG
Sbjct  106  ATIWDVVIHPDFQGLGLGKVVIHQLIQQLRQAEISTITLFAEPDVVSFYKKLGFIKDPDG  165

Query  534  IRGMVY  551
            ++GM +
Sbjct  166  VKGMFW  171



>ref|YP_536873.1| hypothetical protein 174 [Pyropia yezoensis]
 sp|Q1XDU5.1|YCF52_PYRYE RecName: Full=Uncharacterized N-acetyltransferase ycf52 (chloroplast) 
[Pyropia yezoensis]
 dbj|BAE92316.1| unnamed protein product [Pyropia yezoensis]
 gb|AGH27516.1| hypothetical protein 174 (chloroplast) [Pyropia yezoensis]
Length=174

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQK--AKRPVAFARATGDGVFN  353
            N+NL  L  +  +VG+ +R   K+++AL+++  ++ +  +K    + V FARAT D  FN
Sbjct  46   NINLYELEQLCDSVGWVKRPLKKVKIALKNSSIIISLIQKKDANSKLVGFARATSDNGFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQG+GLGK V+ +++ +L    I+ I L++EP V+ FY+ LGF+ DPDG
Sbjct  106  ATIWDVVIHPDFQGLGLGKVVIHQLIQQLRQAEISTITLFAEPDVVSFYKKLGFIKDPDG  165

Query  534  IRGMVY  551
            ++GM +
Sbjct  166  VKGMFW  171



>ref|WP_028083485.1| acetyltransferase [Dolichospermum circinale]
Length=175

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 89/136 (65%), Gaps = 2/136 (1%)
 Frame = +3

Query  150  RGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAF  323
            +G  + +T  +++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + F
Sbjct  37   KGQIIFSTEKDIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGNKKRLIGF  96

Query  324  ARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYR  503
            ARAT D  FNA IWDVV+ P FQ  GLGKA+M+ ++ KL  + I+N+ L+++  V+ FY+
Sbjct  97   ARATSDHAFNATIWDVVIHPDFQSRGLGKALMKYVLKKLRSEEISNVTLFADAHVVDFYK  156

Query  504  SLGFVADPDGIRGMVY  551
            ++GF+ DP+GI+GM +
Sbjct  157  TMGFMPDPEGIKGMFW  172



>ref|WP_024124731.1| N-acetyltransferase GNAT family Ycf52 [Thermosynechococcus sp. 
NK55a]
 gb|AHB88329.1| N-acetyltransferase GNAT family Ycf52 [Thermosynechococcus sp. 
NK55a]
Length=174

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFN  353
            ++++  L  +  AVG+ RR   K++ A++H+  +  +W +    +R + F+RAT D  FN
Sbjct  44   DIDVYELEELCDAVGWSRRPIRKVKKAIQHSFLVISMWEQRGAYRRLIGFSRATSDHAFN  103

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVVV P FQG GLGK +M +I+ +L  + I+NI L+++P V+ FYR LGF  DP+G
Sbjct  104  ATIWDVVVHPEFQGRGLGKELMRQIIKELRSEDISNITLFADPHVVDFYRQLGFRPDPEG  163

Query  534  IRGMVY  551
            I+GM +
Sbjct  164  IKGMFW  169



>ref|WP_010873901.1| N-acetyltransferase [Synechocystis sp. PCC 6803]
 ref|NP_442603.1| hypothetical protein sll0286 [Synechocystis sp. PCC 6803]
 sp|Q55911.1|YC52L_SYNY3 RecName: Full=Uncharacterized N-acetyltransferase ycf52-like 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAA10674.1| sll0286 [Synechocystis sp. PCC 6803]
 dbj|BAK51459.1| hypothetical protein SYNGTS_2711 [Synechocystis sp. PCC 6803]
 dbj|BAL30457.1| hypothetical protein SYNGTI_2710 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL33626.1| hypothetical protein SYNPCCN_2709 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL36795.1| hypothetical protein SYNPCCP_2709 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM53729.1| hypothetical protein BEST7613_4798 [Synechocystis sp. PCC 6803]
 gb|AGF52965.1| hypothetical protein MYO_127370 [Synechocystis sp. PCC 6803]
Length=171

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 85/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            TT  +++L  L  +  AVG+ RR   K++ A+E +  +  +W      +R V FARAT D
Sbjct  39   TTERDIDLYELEELCDAVGWARRPIRKVKKAVECSFLVVTMWEMQGNRRRLVGFARATSD  98

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVV+ PS Q  GLGKA+M+ I+ KL    I+NI L+++P+V+ FYR LGFV 
Sbjct  99   HAFNATVWDVVIHPSLQSKGLGKALMQYIIRKLRHYDISNITLFADPQVVDFYRRLGFVL  158

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  159  DPEGIKGMFW  168



>ref|WP_009627612.1| GCN5-related N-acetyltransferase [Pseudanabaena biceps]
 gb|ELS32278.1| GCN5-related N-acetyltransferase [Pseudanabaena biceps PCC 7429]
Length=165

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  +VG+ RR   K+++AL+H+  +L  W      +R + FARAT D
Sbjct  34   STEKDIDLYELEELCDSVGWARRPIRKVRIALQHSFVVLSMWEHRGGFRRLIGFARATSD  93

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVV+ P FQG GLGKA+ME ++ +L    I+NI+L+++  V+ FY  LGF A
Sbjct  94   YAFNATLWDVVIHPDFQGRGLGKAMMEEMIRELRKSDISNISLFADAHVVEFYSQLGFNA  153

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  154  DPEGIKGMFW  163



>ref|WP_037217166.1| acetyltransferase [Richelia intracellularis]
Length=174

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + FARAT D
Sbjct  42   STEREIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGTQKRLIGFARATSD  101

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P +Q  GLGKA+M+ ++ +L  + I+N+ L+++P V+ FY+ LGF++
Sbjct  102  HAFNATIWDVVVHPEYQSKGLGKALMKYVLKQLRTEEISNVTLFADPHVVEFYQGLGFMS  161

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  162  DPEGIKGMFW  171



>gb|AIA20595.1| hypothetical protein [Pyropia perforata]
Length=174

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL-WVEHQKAK-RPVAFARATGDGVFN  353
            N+NL  L  +  +VG+ +R   K+++AL+++  ++  VE +    + V FARAT D  FN
Sbjct  46   NINLYELEQLCDSVGWVKRPLKKVKIALKNSSIIISLVEKEDTNTKLVGFARATSDNGFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQG+GLGK V+ +++ +L    I+ I L++EP V+ FY+ LGF+ DPDG
Sbjct  106  ATIWDVVIHPDFQGLGLGKVVIHQLIQQLRQAEISTITLFAEPDVVSFYKKLGFIKDPDG  165

Query  534  IRGMVY  551
            ++GM +
Sbjct  166  VKGMFW  171



>emb|CDN11012.1| N-acetyltransferase (GNAT) family, Syn7942_0773 homolog, Ycf52 
protein [Richelia intracellularis]
Length=182

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 86/130 (66%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  AVG+ RR   K++ A+EH+   A +W      KR + FARAT D
Sbjct  50   STEREIDLYELEELCDAVGWSRRPLRKVKKAIEHSFLVASMWQVRGTQKRLIGFARATSD  109

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P +Q  GLGKA+M+ ++ +L  + I+N+ L+++P V+ FY+ LGF++
Sbjct  110  HAFNATIWDVVVHPEYQSKGLGKALMKYVLKQLRTEEISNVTLFADPHVVEFYQGLGFMS  169

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  170  DPEGIKGMFW  179



>ref|WP_015227833.1| N-acetyltransferase GCN5 [Halothece sp. PCC 7418]
 gb|AFZ45963.1| GCN5-related N-acetyltransferase [Halothece sp. PCC 7418]
Length=174

 Score =   116 bits (290),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARAT  335
            L +T  +++L  L  +  AVG+ RR   K++ A++H+  +  +W E   ++R + FARAT
Sbjct  40   LFSTTRSIDLYELEELCDAVGWSRRPLRKVRKAMQHSFLVVSMWEEKGASRRLIGFARAT  99

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P  QG GLGKA+M  ++ +L  + I+NI L+++  V+ FY  LGF
Sbjct  100  SDHAFNATIWDVVVHPQAQGKGLGKALMNYMIKRLRQEDISNITLFADAGVVQFYNRLGF  159

Query  516  VADPDGIRGMVY  551
            V DP+GI+GM +
Sbjct  160  VPDPEGIKGMFW  171



>ref|WP_017718718.1| N-acetyltransferase [Oscillatoria sp. PCC 10802]
Length=183

 Score =   116 bits (291),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            TT  +++L  L  +  AVG+ RR   K++ A++++  +  +W +    +R + FARAT D
Sbjct  51   TTDRDIDLYELEELCDAVGWSRRPLRKVRKAIQYSFLVVSMWEQRGAKRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVVV P  QG GLGKA+M+ ++ KL  + I+NI L+++P V+ FYR+LGF+ 
Sbjct  111  HAFNATLWDVVVHPDCQGKGLGKAMMKFLIKKLRSEDISNITLFADPHVVDFYRNLGFMP  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>gb|KEI68973.1| N-acetyltransferase ycf52 [Planktothrix agardhii NIVA-CYA 126/8]
Length=177

