BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN033G01

Length=215
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW58176.1|  hypothetical protein EUGRSUZ_H00892                     149   7e-43   Eucalyptus grandis [rose gum]
ref|XP_007039159.1|  Ubiquitin supergroup,Ribosomal protein L40e        146   1e-42   
pir||S42643  ubiquitin / ribosomal protein S27a - potato (fragment)     145   1e-42
ref|XP_008439961.1|  PREDICTED: polyubiquitin-like                      146   2e-42   
ref|XP_010271616.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    146   2e-42   
ref|XP_006444583.1|  hypothetical protein CICLE_v10024476mg             144   2e-42   
gb|EYU19679.1|  hypothetical protein MIMGU_mgv1a015002mg                146   3e-42   Erythranthe guttata [common monkey flower]
gb|KIL71143.1|  hypothetical protein M378DRAFT_202901                   144   4e-42   Amanita muscaria Koide BX008
emb|CCA26421.1|  ubiquitinribosomal fusion protein putative             144   4e-42   Albugo laibachii Nc14
ref|XP_006373839.1|  UBIQUITIN EXTENSION protein 1                      144   4e-42   
ref|XP_003327364.1|  ubiquitin-60S ribosomal protein L40 fusion p...    147   4e-42   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_006292019.1|  hypothetical protein CARUB_v10018208mg             144   4e-42   
gb|ABK93609.1|  unknown                                                 144   5e-42   Populus trichocarpa [western balsam poplar]
emb|CDX79186.1|  BnaC06g21170D                                          145   5e-42   
sp|P51423.2|RL40_BRARP  RecName: Full=Ubiquitin-60S ribosomal pro...    144   5e-42   Brassica rapa subsp. pekinensis [bai cai]
emb|CCI48433.1|  unnamed protein product                                145   5e-42   Albugo candida
gb|ADQ55418.1|  ubiquitin 2                                             142   6e-42   Oryza coarctata
ref|XP_002465593.1|  hypothetical protein SORBIDRAFT_01g041800          144   6e-42   Sorghum bicolor [broomcorn]
gb|EPS73110.1|  hypothetical protein M569_01646                         145   6e-42   Genlisea aurea
gb|ABK93568.1|  unknown                                                 144   6e-42   Populus trichocarpa [western balsam poplar]
ref|XP_002318470.1|  UBIQUITIN EXTENSION protein 1                      144   6e-42   Populus trichocarpa [western balsam poplar]
emb|CEG01448.1|  Ubiquitin supergroup                                   144   6e-42   Ostreococcus tauri
ref|XP_008354260.1|  PREDICTED: ubiquitin                               144   6e-42   
dbj|BAB32735.1|  ubiquitin                                              143   6e-42   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_003558419.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    144   6e-42   Brachypodium distachyon [annual false brome]
gb|AAX22106.1|  polyubiquitin                                           142   7e-42   Oryza sativa Indica Group [Indian rice]
gb|KFK38522.1|  hypothetical protein AALP_AA3G124500                    144   7e-42   Arabis alpina [alpine rockcress]
ref|XP_006430159.1|  hypothetical protein CICLE_v10013083mg             144   7e-42   
gb|AAF78520.1|AF195224_1  ubiquitin fusion protein                      143   7e-42   Pyrus pyrifolia [sha li]
ref|XP_010683693.1|  PREDICTED: ubiquitin-60S ribosomal protein L40     144   7e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|EMD85945.1|  hypothetical protein COCHEDRAFT_43242                   142   7e-42   Bipolaris maydis C5
gb|KEH35478.1|  ubiquitin-60S ribosomal L40 fusion protein              144   7e-42   Medicago truncatula
gb|EGN93533.1|  hypothetical protein SERLA73DRAFT_63550                 143   7e-42   Serpula lacrymans var. lacrymans S7.3
dbj|BAK18566.1|  N-terminal end of polyubiquitin                        142   7e-42   Mesembryanthemum crystallinum
sp|P69310.1|UBIQ_AVESA  RecName: Full=Ubiquitin                         142   7e-42   Avena sativa [cultivated oat]
gb|AAA96951.1|  polyubiquitin                                           142   7e-42   Solanum tuberosum [potatoes]
ref|XP_007202754.1|  hypothetical protein PRUPE_ppa013349mg             144   7e-42   Prunus persica
tpe|CAI56329.1|  TPA: ubiquitin-60S ribosomal L40 fusion protein        144   7e-42   Vitis vinifera
sp|P49636.2|RL40_NICSY  RecName: Full=Ubiquitin-60S ribosomal pro...    144   7e-42   Nicotiana sylvestris
ref|XP_002530306.1|  ubiquitin, putative                                144   7e-42   Ricinus communis
ref|XP_002273568.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    144   7e-42   Vitis vinifera
ref|XP_009419594.1|  PREDICTED: ubiquitin                               142   7e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_565836.1|  60S ribosomal protein L40-1                           144   7e-42   Arabidopsis thaliana [mouse-ear cress]
sp|P69326.2|UBIQ_WHEAT  RecName: Full=Ubiquitin; Flags: Precursor       142   7e-42   Triticum aestivum [Canadian hard winter wheat]
gb|KJB46428.1|  hypothetical protein B456_007G368200                    142   8e-42   Gossypium raimondii
emb|CDY71775.1|  BnaUnng04590D                                          142   8e-42   Brassica napus [oilseed rape]
ref|NP_001063337.1|  Os09g0452700                                       144   8e-42   
gb|AFK47149.1|  unknown                                                 144   8e-42   Lotus japonicus
ref|XP_003602319.1|  Ubiquitin                                          144   8e-42   Medicago truncatula
gb|ABH08968.1|  ubiquitin                                               142   8e-42   Morus bombycis
gb|KIK29708.1|  hypothetical protein PISMIDRAFT_439235                  142   8e-42   Pisolithus microcarpus 441
ref|NP_001049479.1|  Os03g0234200                                       144   8e-42   
ref|XP_007027812.1|  Ubiquitin extension protein 1 isoform 2            142   8e-42   
gb|EPT03401.1|  hypothetical protein FOMPIDRAFT_51332                   142   8e-42   Fomitopsis pinicola FP-58527 SS1
gb|ABK42077.1|  ubiquitin extension protein                             145   8e-42   Capsicum annuum
emb|CDX95544.1|  BnaC01g34360D                                          142   8e-42   
ref|NP_001059668.2|  Os07g0489500                                       144   8e-42   
gb|ABR25913.1|  polyubiquitin containing 7 ubiquitin monomers           142   9e-42   Oryza sativa Indica Group [Indian rice]