 Score =   116 bits (290),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A++++  +  +W      +R + FARAT D
Sbjct  45   STDRDIDLYELEELCNAVGWSRRPLRKVKKAIQYSFLVVSMWQIRGNQRRLIGFARATSD  104

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVVV P FQ  G+GKA+M+ I+ KL    I+NI L+++P V+ FYR+LGF++
Sbjct  105  HAFNATLWDVVVHPDFQNKGMGKALMKFIIKKLRSDDISNITLFADPHVVDFYRNLGFIS  164

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  165  DPEGIKGMFW  174



>ref|WP_011430988.1| N-acetyltransferase [Synechococcus sp. JA-3-3Ab]
 gb|ABD00314.1| acetyltransferase, GNAT family [Synechococcus sp. JA-3-3Ab]
Length=174

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFN  353
            NL+L  L  +  AVG+ RR   K++ AL+H+  +  +W +    +R + FARAT D  FN
Sbjct  46   NLDLYELEELCDAVGWSRRPIHKVRKALQHSFLVVSMWQQRGSYRRLIGFARATSDHAFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVVV P FQG GLG+ +ME+++ +L  + I+NI L+++  V+ FY  LGF  DP+G
Sbjct  106  ATIWDVVVHPEFQGRGLGRRLMEKVIHELRAQDISNITLFADRDVVSFYERLGFTPDPEG  165

Query  534  IRGMVY  551
            I+GM +
Sbjct  166  IKGMFW  171



>gb|AIA21222.1| hypothetical protein [Pyropia kanakaensis]
Length=174

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 85/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQK--AKRPVAFARATGDGVFN  353
            N+NL  L  +  +VG+ +R   K+++AL+++  ++ +  +K    + V FARAT D  FN
Sbjct  46   NVNLYELEQLCDSVGWVKRPLKKVKIALKNSSIIISLIQKKDANTKLVGFARATSDNGFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQG+GLGK V+ +++ +L    I+ I L++EP V+ FY+ LGF+ DPDG
Sbjct  106  ATIWDVVIHPDFQGLGLGKVVVHQLIKQLRQAEISTITLFAEPDVVSFYKKLGFIKDPDG  165

Query  534  IRGMVY  551
            ++GM +
Sbjct  166  VKGMFW  171



>ref|WP_015144247.1| acetyltransferase [Pleurocapsa minor]
 gb|AFY77945.1| putative acetyltransferase [Pleurocapsa sp. PCC 7327]
Length=174

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 92/147 (63%), Gaps = 5/147 (3%)
 Frame = +3

Query  120  FSISDEEL-QSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWV  290
              ++D+ L QSR   + +T  +L+L  L  +  AVG+ RR   K++ ALE +  +  +W 
Sbjct  27   LELTDDPLSQSR--IVFSTERDLDLYELEELCDAVGWARRPLRKVKKALECSYLVVSMWE  84

Query  291  EHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIAL  470
                 +R + FARAT D  FNA IWDVVV P+ Q  GLGKA+M+  + KL    I+NI L
Sbjct  85   VRNNRRRLIGFARATSDHAFNATIWDVVVHPTVQKQGLGKALMKYTIKKLRSDDISNITL  144

Query  471  YSEPRVLGFYRSLGFVADPDGIRGMVY  551
            +++P V+ FYR LGFV DP+GI+GM +
Sbjct  145  FADPHVVDFYRRLGFVLDPEGIKGMFW  171



>ref|WP_042156520.1| acetyltransferase [Planktothrix agardhii]
Length=183

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A++++  +  +W      +R + FARAT D
Sbjct  51   STDRDIDLYELEELCNAVGWSRRPLRKVKKAIQYSFLVVSMWQIRGNQRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVVV P FQ  G+GKA+M+ I+ KL    I+NI L+++P V+ FYR+LGF++
Sbjct  111  HAFNATLWDVVVHPDFQNKGMGKALMKFIIKKLRSDDISNITLFADPHVVDFYRNLGFIS  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_015134874.1| N-acetyltransferase GCN5 [Leptolyngbya sp. PCC 7376]
 gb|AFY39122.1| GCN5-related N-acetyltransferase [Leptolyngbya sp. PCC 7376]
Length=169

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 85/127 (67%), Gaps = 3/127 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--W-VEHQKAKRPVAFARATGDGVF  350
            +++L  L  +   VG+ RR   K++ A++H+  ++  W V +   KR + FARAT D  F
Sbjct  40   DIDLYELEELCDKVGWARRPIRKVRKAIQHSFLVVTVWEVRNANRKRLIGFARATSDCAF  99

Query  351  NAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPD  530
            NA +WDVV+ P FQ  GLGK +M+ I+ KL +  I+NI L+++P+V+ FYR LGF+ DP+
Sbjct  100  NATVWDVVIHPEFQSKGLGKGLMKFIIKKLRESDISNITLFADPQVVEFYRRLGFILDPE  159

Query  531  GIRGMVY  551
            GI+GM +
Sbjct  160  GIKGMFW  166



>gb|AJO68352.1| hypothetical protein (chloroplast) [Gracilariopsis lemaneiformis]
Length=179

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 85/127 (67%), Gaps = 2/127 (2%)
 Frame = +3

Query  177  TNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGDGVF  350
            +++NL  L  +  +VG+ RR   K+++A++++     ++ E+ K K  + FARAT D  F
Sbjct  50   SHINLYDLEKLCDSVGWIRRPLKKVKIAIDNSFLTVSIFYEYNKQKYLIGFARATSDTSF  109

Query  351  NAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPD  530
            NA IWDVV+ P FQG GLGK +M +I+  L    I+ I L+++P+V+ FY+ LGFV DPD
Sbjct  110  NATIWDVVIHPDFQGKGLGKILMHQIIKYLRYSDISTITLFADPQVVSFYKQLGFVTDPD  169

Query  531  GIRGMVY  551
            G++GM +
Sbjct  170  GVKGMFW  176



>gb|KIZ07104.1| putative acetyltransferase NSI [Monoraphidium neglectum]
Length=151

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 80/131 (61%), Gaps = 6/131 (5%)
 Frame = +3

Query  120  FSISDEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQ  299
             S SD E    G    ++   + +  LN +F  VGFPRRD  ++++AL++T  L+WV   
Sbjct  19   ISKSDHEFLQMGLEFMSSRDGIRVSELNELFDKVGFPRRDPERLKVALDNTHRLVWVRAT  78

Query  300  KAKRP------VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITN  461
            K  R       + FARAT DGVF A IWDV V P++Q +GLG+A+MER+   L++ GI N
Sbjct  79   KQSRVARLGQLLGFARATSDGVFTATIWDVAVAPAWQRVGLGRAMMERLTRGLVEDGIPN  138

Query  462  IALYSEPRVLG  494
            I LY+EP+ + 
Sbjct  139  ITLYAEPQTIA  149



>ref|WP_015167438.1| acetyltransferase [Synechococcus sp. PCC 7502]
 gb|AFY72779.1| putative acetyltransferase [Synechococcus sp. PCC 7502]
Length=176

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKA--KRPVAFARAT  335
            L ++  +L+L  L  +  +VG+ RR   K+++A+EH+  ++ + H+K   KR + FARAT
Sbjct  41   LFSSDRDLDLYELEELCDSVGWSRRPIRKVRIAIEHSFVVVTMWHKKGSFKRLIGFARAT  100

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA +WDVVV P FQG GLGK +M  ++  L  + I+NI+L+++  V+ FY+ LGF
Sbjct  101  SDHAFNATVWDVVVHPEFQGRGLGKELMREVIYLLRKEDISNISLFADGHVVTFYQQLGF  160

Query  516  VADPDGIRGMVY  551
              DP+GI+GM +
Sbjct  161  SPDPEGIKGMFW  172



>ref|WP_006276008.1| N-acetyltransferase [Cylindrospermopsis raciborskii]
 gb|EFA71047.1| GCN5-related N-acetyltransferase [Cylindrospermopsis raciborskii 
CS-505]
Length=172

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 88/132 (67%), Gaps = 2/132 (2%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARAT  335
            + +T  +++L  L  +  AVG+ RR   K++ A++H+   A +W      KR + FARAT
Sbjct  39   VFSTERDIDLYELEELCDAVGWSRRPLRKVKRAIDHSFLVASMWQIGGSKKRLIGFARAT  98