gb|KCW48292.1|  hypothetical protein EUGRSUZ_K020232                    142   9e-42   Eucalyptus grandis [rose gum]
emb|CDY71299.1|  BnaA08g30590D                                          142   9e-42   Brassica napus [oilseed rape]
gb|EAZ03906.1|  hypothetical protein OsI_26040                          144   9e-42   Oryza sativa Indica Group [Indian rice]
emb|CDY70361.1|  BnaAnng33460D                                          142   9e-42   Brassica napus [oilseed rape]
gb|AEI29169.1|  ubiquitin-like protein                                  142   9e-42   Vanilla planifolia [cultivated vanilla]
ref|XP_004957594.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    144   9e-42   Setaria italica
tpg|DAA44271.1|  TPA: polyubiquitin-like protein                        142   9e-42   
ref|XP_009803293.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    143   9e-42   Nicotiana sylvestris
ref|XP_003058683.1|  predicted protein                                  142   9e-42   Micromonas pusilla CCMP1545
ref|XP_009601703.1|  PREDICTED: ubiquitin-like isoform X1               142   9e-42   Nicotiana tomentosiformis
ref|XP_009601704.1|  PREDICTED: ubiquitin-like isoform X2               142   9e-42   Nicotiana tomentosiformis
ref|NP_001235900.1|  polyubiquitin                                      142   9e-42   
gb|KFK24775.1|  hypothetical protein AALP_AA8G023100                    142   9e-42   Arabis alpina [alpine rockcress]
emb|CAD56223.1|  polyubiquitin                                          142   9e-42   Cicer arietinum [garbanzo]
dbj|BAA76429.1|  polyubiquitin                                          142   1e-41   Cicer arietinum [garbanzo]
emb|CAA70324.1|  ubiquitin                                              142   1e-41   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_002503063.1|  predicted protein                                  142   1e-41   Micromonas commoda
gb|ABC68439.1|  putative polyubiquitin                                  142   1e-41   Tragopogon dubius [yellow salsify]
ref|XP_009803295.1|  PREDICTED: ubiquitin isoform X3                    143   1e-41   Nicotiana sylvestris
ref|XP_009803294.1|  PREDICTED: ubiquitin isoform X2                    143   1e-41   Nicotiana sylvestris
ref|XP_010046733.1|  PREDICTED: ubiquitin                               142   1e-41   Eucalyptus grandis [rose gum]
gb|ABB55360.1|  polyubiquitin-like                                      142   1e-41   Solanum tuberosum [potatoes]
emb|CDY39163.1|  BnaC09g21810D                                          142   1e-41   Brassica napus [oilseed rape]
gb|AGZ90161.1|  ubiquitin                                               142   1e-41   Litsea cubeba [may chang]
gb|KJB22478.1|  hypothetical protein B456_004G049300                    143   1e-41   Gossypium raimondii
ref|XP_006576160.1|  PREDICTED: uncharacterized protein LOC100306...    143   1e-41   
dbj|GAA98827.1|  hypothetical protein E5Q_05515                         144   1e-41   Mixia osmundae IAM 14324
gb|KJB46429.1|  hypothetical protein B456_007G368200                    142   1e-41   Gossypium raimondii
gb|AEA86332.1|  ubiquitin extension protein                             143   1e-41   Solanum nigrum
ref|XP_006430157.1|  hypothetical protein CICLE_v10013083mg             143   1e-41   
gb|EPS71799.1|  hypothetical protein M569_02961                         143   1e-41   Genlisea aurea
emb|CDR41652.1|  CYFA0S07e04632g1_1                                     145   1e-41   Cyberlindnera fabianii
emb|CEF98605.1|  Ubiquitin supergroup                                   144   1e-41   Ostreococcus tauri
gb|ELU38056.1|  ubiquitin domain-containing protein                     144   1e-41   Rhizoctonia solani AG-1 IA
gb|ABJ91201.1|  ubiquitin K48R                                          141   1e-41   synthetic construct
gb|ABJ91202.1|  ubiquitin K63R                                          141   1e-41   synthetic construct
gb|KDO70481.1|  hypothetical protein CISIN_1g032678mg                   142   1e-41   Citrus sinensis [apfelsine]
gb|ADC29516.1|  polyubiquitin                                           142   1e-41   Citrus sinensis [apfelsine]
emb|CAC84144.1|  polyubiquitin-like protein                             142   1e-41   Nicotiana tabacum [American tobacco]
ref|XP_006604643.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    143   1e-41   
gb|AGH68503.1|  ubiquitin extension protein                             143   1e-41   Ipomoea batatas [batate]
gb|AIZ74336.1|  polyubiquitin 4                                         142   1e-41   Pinus massoniana [Chinese red pine]
ref|XP_003063272.1|  predicted protein                                  145   1e-41   Micromonas pusilla CCMP1545
ref|XP_011003162.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    145   1e-41   Populus euphratica
gb|AIH15195.1|  ubiquitin-40S ribosomal protein S27a-like protein       144   1e-41   Hedychium coronarium
gb|AGO97083.1|  ubiquitin                                               143   1e-41   Cymbidium faberi
ref|XP_001909229.1|  hypothetical protein                               144   1e-41   Podospora anserina S mat+
ref|XP_008221845.1|  PREDICTED: ubiquitin                               143   2e-41   Prunus mume [ume]
ref|XP_001418619.1|  Ribosomal protein S27a, component of cytosol...    143   2e-41   Ostreococcus lucimarinus CCE9901
ref|NP_985832.1|  ubiquitin-60S ribosomal protein L40 fusion protein    143   2e-41   Eremothecium gossypii ATCC 10895
ref|XP_010519353.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Tarenaya hassleriana [spider flower]
gb|AAA70104.1|  ubiquitin fusion protein                                144   2e-41   Zea mays [maize]
gb|AGO97081.1|  ubiquitin                                               143   2e-41   Cymbidium faberi
gb|ADB85771.1|  polyubiquitin-like protein                              142   2e-41   Wolffia arrhiza
gb|KIJ06560.1|  hypothetical protein PAXINDRAFT_91823                   142   2e-41   Paxillus involutus ATCC 200175
gb|ACG31121.1|  40S ribosomal protein S27a                              144   2e-41   Zea mays [maize]
gb|AHW57997.1|  ubiquitin                                               142   2e-41   Xanthophyllomyces dendrorhous
dbj|BAK19068.1|  ubiquitin                                              142   2e-41   Ipomoea nil [qian niu]
ref|XP_009104378.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    144   2e-41   Brassica rapa
gb|ACJ83917.1|  unknown                                                 144   2e-41   Medicago truncatula
ref|XP_009383724.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    144   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001829580.1|  ubiquitin-60S ribosomal protein L40 fusion p...    142   2e-41   Coprinopsis cinerea okayama7#130
gb|KFK35409.1|  hypothetical protein AALP_AA5G280900                    144   2e-41   Arabis alpina [alpine rockcress]
ref|XP_008653168.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    144   2e-41   Zea mays [maize]
gb|ABD61727.1|  polyubiquitin                                           143   2e-41   Lupinus albus
ref|XP_003645919.1|  hypothetical protein Ecym_4019                     142   2e-41   Eremothecium cymbalariae DBVPG#7215
emb|CDO73416.1|  hypothetical protein BN946_scf185013.g50               143   2e-41   Trametes cinnabarina
gb|EMS20171.1|  large subunit ribosomal protein L40e                    142   2e-41   Rhodotorula toruloides NP11
ref|XP_001880516.1|  ubiquitin                                          141   2e-41   Laccaria bicolor S238N-H82
gb|AEE98366.1|  ubiquitin                                               143   2e-41   Deschampsia antarctica
ref|NP_191784.1|  ubiquitin-40S ribosomal protein S27a-3                144   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB49764.1|  hypothetical protein B456_008G136200                    145   2e-41   Gossypium raimondii
ref|XP_007877546.1|  hypothetical protein PFL1_06936                    142   2e-41   Anthracocystis flocculosa PF-1
gb|AAC39466.1|  polyubiquitin                                           143   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|ABR16172.1|  unknown                                                 143   2e-41   Picea sitchensis
gb|ADF36485.1|  ubiquitin extension protein                             143   2e-41   Ageratina adenophora
ref|XP_004504241.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   
ref|XP_003568865.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Brachypodium distachyon [annual false brome]
ref|XP_009133797.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    144   2e-41   Brassica rapa
ref|XP_009540734.1|  hypothetical protein HETIRDRAFT_377330             142   2e-41   Heterobasidion irregulare TC 32-1
ref|NP_566095.1|  ubiquitin-40S ribosomal protein S27a-2                143   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB36337.1|  hypothetical protein B456_006G153300                    142   2e-41   Gossypium raimondii
gb|KFH71638.1|  ubiquitin-60S ribosomal protein L40                     142   2e-41   Mortierella verticillata NRRL 6337
ref|XP_001597677.1|  ubiquitin-60S ribosomal protein L40 fusion p...    142   2e-41   Sclerotinia sclerotiorum 1980 UF-70
gb|EYU46866.1|  hypothetical protein MIMGU_mgv1a015483mg                143   2e-41   Erythranthe guttata [common monkey flower]
ref|NP_001150700.1|  40S ribosomal protein S27a                         143   2e-41   Zea mays [maize]
ref|XP_006488031.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    144   2e-41   Citrus sinensis [apfelsine]
ref|NP_001042915.1|  Os01g0328400                                       143   2e-41   
ref|XP_010506742.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Camelina sativa [gold-of-pleasure]
gb|KIR50412.1|  ubiquitin                                               142   2e-41   Cryptococcus gattii CA1280
ref|XP_003535084.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Glycine max [soybeans]
ref|XP_010507927.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Camelina sativa [gold-of-pleasure]
gb|KJB06862.1|  hypothetical protein B456_001G146500                    144   2e-41   Gossypium raimondii
gb|ACA24140.1|  ubiquitin                                               143   2e-41   Lolium temulentum
ref|XP_008793306.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Phoenix dactylifera
gb|AAL66206.1|AF386524_1  ubiquitin extension protein                   143   2e-41   Pyrus communis
sp|P47905.2|RS27A_LUPAL  RecName: Full=Ubiquitin-40S ribosomal pr...    143   2e-41   Lupinus albus
ref|XP_010107560.1|  Ubiquitin-40S ribosomal protein S27a               143   2e-41   Morus notabilis
ref|XP_006402395.1|  hypothetical protein EUTSA_v10006290mg             143   2e-41   Eutrema salsugineum [saltwater cress]
dbj|BAC80055.1|  putative ubiquitin / ribosomal protein CEP52           143   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007154497.1|  hypothetical protein PHAVU_003G1236000g            142   2e-41   Phaseolus vulgaris [French bean]
gb|KHN22999.1|  Ubiquitin-40S ribosomal protein S27a                    143   2e-41   Glycine soja [wild soybean]
emb|CDP26955.1|  Putative fusion protein: ubiquitin-cytosolic 60S...    142   2e-41   Podospora anserina S mat+
sp|P59272.2|RS27A_DAUCA  RecName: Full=Ubiquitin-40S ribosomal pr...    143   2e-41   Daucus carota [carrots]
emb|CAA80334.1|  ubiquitin extension protein                            143   2e-41   Lupinus albus
gb|ABI84265.1|  ubiquitin/ribosomal protein S27a                        143   2e-41   Arachis hypogaea [goober]
ref|XP_010552656.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Tarenaya hassleriana [spider flower]
sp|P0CG86.1|RS271_HORVU  RecName: Full=Ubiquitin-40S ribosomal pr...    143   2e-41   Hordeum vulgare [barley]
ref|XP_008026131.1|  hypothetical protein SETTUDRAFT_56731              142   2e-41   Exserohilum turcica Et28A
ref|XP_008781194.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   2e-41   Phoenix dactylifera
gb|EYU38434.1|  hypothetical protein MIMGU_mgv1a015486mg                143   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_007855933.1|  ubiquitin                                          142   2e-41   
gb|KIM38209.1|  hypothetical protein M413DRAFT_247932                   141   2e-41   Hebeloma cylindrosporum h7
gb|KDO86852.1|  hypothetical protein CISIN_1g031604mg                   143   2e-41   Citrus sinensis [apfelsine]
gb|KCW58175.1|  hypothetical protein EUGRSUZ_H00892                     143   2e-41   Eucalyptus grandis [rose gum]