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDVVV P FQ  GLGKA+M+ ++ KL ++ I+N+ L+++  V+ FYR++GF
Sbjct  99   SDHAFNATIWDVVVHPDFQNQGLGKALMKFVLKKLRNEEISNVTLFADAHVVDFYRTMGF  158

Query  516  VADPDGIRGMVY  551
            + DP+GI+GM +
Sbjct  159  IPDPEGIKGMFW  170



>ref|WP_026797328.1| acetyltransferase [Planktothrix prolifica]
Length=183

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A++++  +  +W      +R + FARAT D
Sbjct  51   STDRDIDLYELEELCNAVGWSRRPLRKVKKAIQYSFLVVSMWQIRGNQRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVVV P FQ  G+GKA+M+ I+ KL    I+NI L+++P V+ FYR+LGF++
Sbjct  111  HAFNATLWDVVVHPDFQNKGMGKALMKFIIKKLRSDDISNITLFADPHVVDFYRNLGFIS  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_026787559.1| MULTISPECIES: acetyltransferase [Planktothrix]
Length=183

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A++++  +  +W      +R + FARAT D
Sbjct  51   STDRDIDLYELEELCNAVGWSRRPLRKVKKAIQYSFLVVSMWQIRGNQRRLIGFARATSD  110

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVVV P FQ  G+GKA+M+ I+ KL    I+NI L+++P V+ FYR+LGF++
Sbjct  111  HAFNATLWDVVVHPDFQNKGMGKALMKFIIKKLRSDDISNITLFADPHVVDFYRNLGFIS  170

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  171  DPEGIKGMFW  180



>ref|WP_028947784.1| acetyltransferase [Synechocystis sp. PCC 6714]
 gb|AIE74771.1| N-acetyltransferase (GNAT) family [Synechocystis sp. PCC 6714]
Length=171

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 86/138 (62%), Gaps = 2/138 (1%)
 Frame = +3

Query  144  QSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPV  317
              +G    +T   ++L  L  +  AVG+ RR   K++ A+E +  +  +W      +R V
Sbjct  31   NDKGRIFFSTDREIDLYELEELCDAVGWARRPIRKVKKAVECSFLVVTMWEIRGNRRRLV  90

Query  318  AFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGF  497
             FARAT D  FNA +WDVVV PS Q  GLGKA+M+ I+ KL    I+NI L+++P+V+ F
Sbjct  91   GFARATSDHAFNATVWDVVVHPSLQSKGLGKALMQYIIRKLRHYDISNITLFADPQVVDF  150

Query  498  YRSLGFVADPDGIRGMVY  551
            YR LGFV DP+GI+GM +
Sbjct  151  YRRLGFVLDPEGIKGMFW  168



>ref|WP_015147189.1| acetyltransferase [Oscillatoria acuminata]
 gb|AFY80539.1| acetyltransferase [Oscillatoria acuminata PCC 6304]
Length=176

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ A++++  +  +W    K +R + F+RAT D
Sbjct  43   STDRDIDLYELEELCDAVGWSRRPLRKVKKAIQYSFLVVSMWEMRGKTRRLIGFSRATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P +QG G GK++M   + +L  + I+NI L+++P V+ FYR+LGF++
Sbjct  103  HAFNATIWDVVVHPEYQGKGFGKSLMNYTIKRLRSEDISNITLFADPHVVEFYRNLGFMS  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|WP_015223079.1| N-acetyltransferase GCN5 [Cyanobacterium stanieri]
 gb|AFZ47763.1| GCN5-related N-acetyltransferase [Cyanobacterium stanieri PCC 
7202]
Length=174

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRPVAFARATGD  341
            +T   ++L  L  +  +VG+ RR   K++ ALEH+  ++  W      K  + FARAT D
Sbjct  42   STHEQIDLYELEELCDSVGWARRPLRKVRKALEHSYLVVSAWEVKGTKKTMIGFARATSD  101

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVV+ P FQ  GLGK +M+ ++ KL    I+N+ L+++P+V+ FYR LGF+ 
Sbjct  102  HAFNATIWDVVIHPRFQNKGLGKVLMKYMIRKLRSDDISNVTLFADPQVVDFYRRLGFIL  161

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  162  DPEGIKGMFW  171



>ref|WP_015203416.1| N-acetyltransferase GCN5 [Crinalium epipsammum]
 gb|AFZ13302.1| GCN5-related N-acetyltransferase [Crinalium epipsammum PCC 9333]
Length=175

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 78/114 (68%), Gaps = 2/114 (2%)
 Frame = +3

Query  216  AVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSF  389
            AVG+ RR   K++ AL+ +  +  +W E    +R + FARAT D  FNA IWDVVV P F
Sbjct  59   AVGWSRRPLRKVKKALQFSFLVVSMWEERGAKRRIIGFARATSDHAFNATIWDVVVHPDF  118

Query  390  QGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGIRGMVY  551
            Q  GLGKA+M+ ++ KL  + I+NI L+++P V+ FY  LGF+ADP+GI+GM +
Sbjct  119  QSKGLGKAMMKYMIKKLRSEDISNITLFADPHVVNFYGGLGFLADPEGIKGMFW  172



>gb|AIA21428.1| hypothetical protein [Pyropia fucicola]
Length=174

 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQK--AKRPVAFARATGDGVFN  353
            N+NL  L  +  +VG+ +R   K+++AL+++  ++ +  +K    + V FARAT D  FN
Sbjct  46   NINLYELEQLCDSVGWVKRPLKKVKIALKNSSIIISLIQKKDTNSKLVGFARATSDNGFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDV + P FQG+GLGK V+  ++ +L    I+ I L++EP V+ FY+ LGF+ DPDG
Sbjct  106  ATIWDVAIHPDFQGLGLGKVVIHHLIQQLRQGEISTITLFAEPDVVSFYKKLGFIKDPDG  165

Query  534  IRGMVY  551
            ++GM +
Sbjct  166  VKGMFW  171



>ref|WP_012596334.1| MULTISPECIES: N-acetyltransferase [Cyanothece]
 gb|ACK67073.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 8801]
 gb|ACV01874.1| GCN5-related N-acetyltransferase [Cyanothece sp. PCC 8802]
Length=175

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 85/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L  +  AVG+ RR   K++ AL ++  +  +W      +R V FARAT D
Sbjct  43   STERDIDLYELEELCDAVGWARRPLRKVKRALAYSFLVVSMWEVKGNQRRLVGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVVV P  Q  GLGKA+M+ ++ +L  + I+NI L+++P+V+ FYR LGFV 
Sbjct  103  HAFNATIWDVVVHPRCQSQGLGKALMKYMIRQLRSEDISNITLFADPQVIDFYRRLGFVL  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|XP_010529331.1| PREDICTED: acetyltransferase NSI isoform X1 [Tarenaya hassleriana]
Length=292

 Score =   116 bits (290),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 99/164 (60%), Gaps = 16/164 (10%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFT---NLNLDHLNSVFAAVGFPRRDTAKIQLALEHT-----  272
            +F + +  L   G      F+   ++++  L ++   VG+PRR  +K+  AL+++     
Sbjct  128  EFVLLERTLPDGGVTEQIMFSSGGDIDVYDLQALCDKVGWPRRPLSKLAAALKNSYMVAT  187

Query  273  --------DALLWVEHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERI  428
                    D+++  E    +R +  ARAT D  FNA IWDV+VDP +QG GLGKA++E++
Sbjct  188  LHSISKSSDSVILTEGDDQRRLIGMARATSDHAFNATIWDVLVDPEYQGQGLGKALVEKL  247

Query  429  VTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGIRGMVYSRK  560
            V  LL + I NI+L+++ +V+ FYR+LGF ADP+GI+GM +  K
Sbjct  248  VRALLQRDIGNISLFADSQVVEFYRNLGFEADPEGIKGMFWYPK  291



>ref|WP_015230881.1| acetyltransferase [Dactylococcopsis salina]
 gb|AFZ51907.1| putative acetyltransferase [Dactylococcopsis salina PCC 8305]
Length=174

 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 87/140 (62%), Gaps = 2/140 (1%)
 Frame = +3

Query  138  ELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKR  311
            E Q     L +T  +++L  L  +  AVG+ RR   K++ A++H+  +  +W E   ++R
Sbjct  32   ETQPETKILFSTTRSIDLYELEELCDAVGWSRRPLRKVRKAMQHSFLVVSMWEEKGASRR  91

Query  312  PVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVL  491
             + FARAT D  FNA IWDVVV P  QG GLGKA++  ++  L  + I+NI L+++  V+
Sbjct  92   LIGFARATSDHAFNATIWDVVVHPRSQGKGLGKALINYLIKCLRQEDISNITLFADAEVV  151

Query  492  GFYRSLGFVADPDGIRGMVY  551
             FY  LGFV DP+GI+GM +
Sbjct  152  QFYNRLGFVPDPEGIKGMFW  171



>ref|XP_002439969.1| hypothetical protein SORBIDRAFT_09g023610 [Sorghum bicolor]
 gb|EES18399.1| hypothetical protein SORBIDRAFT_09g023610 [Sorghum bicolor]
Length=216

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRP  314
            L ++  +++L  L ++   VG+PRR  +KI  +L ++  +  +         E ++ K+ 
Sbjct  74   LFSSAGDVDLYDLQALCDKVGWPRRPLSKIAASLRNSYLVATLHSIIRSSETEGEEKKQL  133

Query  315  VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLG  494
            +  ARAT D  FNA IWDV+VDPS+QG GLGKA+ME+++  LL + I NI L+++ +V+ 
Sbjct  134  IGMARATSDHAFNATIWDVLVDPSYQGQGLGKALMEKVIRTLLQRDINNITLFADNKVID  193

Query  495  FYRSLGFVADPDGIRGMVY  551
            FY++LGF  DP GI+GM +
Sbjct  194  FYKNLGFEVDPQGIKGMFW  212



>emb|CCQ60940.1| N-acetyltransferase (GNAT) family, Syn7942_0773 homolog, Ycf52 
protein [Crocosphaera watsonii WH 0401]
Length=146

 Score =   112 bits (281),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRPVAFARATGDGVFN  353
             ++L  L  +  AVG+ RR   K++ AL ++  ++  W    + +R + FARAT D  FN
Sbjct  18   EIDLYELEELCDAVGWARRPLPKVKRALTYSFMVVSAWEVKGQRRRLIGFARATSDHAFN  77

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQ  GLGK +M+ ++ +L  + I+NI L+++P+V+ FYR LGFV DP+G
Sbjct  78   ATIWDVVIHPRFQSKGLGKGMMKYMIRQLRSEDISNITLFADPQVVEFYRRLGFVLDPEG  137

Query  534  IRGMVY  551
            I+GM +
Sbjct  138  IKGMFW  143



>gb|EHJ10581.1| hypothetical protein CWATWH0003_4692 [Crocosphaera watsonii WH 
0003]
Length=146

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRPVAFARATGDGVFN  353
             ++L  L  +  AVG+ RR   K++ AL ++  ++  W    + +R + FARAT D  FN
Sbjct  18   EIDLYELEELCDAVGWARRPLRKVKRALTYSFMVVSAWEVKGQRRRLIGFARATSDHAFN  77

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQ  GLGK +M+ ++ +L  + I+NI L+++P+V+ FYR LGFV DP+G
Sbjct  78   ATIWDVVIHPRFQSKGLGKGMMKYMIRQLRSEDISNITLFADPQVVEFYRRLGFVLDPEG  137

Query  534  IRGMVY  551
            I+GM +
Sbjct  138  IKGMFW  143



>ref|WP_009547406.1| MULTISPECIES: N-acetyltransferase [Cyanothece]
 gb|ACB52295.1| unknown [Cyanothece sp. ATCC 51142]
Length=174

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 82/125 (66%), Gaps = 2/125 (2%)
 Frame = +3

Query  183  LNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRPVAFARATGDGVFNA  356
            ++L  L  +  AVG+ RR   K++ AL ++  ++  W      KR + FARAT D  FNA
Sbjct  47   IDLYELEELCDAVGWARRPLRKVKRALTYSFMVVSAWEVKGNRKRLIGFARATSDHAFNA  106

Query  357  IIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGI  536
             IWDVV+ P FQ  GLGK +M+ ++ +L  + I+NI L+++P+V+ FYR LGFV DP+GI
Sbjct  107  TIWDVVIHPRFQSKGLGKGMMKYMIRQLRSEDISNITLFADPQVVDFYRRLGFVLDPEGI  166

Query  537  RGMVY  551
            +GM +
Sbjct  167  KGMFW  171



>ref|WP_008274971.1| N-acetyltransferase [Cyanothece sp. CCY0110]
 gb|EAZ91899.1| hypothetical protein CY0110_29529 [Cyanothece sp. CCY0110]
Length=174

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRPVAFARATGDGVFN  353
             ++L  L  +  AVG+ RR   K++ AL ++  ++  W      KR + FARAT D  FN
Sbjct  46   EIDLYELEELCDAVGWARRPLRKVKRALTYSFMVVSAWEVKGNRKRLIGFARATSDHAFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQ  GLGK +M+ ++ +L  + I+NI L+++P+V+ FYR LGFV DP+G
Sbjct  106  ATIWDVVIHPRFQSKGLGKGMMKYMIRQLRSEDISNITLFADPQVVDFYRRLGFVLDPEG  165

Query  534  IRGMVY  551
            I+GM +
Sbjct  166  IKGMFW  171



>ref|XP_002502571.1| gcn5-related n-acetyltransferase [Micromonas sp. RCC299]
 gb|ACO63829.1| gcn5-related n-acetyltransferase [Micromonas sp. RCC299]
Length=294

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 13/131 (10%)
 Frame = +3

Query  162  LHTTF-----TNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV-----EHQKAKR  311
            L TTF        +LD LN +FA VGFP+RD  +++ AL ++  ++W         ++  
Sbjct  136  LGTTFLFGQRPEADLDELNGLFATVGFPQRDPTRLKRALVNSHHIVWCVVKDGNKNRSTH  195

Query  312  P---VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEP  482
            P   V FARAT DGVF A IWDVVV P +QG G+G+ +++R+V KL+ + I NI LY+EP
Sbjct  196  PGQCVGFARATSDGVFYATIWDVVVSPKWQGCGIGRGMVQRLVDKLVKEDINNITLYTEP  255

Query  483  RVLGFYRSLGF  515
             V G YR++GF
Sbjct  256  AVEGLYRTIGF  266



>ref|WP_041676949.1| acetyltransferase [Synechococcus elongatus]
Length=182

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L ++  AVG+ RR   +++ AL+++  +  LW +  + +R + FARAT D
Sbjct  50   STRRDIDLQELEALCDAVGWSRRPVRRVRRALDNSFLVVSLWEQLAQQRRLIGFARATSD  109

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVV++PSFQG GLG+ +ME ++ +L    I NI L+++P V+ FYR LGFV 
Sbjct  110  HAFNATIWDVVINPSFQGQGLGRVLMEYVIAQLQQAEIPNITLFADPHVVDFYRRLGFVL  169

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  170  DPEGIKGMFW  179



>ref|XP_005643135.1| histone acetyltransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE18591.1| histone acetyltransferase [Coccomyxa subellipsoidea C-169]
Length=134

 Score =   112 bits (279),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 76/124 (61%), Gaps = 6/124 (5%)
 Frame = +3

Query  207  VFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAKRP------VAFARATGDGVFNAIIWD  368
            ++  VGFP R+  K+  AL HT   LW+   +  R       + F RAT DG  +A IWD
Sbjct  1    MWRQVGFPARNPEKLVRALSHTHRTLWIRSTRKSRMARAGQLLGFCRATSDGALSATIWD  60

Query  369  VVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDGIRGMV  548
            V V P++Q  GLG+ V+ER+  +L+ +GI NI L++EP V+G Y  LGF+ DP G++G+ 
Sbjct  61   VAVHPAWQRSGLGRGVLERLTARLVAEGIPNITLFAEPNVVGLYEKLGFIRDPVGVKGLA  120

Query  549  YSRK  560
            +  K
Sbjct  121  FQGK  124



>gb|EEC79409.1| hypothetical protein OsI_20361 [Oryza sativa Indica Group]
Length=254

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARA  332
            ++N+  L ++   VG+PRR   KI  +L ++  +  +         E ++ K+ +  ARA
Sbjct  118  DVNVYDLQALCDKVGWPRRPLTKIAASLRNSYLVATLHSVTTPSKAEGEERKQLIGMARA  177

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA+ME+++  LL + I+NI L+++ +V+ FY++LG
Sbjct  178  TSDHAFNATIWDVLVDPSYQGQGLGKALMEKVIRTLLQRDISNITLFADNKVVDFYKNLG  237

Query  513  FVADPDGIRGMVY  551
            F ADP GI+GM +
Sbjct  238  FEADPQGIKGMFW  250



>ref|XP_007140046.1| hypothetical protein PHAVU_008G079900g [Phaseolus vulgaris]
 gb|ESW12040.1| hypothetical protein PHAVU_008G079900g [Phaseolus vulgaris]
Length=249

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 89/133 (67%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++  +  +         E  + KR +  ARA
Sbjct  113  DIDVYDLQALCDKVGWPRRPLSKLAAALKNSYIVASLHSIRKSPGSEGDEQKRLIGMARA  172

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LG
Sbjct  173  TSDHAFNATIWDVLVDPSYQGQGLGKALIEKLIRALLQRDIGNITLFADSQVVEFYRNLG  232