ref|XP_003567648.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   2e-41   Brachypodium distachyon [annual false brome]
gb|AFK43562.1|  unknown                                                 143   2e-41   Medicago truncatula
ref|XP_003613203.1|  Ubiquitin                                          143   2e-41   Medicago truncatula
ref|XP_006397903.1|  hypothetical protein EUTSA_v10001668mg             143   2e-41   Eutrema salsugineum [saltwater cress]
gb|KDO50669.1|  hypothetical protein CISIN_1g0317061mg                  142   2e-41   Citrus sinensis [apfelsine]
gb|KIE01056.1|  ubiquitin                                               143   2e-41   Metarhizium majus ARSEF 297
ref|XP_006654079.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Oryza brachyantha
gb|AFK49579.1|  unknown                                                 143   2e-41   Lotus japonicus
emb|CBQ68978.1|  probable ubiquitin                                     143   2e-41   Sporisorium reilianum SRZ2
emb|CCK69751.1|  hypothetical protein KNAG_0C06580                      143   2e-41   Kazachstania naganishii CBS 8797
ref|XP_009416508.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_173755.1|  40S ribosomal protein S27a-1                          143   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525394.1|  ubiquitin, putative                                143   2e-41   Ricinus communis
ref|XP_006680275.1|  ubiquitin                                          140   2e-41   Batrachochytrium dendrobatidis JAM81
ref|XP_007157375.1|  hypothetical protein PHAVU_002G065000g             143   2e-41   Phaseolus vulgaris [French bean]
ref|XP_002457768.1|  hypothetical protein SORBIDRAFT_03g013260          143   2e-41   Sorghum bicolor [broomcorn]
ref|XP_004968668.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Setaria italica
ref|XP_006460460.1|  hypothetical protein AGABI2DRAFT_192160            143   2e-41   Agaricus bisporus var. bisporus H97
gb|AAZ83341.1|  ubiquitin extension protein                             143   2e-41   Gossypium hirsutum [American cotton]
gb|AHA83529.1|  ubiquitin extension protein                             143   2e-41   Hevea brasiliensis [jebe]
ref|XP_002279878.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   2e-41   Vitis vinifera
ref|XP_010731693.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    142   2e-41   
ref|XP_008649366.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Zea mays [maize]
ref|XP_004489824.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Cicer arietinum [garbanzo]
gb|KJB84421.1|  hypothetical protein B456_N024400                       142   2e-41   Gossypium raimondii
gb|ELQ39973.1|  ubiquitin                                               143   2e-41   Magnaporthe oryzae Y34
gb|AAZ53360.1|  ubiquitin extension protein                             143   2e-41   Nicotiana tabacum [American tobacco]
ref|XP_006424488.1|  hypothetical protein CICLE_v10029476mg             143   2e-41   Citrus clementina [clementine]
ref|XP_003629895.1|  Ubiquitin                                          145   2e-41   
ref|NP_001131602.1|  ubiquitin                                          143   2e-41   Zea mays [maize]
ref|NP_001237759.1|  uncharacterized protein LOC100306626               142   2e-41   Glycine max [soybeans]
ref|XP_004977103.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   Setaria italica
ref|XP_002890580.1|  hypothetical protein ARALYDRAFT_472603             143   2e-41   
gb|ACJ84122.1|  unknown                                                 143   2e-41   Medicago truncatula
gb|KIJ45726.1|  hypothetical protein M422DRAFT_166624                   140   2e-41   Sphaerobolus stellatus SS14
emb|CCL98913.1|  predicted protein                                      142   2e-41   Fibroporia radiculosa
ref|XP_010675161.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   2e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011082406.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   2e-41   Sesamum indicum [beniseed]
ref|NP_001105472.1|  ubiquitin-40S ribosomal protein S27a               143   2e-41   
gb|KIO16717.1|  hypothetical protein M407DRAFT_183161                   140   2e-41   Tulasnella calospora MUT 4182
ref|XP_008793305.1|  PREDICTED: ubiquitin-like isoform X1               142   2e-41   
ref|NP_001063507.2|  Os09g0483200                                       142   2e-41   
ref|NP_001238483.1|  uncharacterized protein LOC100527854               143   2e-41   
ref|NP_001054720.2|  Os05g0160200                                       143   2e-41   
ref|XP_007685506.1|  hypothetical protein COCMIDRAFT_88724              143   2e-41   Bipolaris oryzae ATCC 44560
ref|XP_007334275.1|  hypothetical protein AGABI1DRAFT_26321             141   2e-41   Agaricus bisporus var. burnettii JB137-S8
sp|P62980.2|RS27A_SOLLC  RecName: Full=Ubiquitin-40S ribosomal pr...    143   2e-41   Solanum lycopersicum
ref|NP_001238181.1|  uncharacterized protein LOC100527579               143   2e-41   Glycine max [soybeans]
gb|AEX13272.1|  hypothetical protein CL958Contig1_06                    141   2e-41   Pinus taeda
gb|AGF25315.1|  ubiquitin 2                                             142   2e-41   x Doritaenopsis hybrid cultivar
ref|XP_008358198.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   
ref|XP_006492389.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   2e-41   
ref|NP_001275598.1|  ubiquitin-40S ribosomal protein S27a-like          143   2e-41   Solanum tuberosum [potatoes]
ref|XP_006846976.1|  hypothetical protein AMTR_s00017p00094950          143   2e-41   Amborella trichopoda
gb|ABR29645.1|  ubiquitin                                               143   2e-41   Lolium perenne [perennial ryegrass]
ref|XP_010413295.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002876668.1|  hypothetical protein ARALYDRAFT_486730             143   3e-41   
gb|KDQ32340.1|  hypothetical protein PLEOSDRAFT_1074537                 140   3e-41   Pleurotus ostreatus PC15
ref|XP_004288657.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   3e-41   Fragaria vesca subsp. vesca
ref|NP_001275323.1|  putative ubiquitin extension protein               143   3e-41   Solanum tuberosum [potatoes]
ref|XP_002506532.1|  predicted protein                                  144   3e-41   Micromonas commoda