Query  513  FVADPDGIRGMVY  551
            F ADP+GI+GM +
Sbjct  233  FEADPEGIKGMFW  245



>sp|A2Y5T7.2|NSI_ORYSI RecName: Full=Probable acetyltransferase NSI; AltName: Full=Nuclear 
shuttle protein-interacting protein homolog [Oryza sativa 
Indica Group]
Length=254

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARA  332
            ++N+  L ++   VG+PRR   KI  +L ++  +  +         E ++ K+ +  ARA
Sbjct  118  DVNVYDLQALCDKVGWPRRPLTKIAASLRNSYLVATLHSVTMPSKAEGEERKQLIGMARA  177

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA+ME+++  LL + I+NI L+++ +V+ FY++LG
Sbjct  178  TSDHAFNATIWDVLVDPSYQGQGLGKALMEKVIRTLLQRDISNITLFADNKVVDFYKNLG  237

Query  513  FVADPDGIRGMVY  551
            F ADP GI+GM +
Sbjct  238  FEADPQGIKGMFW  250



>ref|NP_001055858.2| Os05g0481000 [Oryza sativa Japonica Group]
 sp|Q5KQI6.1|NSI_ORYSJ RecName: Full=Probable acetyltransferase NSI; AltName: Full=Nuclear 
shuttle protein-interacting protein homolog [Oryza sativa 
Japonica Group]
 gb|AAW56866.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG86973.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64117.1| hypothetical protein OsJ_18949 [Oryza sativa Japonica Group]
 dbj|BAF17772.2| Os05g0481000 [Oryza sativa Japonica Group]
Length=254

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARA  332
            ++N+  L ++   VG+PRR   KI  +L ++  +  +         E ++ K+ +  ARA
Sbjct  118  DVNVYDLQALCDKVGWPRRPLTKIAASLRNSYLVATLHSVTMPSKAEGEERKQLIGMARA  177

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA+ME+++  LL + I+NI L+++ +V+ FY++LG
Sbjct  178  TSDHAFNATIWDVLVDPSYQGQGLGKALMEKVIRTLLQRDISNITLFADNKVVDFYKNLG  237

Query  513  FVADPDGIRGMVY  551
            F ADP GI+GM +
Sbjct  238  FEADPQGIKGMFW  250



>gb|KDO64174.1| hypothetical protein CISIN_1g0258303mg, partial [Citrus sinensis]
 gb|KDO64175.1| hypothetical protein CISIN_1g0258303mg, partial [Citrus sinensis]
Length=206

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 95/155 (61%), Gaps = 14/155 (9%)
 Frame = +3

Query  135  EELQSRGFNLHTTFT---NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKA  305
            E+ Q  G      F+   ++++  L ++   VG+PRR  +K+  AL+++  L+   H   
Sbjct  52   EKTQPDGVIEQIIFSSGGDVDVYELQTLCDKVGWPRRPLSKLAAALKNS-YLVATLHSIR  110

Query  306  KRP----------VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGI  455
            K P          +  ARAT D  FNA IWDV+VDPS+QG GLGKA++E++V  LL K I
Sbjct  111  KSPGSEGNEQRTLIGMARATSDHAFNATIWDVLVDPSYQGQGLGKALVEKVVRALLQKDI  170

Query  456  TNIALYSEPRVLGFYRSLGFVADPDGIRGMVYSRK  560
             NI+L+++ +V+ FYR+LGF  DP+GI+GM +  K
Sbjct  171  GNISLFADSQVVDFYRNLGFEPDPEGIKGMFWHPK  205



>ref|WP_021830270.1| N-acetyltransferase (GNAT) family, Syn7942_0773 homolog, Ycf52 
protein [Crocosphaera watsonii]
 emb|CCQ50683.1| N-acetyltransferase (GNAT) family, Syn7942_0773 homolog, Ycf52 
protein [Crocosphaera watsonii WH 8502]
Length=174

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRPVAFARATGDGVFN  353
             ++L  L  +  AVG+ RR   K++ AL ++  ++  W    + +R + FARAT D  FN
Sbjct  46   EIDLYELEELCDAVGWARRPLPKVKRALTYSFMVVSAWEVKGQRRRLIGFARATSDHAFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQ  GLGK +M+ ++ +L  + I+NI L+++P+V+ FYR LGFV DP+G
Sbjct  106  ATIWDVVIHPRFQSKGLGKGMMKYMIRQLRSEDISNITLFADPQVVEFYRRLGFVLDPEG  165

Query  534  IRGMVY  551
            I+GM +
Sbjct  166  IKGMFW  171



>ref|WP_021833210.1| N-acetyltransferase (GNAT) family, Syn7942_0773 homolog, Ycf52 
protein [Crocosphaera watsonii]
 emb|CCQ56508.1| N-acetyltransferase (GNAT) family, Syn7942_0773 homolog, Ycf52 
protein [Crocosphaera watsonii WH 0005]
 emb|CCQ66902.1| N-acetyltransferase (GNAT) family, Syn7942_0773 homolog, Ycf52 
protein [Crocosphaera watsonii WH 0402]
Length=174

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRPVAFARATGDGVFN  353
             ++L  L  +  AVG+ RR   K++ AL ++  ++  W    + +R + FARAT D  FN
Sbjct  46   EIDLYELEELCDAVGWARRPLRKVKRALTYSFMVVSAWEVKGQRRRLIGFARATSDHAFN  105

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVV+ P FQ  GLGK +M+ ++ +L  + I+NI L+++P+V+ FYR LGFV DP+G
Sbjct  106  ATIWDVVIHPRFQSKGLGKGMMKYMIRQLRSEDISNITLFADPQVVEFYRRLGFVLDPEG  165

Query  534  IRGMVY  551
            I+GM +
Sbjct  166  IKGMFW  171



>gb|EPS67510.1| hypothetical protein M569_07266, partial [Genlisea aurea]
Length=207

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 95/143 (66%), Gaps = 10/143 (7%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT---DALLWV------EHQKAKRP  314
            + ++  N+++  L ++   VG+PRR  +K+  AL ++    AL  V      E   A+R 
Sbjct  65   IFSSGGNVDVYDLQALCDKVGWPRRPLSKLAAALRNSYLVAALHLVSKPGGGEGGSAERK  124

Query  315  -VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVL  491
             +  ARAT D  FNA IWDV+VDP++QG GLGKA++E+++  LL +GI NI+L+++ +V+
Sbjct  125  LIGMARATSDHAFNATIWDVLVDPNYQGRGLGKALIEKLIRTLLQRGIGNISLFADSKVV  184

Query  492  GFYRSLGFVADPDGIRGMVYSRK  560
             FYR+LGF ADP+GI+GM +  K
Sbjct  185  EFYRNLGFEADPEGIKGMFWHPK  207



>ref|XP_006481240.1| PREDICTED: acetyltransferase NSI-like [Citrus sinensis]
Length=247

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 95/155 (61%), Gaps = 14/155 (9%)
 Frame = +3

Query  135  EELQSRGFNLHTTFT---NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKA  305
            E+ Q  G      F+   ++++  L ++   VG+PRR  +K+  AL+++  L+   H   
Sbjct  93   EKTQPDGVIEQIIFSSGGDVDVYELQTLCDKVGWPRRPLSKLAAALKNS-YLVATLHSIR  151

Query  306  KRP----------VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGI  455
            K P          +  ARAT D  FNA IWDV+VDPS+QG GLGKA++E++V  LL K I
Sbjct  152  KSPGSEGNEQRTLIGMARATSDHAFNATIWDVLVDPSYQGQGLGKALVEKVVRALLQKDI  211

Query  456  TNIALYSEPRVLGFYRSLGFVADPDGIRGMVYSRK  560
             NI+L+++ +V+ FYR+LGF  DP+GI+GM +  K
Sbjct  212  GNISLFADSQVVDFYRNLGFEPDPEGIKGMFWHPK  246



>dbj|BAD78953.1| hypothetical protein YCF52 [Synechococcus elongatus PCC 6301]
Length=210

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +++L  L ++  AVG+ RR   +++ AL+++  +  LW +  + +R + FARAT D
Sbjct  78   STRRDIDLQELEALCDAVGWSRRPVRRVRRALDNSFLVVSLWEQLAQQRRLIGFARATSD  137

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA IWDVV++PSFQG GLG+ +ME ++ +L    I NI L+++P V+ FYR LGFV 
Sbjct  138  HAFNATIWDVVINPSFQGQGLGRVLMEYVIAQLQQAEIPNITLFADPHVVDFYRRLGFVL  197

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  198  DPEGIKGMFW  207



>ref|XP_008647422.1| PREDICTED: uncharacterized protein LOC100194006 isoform X1 [Zea 
mays]
 gb|ACN26308.1| unknown [Zea mays]
Length=249