ref|XP_008389677.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   3e-41   Malus domestica [apple tree]
gb|ABN72579.1|  ubiquitin extension protein                             143   3e-41   Hevea brasiliensis [jebe]
ref|XP_002320950.1|  ubiquitin/ribosomal protein 27a                    143   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_003634320.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   3e-41   Vitis vinifera
ref|XP_001700313.1|  ribosomal protein L40, component of cytosoli...    142   3e-41   Chlamydomonas reinhardtii
ref|XP_001729044.1|  hypothetical protein MGL_3832                      143   3e-41   Malassezia globosa CBS 7966
ref|XP_001227904.1|  ubiquitin                                          141   3e-41   Chaetomium globosum CBS 148.51
ref|XP_003062279.1|  predicted protein                                  143   3e-41   Micromonas pusilla CCMP1545
ref|XP_002501200.1|  predicted protein                                  143   3e-41   Micromonas commoda
ref|XP_006495490.1|  PREDICTED: polyubiquitin 4-like                    142   3e-41   Citrus sinensis [apfelsine]
ref|XP_011011438.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2...    143   3e-41   Populus euphratica
ref|XP_011079491.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   3e-41   Sesamum indicum [beniseed]
ref|XP_007692333.1|  hypothetical protein COCMIDRAFT_76755              140   3e-41   Bipolaris oryzae ATCC 44560
ref|XP_009103181.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   3e-41   Brassica rapa
ref|XP_010064065.1|  PREDICTED: ubiquitin isoform X2                    142   3e-41   
gb|KDN47865.1|  Polyubiquitin                                           141   3e-41   Rhizoctonia solani AG-8 WAC10335
ref|XP_007877110.1|  hypothetical protein PFL1_01417                    144   3e-41   Anthracocystis flocculosa PF-1
ref|XP_010040181.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   3e-41   Eucalyptus grandis [rose gum]
gb|AAG13985.1|AF298826_1  ubiquitin/ribosomal protein 27a               143   3e-41   Prunus avium [gean]
gb|KDQ62896.1|  hypothetical protein JAAARDRAFT_120469                  140   3e-41   Jaapia argillacea MUCL 33604
ref|XP_011011441.1|  PREDICTED: ubiquitin isoform X3                    142   3e-41   Populus euphratica
emb|CDY04715.1|  BnaC05g18740D                                          143   3e-41   
ref|XP_010248517.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_006416085.1|  hypothetical protein EUTSA_v10008988mg             143   3e-41   Eutrema salsugineum [saltwater cress]
ref|XP_006306408.1|  hypothetical protein CARUB_v10012327mg             143   3e-41   Capsella rubella
gb|ABH08969.1|  ubiquitin extension protein                             143   3e-41   Morus bombycis
ref|NP_001269170.1|  ubiquitin-40S ribosomal protein S27a-like          143   3e-41   Cucumis sativus [cucumbers]
ref|XP_011388728.1|  ubiquitin-ribosomal 60S subunit protein L40 ...    142   3e-41   Ustilago maydis 521
gb|ADE06486.1|  putative poly-ubiquitin                                 141   3e-41   Tragopogon porrifolius [oyster plant]
ref|XP_004229050.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    143   3e-41   
ref|XP_010544941.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   3e-41   Tarenaya hassleriana [spider flower]
gb|KDP26615.1|  hypothetical protein JCGZ_17773                         143   3e-41   Jatropha curcas
gb|KHN19534.1|  Ubiquitin-60S ribosomal protein L40                     144   3e-41   Glycine soja [wild soybean]
ref|XP_010270921.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_001701380.1|  ubiquitin, minor isoform                           140   3e-41   Chlamydomonas reinhardtii
pdb|4II3|B  Chain B, Crystal Structure Of S. Pombe Ubiquitin Acti...    141   3e-41   Schizosaccharomyces pombe 972h-
ref|XP_004142977.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   3e-41   Cucumis sativus [cucumbers]
gb|AHZ94965.1|  ubiquitin                                               140   3e-41   Lilium regale
ref|XP_009414918.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   3e-41   
ref|XP_010270924.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_007417860.1|  hypothetical protein MELLADRAFT_40604              141   3e-41   Melampsora larici-populina 98AG31
dbj|BAA85750.1|  polyubiquitin                                          142   3e-41   Cucumis melo [Oriental melon]
gb|EYU41616.1|  hypothetical protein MIMGU_mgv1a015017mg                143   3e-41   Erythranthe guttata [common monkey flower]
gb|KJB75366.1|  hypothetical protein B456_012G038400                    142   3e-41   Gossypium raimondii
ref|XP_001729494.1|  hypothetical protein MGL_3529                      142   3e-41   Malassezia globosa CBS 7966
ref|XP_010460127.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   3e-41   
gb|KIJ96715.1|  hypothetical protein K443DRAFT_10451                    143   3e-41   
gb|AAL33551.1|AF436850_1  polyubiquitin                                 142   3e-41   
ref|XP_010498849.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   3e-41   
ref|XP_007294573.1|  ubiquitin                                          142   3e-41   
gb|KIK42485.1|  hypothetical protein CY34DRAFT_30585                    140   4e-41   
dbj|BAJ61942.1|  ubiquitin                                              142   4e-41   
ref|XP_001644255.1|  hypothetical protein Kpol_1030p5                   142   4e-41   
ref|XP_007871907.1|  hypothetical protein PNEG_00053                    142   4e-41   
ref|XP_009388149.1|  PREDICTED: polyubiquitin-like                      142   4e-41   
ref|XP_006374591.1|  ubiquitin/ribosomal protein 27a                    142   4e-41   
gb|AIZ74334.1|  polyubiquitin 11                                        141   4e-41   
ref|NP_001063509.1|  Os09g0483400                                       142   4e-41   
gb|EEC79343.1|  hypothetical protein OsI_20205                          140   4e-41   
ref|XP_001758298.1|  predicted protein                                  140   4e-41   
gb|KIN99986.1|  hypothetical protein M404DRAFT_777608                   140   4e-41   
ref|XP_009385098.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    142   4e-41   
ref|XP_001644721.1|  hypothetical protein Kpol_1024p16                  142   4e-41   