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 91/139 (65%), Gaps = 9/139 (6%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLW-------VEHQKAKRP  314
            L ++  ++++  L ++   VG+PRR  +KI  +L ++   A L+        E ++ K+ 
Sbjct  107  LFSSAGDVDVYDLQALCNKVGWPRRPLSKIAASLRNSYLVATLYSIIRSSETEGEEKKQL  166

Query  315  VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLG  494
            +  ARAT D  FNA IWDV+VDPS+QG GLGKA+ME+++  LL + I NI L+++ +V+ 
Sbjct  167  IGMARATSDHAFNATIWDVLVDPSYQGQGLGKALMEKVIRTLLQRDINNITLFADNKVID  226

Query  495  FYRSLGFVADPDGIRGMVY  551
            FY++LGF  DP GI+GM +
Sbjct  227  FYKNLGFEVDPQGIKGMFW  245



>gb|KJB29848.1| hypothetical protein B456_005G121100 [Gossypium raimondii]
Length=251

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 87/133 (65%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHT---------DALLWVEHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++           L   E  + KR +  ARA
Sbjct  115  DVDVYELQALCDKVGWPRRPLSKLAAALKNSYMVAALHSVKKLPGSEGNEQKRLIGMARA  174

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LG
Sbjct  175  TSDHAFNATIWDVLVDPSYQGQGLGKAMVEKMIRTLLQRDIGNITLFADSQVVEFYRNLG  234

Query  513  FVADPDGIRGMVY  551
            F  DP+GI+GM +
Sbjct  235  FEPDPEGIKGMFW  247



>ref|XP_006654548.1| PREDICTED: probable acetyltransferase NSI-like isoform X1 [Oryza 
brachyantha]
Length=257

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 89/133 (67%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR   KI  +L ++  +  +         E +++K+ +  ARA
Sbjct  121  DVDVYDLQALCDKVGWPRRPLTKIAASLRNSYLVATLHSIIRSPQAEGEESKQLIGMARA  180

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA+ME+++  LL + I+NI L+++ +V+ FY++LG
Sbjct  181  TSDHAFNATIWDVLVDPSYQGQGLGKALMEKVIRTLLQRDISNITLFADNKVVDFYKNLG  240

Query  513  FVADPDGIRGMVY  551
            F ADP GI+GM +
Sbjct  241  FEADPQGIKGMFW  253



>ref|WP_015159597.1| acetyltransferase [Chamaesiphon minutus]
 gb|AFY93447.1| acetyltransferase [Chamaesiphon minutus PCC 6605]
Length=175

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 84/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  +L+L  L  +   VG+ RR   K++ AL+++  +  +W      KR + FARAT D
Sbjct  43   STDRDLDLYELEELCDIVGWSRRPLRKVKKALQNSFIVVSMWEVRGATKRMIGFARATSD  102

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
            G FNA +WDVVV P FQG  LGKA+M+  + K+  + I+NI L+++  V+GFY  +GFV 
Sbjct  103  GAFNATVWDVVVHPDFQGQRLGKAMMKYTIDKIRAEDISNITLFADAHVVGFYSGMGFVE  162

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  163  DPEGIKGMFW  172



>ref|NP_001143827.1| uncharacterized protein LOC100276606 [Zea mays]
 gb|ACG35749.1| hypothetical protein [Zea mays]
Length=249

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 91/139 (65%), Gaps = 9/139 (6%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLW-------VEHQKAKRP  314
            L ++  ++++  L ++   VG+PRR  +KI  +L ++   A L+        E ++ K+ 
Sbjct  107  LFSSAGDVDVYDLQALCDKVGWPRRPLSKIAASLRNSYLVATLYSIIRSSETEGEEKKQL  166

Query  315  VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLG  494
            +  ARAT D  FNA IWDV+VDPS+QG GLGKA+ME+++  LL + I NI L+++ +V+ 
Sbjct  167  IGMARATSDHAFNATIWDVLVDPSYQGQGLGKALMEKVIRTLLQRDINNITLFADNKVID  226

Query  495  FYRSLGFVADPDGIRGMVY  551
            FY++LGF  DP GI+GM +
Sbjct  227  FYKNLGFEVDPQGIKGMFW  245



>gb|KJB29849.1| hypothetical protein B456_005G121100 [Gossypium raimondii]
Length=215

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 87/133 (65%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHT---------DALLWVEHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++           L   E  + KR +  ARA
Sbjct  79   DVDVYELQALCDKVGWPRRPLSKLAAALKNSYMVAALHSVKKLPGSEGNEQKRLIGMARA  138

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LG
Sbjct  139  TSDHAFNATIWDVLVDPSYQGQGLGKAMVEKMIRTLLQRDIGNITLFADSQVVEFYRNLG  198

Query  513  FVADPDGIRGMVY  551
            F  DP+GI+GM +
Sbjct  199  FEPDPEGIKGMFW  211



>ref|XP_006429638.1| hypothetical protein CICLE_v10012371mg [Citrus clementina]
 gb|ESR42878.1| hypothetical protein CICLE_v10012371mg [Citrus clementina]
Length=288

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 95/155 (61%), Gaps = 14/155 (9%)
 Frame = +3

Query  135  EELQSRGFNLHTTFT---NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKA  305
            E+ Q  G      F+   ++++  L ++   VG+PRR  +K+  AL+++  L+   H   
Sbjct  134  EKTQPDGVIEQIIFSSGGDVDVYELQTLCDKVGWPRRPLSKLAAALKNS-YLVATLHSIR  192

Query  306  KRP----------VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGI  455
            K P          +  ARAT D  FNA IWDV+VDPS+QG GLGKA++E++V  LL K I
Sbjct  193  KSPGSEGNEQRTLIGMARATSDHAFNATIWDVLVDPSYQGQGLGKALVEKVVRALLQKDI  252

Query  456  TNIALYSEPRVLGFYRSLGFVADPDGIRGMVYSRK  560
             NI+L+++ +V+ FYR+LGF  DP+GI+GM +  K
Sbjct  253  GNISLFADSQVVDFYRNLGFEPDPEGIKGMFWHPK  287



>gb|KJB29846.1| hypothetical protein B456_005G121100 [Gossypium raimondii]
Length=247

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 87/133 (65%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHT---------DALLWVEHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++           L   E  + KR +  ARA
Sbjct  111  DVDVYELQALCDKVGWPRRPLSKLAAALKNSYMVAALHSVKKLPGSEGNEQKRLIGMARA  170

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LG
Sbjct  171  TSDHAFNATIWDVLVDPSYQGQGLGKAMVEKMIRTLLQRDIGNITLFADSQVVEFYRNLG  230

Query  513  FVADPDGIRGMVY  551
            F  DP+GI+GM +
Sbjct  231  FEPDPEGIKGMFW  243



>ref|XP_004492591.1| PREDICTED: probable acetyltransferase NSI-like [Cicer arietinum]
Length=246

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++  +  +         E  + KR +  ARA
Sbjct  110  DIDVYDLQALCDKVGWPRRPLSKLAAALKNSYIVASLYSIRKSPGSEGNEQKRLIGMARA  169

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDP +QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LG
Sbjct  170  TSDHAFNATIWDVLVDPGYQGQGLGKALVEKLIRTLLQRDIGNITLFADSKVVEFYRNLG  229

Query  513  FVADPDGIRGMVY  551
            F ADP+GI+GM +
Sbjct  230  FEADPEGIKGMFW  242



>gb|KHG25134.1| putative acetyltransferase NSI [Gossypium arboreum]
Length=247

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 87/133 (65%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHT---------DALLWVEHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++           L   E  + KR +  ARA
Sbjct  111  DVDVYELQALCDKVGWPRRPLSKLAAALKNSYMVAVLHSVKKLPGSEGNEQKRLIGMARA  170

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LG
Sbjct  171  TSDHAFNATIWDVLVDPSYQGQGLGKAMVEKMIRTLLQRDIGNITLFADSQVVEFYRNLG  230

Query  513  FVADPDGIRGMVY  551
            F  DP+GI+GM +
Sbjct  231  FEPDPEGIKGMFW  243



>ref|XP_003551622.2| PREDICTED: acetyltransferase NSI-like isoform X1 [Glycine max]
Length=231

 Score =   112 bits (281),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 84/127 (66%), Gaps = 9/127 (7%)
 Frame = +3

Query  198  LNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARATGDGVF  350
            L ++   VG+PRR  +K+  AL+++  +  +         E  + KR +  ARAT D  F
Sbjct  101  LQALCDKVGWPRRPLSKLAAALKNSYIVASLHSIRKSHGSEGNEQKRLIGMARATSDHAF  160

Query  351  NAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPD  530
            NA IWDV+VDP +QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LGF ADP+
Sbjct  161  NATIWDVLVDPGYQGQGLGKALIEKLIRTLLQRDIGNITLFADSQVVEFYRNLGFEADPE  220