gb|KDO51108.1|  hypothetical protein CISIN_1g048350mg                   141   4e-41   
ref|XP_010477636.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    142   4e-41   
gb|ACU20957.1|  unknown                                                 140   4e-41   
gb|EWC46626.1|  hypothetical protein DRE_04113                          142   4e-41   
ref|XP_006832935.1|  hypothetical protein AMTR_s00095p00146440          142   4e-41   
ref|XP_007873881.1|  hypothetical protein PNEG_01906                    142   4e-41   
ref|XP_002462809.1|  hypothetical protein SORBIDRAFT_02g032360          142   4e-41   
ref|XP_007149315.1|  hypothetical protein PHAVU_005G060100g             142   4e-41   
gb|AGZ80457.1|  ubiquitin-like protein                                  142   4e-41   
ref|XP_566660.1|  ubiquitin-carboxy extension protein fusion            142   4e-41   
gb|AAA72816.1|  ubiquitin/relaxin fusion protein                        141   4e-41   
ref|XP_011116118.1|  hypothetical protein H072_10672                    142   4e-41   
gb|AGC65581.1|  UBQ5                                                    142   5e-41   
ref|XP_002173465.1|  ribomal-ubiquitin fusion protein Ubi5              142   5e-41   
ref|XP_007051235.1|  Ribosomal protein S27a / Ubiquitin family pr...    143   5e-41   
ref|XP_011120833.1|  hypothetical protein AOL_s00075g220                142   5e-41   
ref|XP_002483963.1|  ubiquitin-60S ribosomal protein L40 fusion p...    141   5e-41   
ref|XP_003568630.1|  PREDICTED: ubiquitin-like                          142   5e-41   
ref|XP_011123943.1|  hypothetical protein AOL_s00083g462                142   5e-41   
pdb|4NNJ|B  Chain B, Crystal Structure Of Uba1 In Complex With Ub...    140   5e-41   
gb|KDO51107.1|  hypothetical protein CISIN_1g038333mg                   141   5e-41   
emb|CDK24996.1|  unnamed protein product                                141   5e-41   
gb|KIJ21593.1|  hypothetical protein PAXINDRAFT_5754                    141   5e-41   
ref|XP_001779917.1|  predicted protein                                  141   5e-41   
gb|ABH06365.1|  ubiquitin                                               142   5e-41   
gb|AAM19122.1|AC103891_2  Putative ubiquitin / ribosomal protein ...    143   5e-41   
gb|KDO50668.1|  hypothetical protein CISIN_1g0317061mg                  142   5e-41   
gb|ABC66105.1|  putative pentameric polyubiquitin                       141   5e-41   
ref|XP_002979703.1|  hypothetical protein SELMODRAFT_19615              140   5e-41   
pdb|3OLM|D  Chain D, Structure And Function Of A Ubiquitin Bindin...    140   5e-41   
gb|KJF61084.1|  polyubiquitin, variant                                  140   5e-41   
ref|XP_007136488.1|  hypothetical protein PHAVU_009G049400g             141   5e-41   
ref|XP_446470.2|  ubiquitin-60S ribosomal protein L40 fusion protein    141   5e-41   
gb|AGA61762.1|  polyubiquitin 14                                        142   5e-41   
ref|XP_004173717.1|  PREDICTED: polyubiquitin-like                      141   5e-41   
dbj|BAL61088.1|  ubiquitin                                              140   5e-41   
ref|XP_002471629.1|  predicted protein                                  140   5e-41   
ref|XP_001904865.1|  hypothetical protein                               142   5e-41   
sp|P14795.2|RL40_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pro...    141   5e-41   
emb|CCX30639.1|  Similar to Ubiquitin-60S ribosomal protein L40; ...    143   5e-41   
ref|NP_012118.1|  ubiquitin-ribosomal 60S subunit protein L40A fu...    141   5e-41   
ref|XP_002553535.1|  ubiquitin-60S ribosomal protein L40 fusion p...    141   5e-41   
ref|XP_505175.1|  ubiquitin-60S ribosomal protein L40 fusion protein    141   5e-41   
ref|XP_009158529.1|  ubiquitin-60S ribosomal protein L40                141   5e-41   
ref|XP_002491396.1|  ubiquitin-60S ribosomal protein L40 fusion p...    141   5e-41   
ref|XP_010666169.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    141   5e-41   
gb|EMS21244.1|  small subunit ribosomal protein S27Ae                   142   5e-41   
ref|XP_002498283.1|  ubiquitin-60S ribosomal protein L40 fusion p...    141   5e-41   
ref|XP_003670563.1|  ubiquitin/ribosomal protein L40 fusion protein     141   5e-41   
emb|CEP63879.1|  LALA0S09e04544g1_1                                     141   5e-41   
ref|XP_003679560.1|  ubiquitin-60S ribosomal protein L40 fusion p...    141   5e-41   
gb|ESW97085.1|  Ubiquitin-60S ribosomal protein L40                     141   5e-41   
ref|XP_008809849.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    142   5e-41   
ref|XP_001645736.1|  hypothetical protein Kpol_1043p69                  141   5e-41   
gb|KGN51791.1|  hypothetical protein Csa_5G600925                       143   5e-41   
emb|CEG02746.1|  unnamed protein product                                140   6e-41   
gb|AFK42383.1|  unknown                                                 142   6e-41   
gb|AAQ08999.1|  polyubiquitin 2                                         141   6e-41   
gb|KIW49978.1|  ubiquitin-60S ribosomal protein L40                     141   6e-41   
gb|EPX73838.1|  ribosomal-ubiquitin fusion protein Ubi1                 141   6e-41   
ref|NP_565812.1|  ubiquitin-like protein RUB2                           142   6e-41   
ref|XP_010233081.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    143   6e-41   
ref|XP_007676698.1|  hypothetical protein BAUCODRAFT_490647             144   6e-41   
ref|XP_006428755.1|  hypothetical protein CICLE_v10013001mg             142   6e-41   
ref|XP_009220153.1|  ubiquitin-60S ribosomal protein L40                142   6e-41   
ref|XP_011411800.1|  hypothetical protein MAA_11504                     144   6e-41   
gb|KID80625.1|  ubiquitin                                               143   6e-41   
ref|XP_006349858.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    143   6e-41   
ref|XP_004501591.1|  PREDICTED: polyubiquitin 4-like                    142   6e-41   
ref|XP_003192124.1|  ubiquitin-carboxy extension protein fusion         141   6e-41   
ref|XP_002172615.1|  ribosomal-ubiquitin fusion protein Ubi1            141   6e-41   
ref|NP_001276242.1|  ubiquitin-NEDD8-like protein RUB1-like             142   6e-41   