Query  531  GIRGMVY  551
            GI+GM +
Sbjct  221  GIKGMFW  227



>gb|EMT17836.1| Putative acetyltransferase NSI [Aegilops tauschii]
Length=249

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 90/139 (65%), Gaps = 9/139 (6%)
 Frame = +3

Query  162  LHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRP  314
            L ++  ++++  L ++   VG+PRR   KI  +L ++  +  +         E ++ K+ 
Sbjct  107  LFSSAGDIDVYDLQALCDKVGWPRRPLTKIAASLRNSYLVATLHSITRSSETEGEERKQL  166

Query  315  VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLG  494
            +  ARAT D  FNA IWDV+VDPS+QG GLGK +ME+++  LL + I+NI L+++ +V+ 
Sbjct  167  IGMARATSDHAFNATIWDVLVDPSYQGQGLGKTLMEKVIRTLLQRDISNITLFADSKVVD  226

Query  495  FYRSLGFVADPDGIRGMVY  551
            FY+++GF ADP GI+GM +
Sbjct  227  FYKNMGFEADPQGIKGMFW  245



>ref|XP_006602733.1| PREDICTED: acetyltransferase NSI-like isoform X3 [Glycine max]
Length=249

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 84/127 (66%), Gaps = 9/127 (7%)
 Frame = +3

Query  198  LNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARATGDGVF  350
            L ++   VG+PRR  +K+  AL+++  +  +         E  + KR +  ARAT D  F
Sbjct  119  LQALCDKVGWPRRPLSKLAAALKNSYIVASLHSIRKSHGSEGNEQKRLIGMARATSDHAF  178

Query  351  NAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPD  530
            NA IWDV+VDP +QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LGF ADP+
Sbjct  179  NATIWDVLVDPGYQGQGLGKALIEKLIRTLLQRDIGNITLFADSQVVEFYRNLGFEADPE  238

Query  531  GIRGMVY  551
            GI+GM +
Sbjct  239  GIKGMFW  245



>ref|WP_012953854.1| N-acetyltransferase [Candidatus Atelocyanobacterium thalassa]
 gb|ADB95189.1| acetyltransferase (GNAT) family protein [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=146

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 88/139 (63%), Gaps = 4/139 (3%)
 Frame = +3

Query  141  LQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRP  314
            +QSR F   T    ++L  L  +  +VG+ RR   KIQ AL+++  ++  W   +  +R 
Sbjct  7    VQSRIF--FTKERKIDLHDLEELCDSVGWSRRPLRKIQRALKNSFIIVSAWEIRKNQRRL  64

Query  315  VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLG  494
            + FARAT D  FNA IWDVV+ P FQ  GLGK ++  ++  L ++ I+NI L+++P+V+ 
Sbjct  65   IGFARATSDHAFNATIWDVVIHPRFQSQGLGKGMISYMIRHLKNEDISNITLFADPQVVD  124

Query  495  FYRSLGFVADPDGIRGMVY  551
            FY  LGFV +P+GI+GM +
Sbjct  125  FYCRLGFVIEPEGIKGMFW  143



>gb|KHN29481.1| Acetyltransferase NSI [Glycine soja]
Length=249

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 88/133 (66%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++  +  +         E  + KR +  ARA
Sbjct  113  DVDVYDLQALCDKVGWPRRPLSKLAAALKNSYIVASLHSIRKSPGSEGNEQKRLIGMARA  172

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDP +QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LG
Sbjct  173  TSDHAFNATIWDVLVDPGYQGQGLGKALIEKLIRTLLQRDIGNITLFADSQVVEFYRNLG  232

Query  513  FVADPDGIRGMVY  551
            F ADP+GI+GM +
Sbjct  233  FEADPEGIKGMFW  245



>ref|XP_006602732.1| PREDICTED: acetyltransferase NSI-like isoform X2 [Glycine max]
Length=279

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 84/127 (66%), Gaps = 9/127 (7%)
 Frame = +3

Query  198  LNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARATGDGVF  350
            L ++   VG+PRR  +K+  AL+++  +  +         E  + KR +  ARAT D  F
Sbjct  149  LQALCDKVGWPRRPLSKLAAALKNSYIVASLHSIRKSHGSEGNEQKRLIGMARATSDHAF  208

Query  351  NAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPD  530
            NA IWDV+VDP +QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LGF ADP+
Sbjct  209  NATIWDVLVDPGYQGQGLGKALIEKLIRTLLQRDIGNITLFADSQVVEFYRNLGFEADPE  268

Query  531  GIRGMVY  551
            GI+GM +
Sbjct  269  GIKGMFW  275



>gb|KJB29847.1| hypothetical protein B456_005G121100 [Gossypium raimondii]
Length=246

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 86/132 (65%), Gaps = 8/132 (6%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALE--------HTDALLWVEHQKAKRPVAFARAT  335
            ++++  L ++   VG+PRR  +K+  AL+        H+   L     + KR +  ARAT
Sbjct  111  DVDVYELQALCDKVGWPRRPLSKLAAALKNSYMVAALHSVKKLPGSGNEQKRLIGMARAT  170

Query  336  GDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
             D  FNA IWDV+VDPS+QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LGF
Sbjct  171  SDHAFNATIWDVLVDPSYQGQGLGKAMVEKMIRTLLQRDIGNITLFADSQVVEFYRNLGF  230

Query  516  VADPDGIRGMVY  551
              DP+GI+GM +
Sbjct  231  EPDPEGIKGMFW  242



>ref|WP_015164425.1| N-acetyltransferase GCN5 [Pseudanabaena sp. PCC 7367]
 gb|AFY69452.1| GCN5-related N-acetyltransferase [Pseudanabaena sp. PCC 7367]
Length=167

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 83/130 (64%), Gaps = 2/130 (2%)
 Frame = +3

Query  168  TTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDAL--LWVEHQKAKRPVAFARATGD  341
            +T  ++++  L  +  AVG+ RR   K++ A++H+  +  +W +     R + FARAT D
Sbjct  35   STDRDIDVYELEELCDAVGWSRRPIRKVRKAIQHSFIVISMWEKRGTYSRLIGFARATSD  94

Query  342  GVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVA  521
              FNA +WDVVV P +QG GLGKA+M+  +  L    I+NI+L+++  V+ FYR LGF  
Sbjct  95   HAFNATLWDVVVHPEYQGKGLGKALMKETIKSLRQADISNISLFADAHVVEFYRQLGFSP  154

Query  522  DPDGIRGMVY  551
            DP+GI+GM +
Sbjct  155  DPEGIKGMFW  164



>ref|WP_040054220.1| acetyltransferase [Candidatus Atelocyanobacterium thalassa]
 gb|KFF42066.1| acetyltransferase [Candidatus Atelocyanobacterium thalassa isolate 
SIO64986]
Length=174

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 87/139 (63%), Gaps = 4/139 (3%)
 Frame = +3

Query  141  LQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALL--WVEHQKAKRP  314
            LQSR F   T    ++L  L  +  +VG+ RR   K++ AL ++  ++  W   +  +R 
Sbjct  35   LQSRIF--FTKEREIDLYDLEELCDSVGWSRRPLRKVKRALNNSFIIVSAWEVRKNQRRL  92

Query  315  VAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLG  494
            + FARAT D  FNA IWDVV+ P FQ  GLGK ++  ++  L ++ I+NI L+++P+V+ 
Sbjct  93   IGFARATSDHAFNATIWDVVIHPRFQSKGLGKGMINYMIRHLKNEDISNITLFADPQVIN  152

Query  495  FYRSLGFVADPDGIRGMVY  551
            FY  LGF+ +P+GI+GM +
Sbjct  153  FYCRLGFIVEPEGIKGMFW  171



>ref|YP_007878158.1| GCN5-like N-acetyltransferase (chloroplast) [Calliarthron tuberculosum]
 gb|AGA63769.1| GCN5-like N-acetyltransferase (chloroplast) [Calliarthron tuberculosum]
Length=176

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHT--DALLWVEHQKAKRPVAFARATGDGVFN  353
            N++L  L  +   VG+ RR   K++ A++H+     L+ +++   + +AFARAT D  FN
Sbjct  48   NIDLYELEKLCDTVGWVRRPLKKVKTAIKHSFLTISLFYKNKNQVKMIAFARATSDHTFN  107

Query  354  AIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGFVADPDG  533
            A IWDVVV P FQ  GLGK ++  ++ +L    I  I L+++P+V+ FY++LGF+ DPDG
Sbjct  108  ATIWDVVVHPEFQRKGLGKVLIYEVIKELRYSDINTITLFADPQVISFYKNLGFIPDPDG  167