ref|XP_003617537.1|  Bi-ubiquitin                                       142   6e-41   
ref|NP_593923.1|  ubiquitin-60S ribosomal protein L40 fusion protein    141   6e-41   
emb|CAJ41449.1|  monoubiquitin                                          139   6e-41   
dbj|BAD97873.1|  ubiquitin                                              139   6e-41   
ref|XP_010497209.1|  PREDICTED: polyubiquitin                           142   6e-41   
ref|XP_004976899.1|  PREDICTED: polyubiquitin 3-like                    142   6e-41   
ref|XP_002879563.1|  hypothetical protein ARALYDRAFT_482524             142   6e-41   
ref|XP_009419640.1|  PREDICTED: polyubiquitin-like                      142   6e-41   
ref|XP_003842568.1|  similar to ubiquitin/ribosomal L40 fusion pr...    141   6e-41   
ref|XP_009764000.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   6e-41   
ref|XP_004497490.1|  PREDICTED: polyubiquitin 4-like                    142   6e-41   
ref|XP_008246113.1|  PREDICTED: polyubiquitin                           142   6e-41   
emb|CCK67962.1|  hypothetical protein KNAG_0A02730                      142   6e-41   
ref|XP_002265864.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   6e-41   
gb|EEH16350.1|  ubiquitin-60S ribosomal protein L40                     142   6e-41   
ref|XP_006422000.1|  hypothetical protein CICLE_v10006134mg             142   6e-41   
ref|XP_007022456.1|  Ubiquitin 1                                        142   6e-41   
gb|KFG84570.1|  ubiquitin                                               143   6e-41   
ref|XP_001538414.1|  ubiquitin-60S ribosomal protein L40 fusion p...    141   7e-41   
gb|AAM63271.1|  unknown                                                 142   7e-41   
gb|AAZ82816.1|  ubiquitin monomer protein                               142   7e-41   
pdb|1OTR|B  Chain B, Solution Structure Of A Cue-Ubiquitin Complex      139   7e-41   
ref|XP_009758989.1|  PREDICTED: polyubiquitin                           142   7e-41   
ref|XP_006295164.1|  hypothetical protein CARUB_v10024242mg             142   7e-41   
gb|KFG85094.1|  hypothetical protein MANI_018777                        140   7e-41   
gb|ABC68440.1|  putative polyubiquitin                                  140   7e-41   
ref|XP_003711895.1|  ubiquitin-60S ribosomal protein L40                141   7e-41   
ref|XP_007149314.1|  hypothetical protein PHAVU_005G060100g             142   7e-41   
ref|XP_004248366.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   7e-41   
ref|XP_006303385.1|  hypothetical protein CARUB_v10010534mg             142   7e-41   
gb|KHC63621.1|  polyubiquitin                                           140   7e-41   
gb|KGU30436.1|  polyubiquitin                                           140   7e-41   
ref|XP_006481837.1|  PREDICTED: polyubiquitin-like                      141   7e-41   
pdb|4HCN|B  Chain B, Crystal Structure Of Burkholderia Pseudomall...    140   7e-41   
gb|EGU80543.1|  hypothetical protein FOXB_09003                         139   7e-41   
ref|XP_009420214.1|  PREDICTED: polyubiquitin                           142   7e-41   
ref|XP_010931828.1|  PREDICTED: polyubiquitin                           142   7e-41   
ref|NP_001190681.1|  ubiquitin 11                                       142   7e-41   
ref|XP_010540689.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   7e-41   
ref|XP_003682753.1|  ubiquitin                                          139   7e-41   
gb|KID90741.1|  ubiquitin                                               143   7e-41   
ref|XP_009593126.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   7e-41   
gb|ABF06579.2|  polyubiquitin                                           142   7e-41   
ref|XP_008029241.1|  hypothetical protein SETTUDRAFT_94331              142   7e-41   
sp|P0C073.2|RUB1_DESAN  RecName: Full=Ubiquitin-NEDD8-like protei...    142   7e-41   
emb|CEG02278.1|  unnamed protein product                                139   7e-41   
ref|XP_004155670.1|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40...    144   7e-41   
ref|XP_006660632.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB1...    142   7e-41   
ref|XP_007918654.1|  putative ubiquitin-60s ribosomal protein l40...    141   7e-41   
gb|EHK20259.1|  hypothetical protein TRIVIDRAFT_181110                  141   7e-41   
gb|KJB69253.1|  hypothetical protein B456_011G016600                    142   7e-41   
ref|XP_009411068.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   7e-41   
ref|XP_003563324.2|  PREDICTED: LOW QUALITY PROTEIN: ubiquitin-NE...    142   7e-41   
ref|XP_007343921.1|  ubiquitin-domain-containing protein                142   7e-41   
ref|XP_002437367.1|  hypothetical protein SORBIDRAFT_10g025670          142   7e-41   
ref|XP_007022452.1|  Ubiquitin 1 isoform 1                              142   7e-41   
ref|XP_007400913.1|  hypothetical protein PHACADRAFT_264025             142   7e-41   
dbj|GAM86569.1|  hypothetical protein ANO11243_045830                   139   8e-41   
ref|XP_001762629.1|  predicted protein                                  142   8e-41   
ref|XP_011115426.1|  hypothetical protein H072_9895                     141   8e-41   
ref|NP_986539.1|  ubiquitin-40S ribosomal protein S31 fusion protein    142   8e-41   
ref|XP_008387172.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   8e-41   
gb|AAL25813.1|  polyubiquitin                                           142   8e-41   
ref|XP_006495477.1|  PREDICTED: polyubiquitin 3-like                    142   8e-41   
gb|KDP23292.1|  hypothetical protein JCGZ_23125                         142   8e-41   
ref|NP_001063199.1|  Os09g0420800                                       142   8e-41   
ref|NP_001058221.2|  Os06g0650100                                       142   8e-41   
ref|XP_009143611.1|  PREDICTED: ubiquitin-60S ribosomal protein L...    141   8e-41   
gb|KJB69254.1|  hypothetical protein B456_011G016600                    142   8e-41   
ref|XP_002891151.1|  hypothetical protein ARALYDRAFT_473638             142   8e-41   
ref|XP_003671444.1|  hypothetical protein NDAI_0H00270                  139   8e-41   
ref|XP_009394342.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB1       142   8e-41   
gb|KIK50599.1|  hypothetical protein GYMLUDRAFT_51110                   142   8e-41   