Query  534  IRGMVY  551
            ++GM +
Sbjct  168  VKGMFW  173



>emb|CBI31163.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 87/133 (65%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++  +  +         E  + K+ +  ARA
Sbjct  85   DVDVYDLQALCDKVGWPRRPLSKLSAALKNSYMVATLHSLRKSPGEERNEQKKLIGMARA  144

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA++E+ +  LL + I NI L+++ +V+ FYR+LG
Sbjct  145  TSDHAFNATIWDVLVDPSYQGQGLGKALVEKTIRALLQRDIGNITLFADSQVVEFYRNLG  204

Query  513  FVADPDGIRGMVY  551
            F  DP+GI+GM +
Sbjct  205  FEPDPEGIKGMFW  217



>ref|XP_002266361.2| PREDICTED: acetyltransferase NSI isoform X2 [Vitis vinifera]
Length=246

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 87/133 (65%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++  +  +         E  + K+ +  ARA
Sbjct  110  DVDVYDLQALCDKVGWPRRPLSKLSAALKNSYMVATLHSLRKSPGEERNEQKKLIGMARA  169

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGKA++E+ +  LL + I NI L+++ +V+ FYR+LG
Sbjct  170  TSDHAFNATIWDVLVDPSYQGQGLGKALVEKTIRALLQRDIGNITLFADSQVVEFYRNLG  229

Query  513  FVADPDGIRGMVY  551
            F  DP+GI+GM +
Sbjct  230  FEPDPEGIKGMFW  242



>ref|XP_001419783.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98076.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=116

 Score =   108 bits (269),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 76/116 (66%), Gaps = 6/116 (5%)
 Frame = +3

Query  186  NLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAKR------PVAFARATGDGV  347
            + + LN++F +VGF  R   K+Q A++++   LWV   +  R       V FARAT DG 
Sbjct  1    DFERLNALFVSVGFSSRACDKLQKAVDNSYLALWVTTTRDSRFAKEGEVVGFARATSDGT  60

Query  348  FNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLGF  515
            F+A +WDVVV P++Q  G+G+ +MERIV K+L++ I N+ LYSE +V+G Y  LGF
Sbjct  61   FHATVWDVVVSPAWQRHGIGQGLMERIVDKILEEDICNVGLYSENKVVGLYERLGF  116



>ref|XP_004302517.1| PREDICTED: acetyltransferase NSI [Fragaria vesca subsp. vesca]
Length=246

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 89/137 (65%), Gaps = 11/137 (8%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWVEHQKAKRP----------VAFAR  329
            ++++  L S+   VG+PRR  +K+  AL+++  ++   H   K P          +  AR
Sbjct  110  DVDVYDLQSLCDKVGWPRRPLSKLAAALKNS-YMVATLHSVRKSPGSDGYDQKKLIGLAR  168

Query  330  ATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSL  509
            AT D  FNA IWDV+VDPS+QG GLGK ++E+I+  LL + I NI+L+++ +V+ FY++L
Sbjct  169  ATSDHAFNATIWDVLVDPSYQGQGLGKTLVEKIIRALLQRDIGNISLFADSQVVDFYQNL  228

Query  510  GFVADPDGIRGMVYSRK  560
            GF ADP+GI+GM +  K
Sbjct  229  GFEADPEGIKGMFWYPK  245



>ref|XP_010653125.1| PREDICTED: acetyltransferase NSI isoform X1 [Vitis vinifera]
Length=257

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 87/144 (60%), Gaps = 20/144 (14%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHT----------------DALLW----VEHQ  299
            ++++  L ++   VG+PRR  +K+  AL+++                D   W     E  
Sbjct  110  DVDVYDLQALCDKVGWPRRPLSKLSAALKNSYMVATLHSLRKSPGEDDEYTWKSYLTERN  169

Query  300  KAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSE  479
            + K+ +  ARAT D  FNA IWDV+VDPS+QG GLGKA++E+ +  LL + I NI L+++
Sbjct  170  EQKKLIGMARATSDHAFNATIWDVLVDPSYQGQGLGKALVEKTIRALLQRDIGNITLFAD  229

Query  480  PRVLGFYRSLGFVADPDGIRGMVY  551
             +V+ FYR+LGF  DP+GI+GM +
Sbjct  230  SQVVEFYRNLGFEPDPEGIKGMFW  253



>ref|XP_011001650.1| PREDICTED: acetyltransferase NSI isoform X3 [Populus euphratica]
Length=202

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 87/136 (64%), Gaps = 9/136 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLWV---------EHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++  +  +         E    K+ +  ARA
Sbjct  66   DVDIYDLQTLCDKVGWPRRPLSKLDAALKNSYMVATLHSIRKSPGSEGNDQKKLIGMARA  125

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDPS+QG GLGK ++E+I+  LL + I NI L+++ +V+ FYR+LG
Sbjct  126  TSDHAFNATIWDVLVDPSYQGQGLGKTLVEKIIRALLQRDIGNITLFADSQVVEFYRNLG  185

Query  513  FVADPDGIRGMVYSRK  560
            F  DP+GI+GM +  K
Sbjct  186  FEPDPEGIKGMFWYPK  201



>ref|XP_007033470.1| Nuclear shuttle interacting isoform 2 [Theobroma cacao]
 gb|EOY04396.1| Nuclear shuttle interacting isoform 2 [Theobroma cacao]
Length=248

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 86/133 (65%), Gaps = 9/133 (7%)
 Frame = +3

Query  180  NLNLDHLNSVFAAVGFPRRDTAKIQLALEHT---------DALLWVEHQKAKRPVAFARA  332
            ++++  L ++   VG+PRR  +K+  AL+++           L   E  + K+ +  ARA
Sbjct  112  DVDIYELQALCDKVGWPRRPLSKLAAALKNSYMVATLHSVRKLASSEGDEQKKLIGMARA  171

Query  333  TGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPRVLGFYRSLG  512
            T D  FNA IWDV+VDP +QG GLGKA++E+++  LL + I NI L+++ +V+ FYR+LG
Sbjct  172  TSDHAFNATIWDVLVDPCYQGQGLGKAMVEKLIRTLLQRDIGNITLFADSQVVEFYRNLG  231

Query  513  FVADPDGIRGMVY  551
            F  DP+GI+GM +
Sbjct  232  FEPDPEGIKGMFW  244



>ref|WP_015218622.1| N-acetyltransferase GCN5 [Cyanobacterium aponinum]
 gb|AFZ52891.1| GCN5-related N-acetyltransferase [Cyanobacterium aponinum PCC 
10605]
Length=174

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = +3

Query  132  DEELQSRGFNLHTTFTNLNLDHLNSVFAAVGFPRRDTAKIQLALEHTD--ALLWVEHQKA  305
            D ++  R     +T  +++L  L  +  +VG+ RR   K++ AL+H+   A  W      
Sbjct  30   DPQVFGRSKIFFSTNQSIDLYELEELCDSVGWARRPLRKVKKALDHSYLVASAWEVRGAK  89

Query  306  KRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKLLDKGITNIALYSEPR  485
               + FARAT D  FNA IWDVV+ P FQ  GLGKA M+ ++ KL    I+N+ L+++  
Sbjct  90   TSLIGFARATSDHAFNATIWDVVIHPRFQSKGLGKAFMKYVIRKLRKDDISNVTLFADAH  149

Query  486  VLGFYRSLGFVADPDGIRGMVY  551
            V+ FY+ LGF+ DP+GIRGM Y
Sbjct  150  VVEFYQRLGFIPDPEGIRGMFY  171



>ref|XP_010529340.1| PREDICTED: acetyltransferase NSI isoform X2 [Tarenaya hassleriana]
Length=288

 Score =   112 bits (279),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 97/160 (61%), Gaps = 12/160 (8%)
 Frame = +3

Query  117  KFSISDEELQSRGFNLHTTFT---NLNLDHLNSVFAAVGFPRRDTAKIQLALEHTDALLW  287
            +F + +  L   G      F+   ++++  L ++   VG+PRR  +K+  AL+++  +  
Sbjct  128  EFVLLERTLPDGGVTEQIMFSSGGDIDVYDLQALCDKVGWPRRPLSKLAAALKNSYMVAT  187

Query  288  V---------EHQKAKRPVAFARATGDGVFNAIIWDVVVDPSFQGIGLGKAVMERIVTKL  440
            +         E    +R +  ARAT D  FNA IWDV+VDP +QG GLGKA++E++V  L
Sbjct  188  LHSISKSSDSEGDDQRRLIGMARATSDHAFNATIWDVLVDPEYQGQGLGKALVEKLVRAL  247

Query  441  LDKGITNIALYSEPRVLGFYRSLGFVADPDGIRGMVYSRK  560
            L + I NI+L+++ +V+ FYR+LGF ADP+GI+GM +  K
Sbjct  248  LQRDIGNISLFADSQVVEFYRNLGFEADPEGIKGMFWYPK  287



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960