gb|KIR83631.1|  polyubiquitin                                           140   8e-41   
ref|XP_011082017.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   8e-41   
ref|XP_008226114.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   8e-41   
gb|AGF25314.1|  ubiquitin 1                                             141   8e-41   
gb|KIX06312.1|  ubiquitin-60S ribosomal protein L40                     142   8e-41   
gb|AAC13689.1|  ubiquitin fusion protein                                141   8e-41   
ref|XP_009609090.1|  PREDICTED: polyubiquitin 11                        142   8e-41   
gb|EJT49277.1|  ubiquitin fusion protein                                140   8e-41   
gb|KDP36032.1|  hypothetical protein JCGZ_09998                         142   8e-41   
gb|EYU22033.1|  hypothetical protein MIMGU_mgv1a015529mg                142   8e-41   
ref|XP_011040332.1|  PREDICTED: ubiquitin-40S ribosomal protein S...    142   8e-41   
gb|EYU29189.1|  hypothetical protein MIMGU_mgv1a015494mg                142   8e-41   
emb|CAI51312.2|  polyubiquitin                                          142   8e-41   
gb|KIO29915.1|  hypothetical protein M407DRAFT_242430                   142   8e-41   
ref|XP_009143639.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   8e-41   
gb|KHG04905.1|  Ubiquitin-NEDD8-like protein RUB1                       142   8e-41   
ref|XP_010064064.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2...    142   8e-41   
ref|XP_004294063.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   8e-41   
ref|XP_007202716.1|  hypothetical protein PRUPE_ppa012799mg             142   8e-41   
gb|KDQ06872.1|  hypothetical protein BOTBODRAFT_39300                   142   8e-41   
emb|CCO31835.1|  Ubiquitin-40S ribosomal protein S27a AltName: Fu...    142   8e-41   
ref|XP_006461860.1|  hypothetical protein AGABI2DRAFT_193235            142   8e-41   
gb|AFU90137.2|  polyubiquitin                                           142   8e-41   
ref|XP_010763225.1|  ubiquitin-60S ribosomal protein L40                142   8e-41   
gb|AAC49970.1|  ubiquitin                                               139   8e-41   
ref|XP_006683968.1|  hypothetical protein CANTEDRAFT_112445             142   8e-41   
gb|KIK16797.1|  hypothetical protein PISMIDRAFT_686019                  140   8e-41   
gb|EUC60885.1|  ubiquitin/40S ribosomal protein S27a fusion protein     142   8e-41   
ref|XP_006410729.1|  hypothetical protein EUTSA_v10017351mg             142   8e-41   
gb|KIK48311.1|  hypothetical protein CY34DRAFT_705963                   142   9e-41   
gb|EPT02993.1|  hypothetical protein FOMPIDRAFT_1142989                 142   9e-41   
ref|XP_006675175.1|  hypothetical protein BATDEDRAFT_18421              142   9e-41   
ref|NP_564379.2|  ubiquitin-NEDD8-like protein RUB1                     142   9e-41   
ref|XP_007865027.1|  ubiquitin-domain-containing protein                142   9e-41   
ref|XP_010509584.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   9e-41   
ref|XP_002302153.1|  hypothetical protein POPTR_0002s06320g             142   9e-41   
gb|KHC35477.1|  polyubiquitin                                           139   9e-41   
ref|XP_003619702.1|  Ubiquitin-like protein                             144   9e-41   
ref|XP_002469300.1|  ubiquitin/40s ribosomal protein S27a fusion        142   9e-41   
ref|XP_010460963.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   9e-41   
ref|XP_001902301.1|  ubiquitin-like protein                             141   9e-41   
gb|AHI85710.1|  stress-induced protein 5                                142   9e-41   
ref|XP_007368145.1|  ubiquitin/40s ribosomal protein S27a fusion        142   9e-41   
ref|XP_002270170.1|  PREDICTED: ubiquitin-40S ribosomal protein S27a    142   9e-41   
ref|XP_010518981.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2       142   9e-41   
gb|KCW88823.1|  hypothetical protein EUGRSUZ_A01161                     139   9e-41   
gb|KDP25088.1|  hypothetical protein JCGZ_22623                         142   9e-41   
gb|KDB11525.1|  ubiquitin                                               142   9e-41   
gb|ACD80080.1|  polyubiquitin                                           139   9e-41   
ref|XP_011011440.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB2...    142   9e-41   
gb|AIC33058.1|  putative polyubiquitin                                  142   9e-41   
sp|P0CG83.1|UBIQP_HORVU  RecName: Full=Polyubiquitin; Contains: R...    142   9e-41   
ref|NP_001191575.1|  ubiquitin                                          139   9e-41   
emb|CDP04258.1|  unnamed protein product                                142   9e-41   
ref|XP_008456305.1|  PREDICTED: ubiquitin-NEDD8-like protein RUB1       142   9e-41   
gb|KIJ65589.1|  hypothetical protein HYDPIDRAFT_39518                   142   9e-41   
emb|CDX84182.1|  BnaC04g09440D                                          142   9e-41   
gb|EJU03816.1|  ubiquitin                                               142   9e-41   



>gb|KCW58176.1| hypothetical protein EUGRSUZ_H00892 [Eucalyptus grandis]
Length=214

 Score =   149 bits (375),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_007039159.1| Ubiquitin supergroup,Ribosomal protein L40e [Theobroma cacao]
 gb|EOY23660.1| Ubiquitin supergroup,Ribosomal protein L40e [Theobroma cacao]
Length=151

 Score =   146 bits (369),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  23   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  82

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  83   NIQKESTLHLV  93



>pir||S42643 ubiquitin / ribosomal protein S27a - potato (fragment)
Length=126

 Score =   145 bits (366),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  45   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  104

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  105  NIQKESTLHLV  115



>ref|XP_008439961.1| PREDICTED: polyubiquitin-like [Cucumis melo]
Length=157

 Score =   146 bits (368),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  80   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  139

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  140  NIQKESTLHLV  150



>ref|XP_010271616.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Nelumbo 
nucifera]
Length=151

 Score =   146 bits (368),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  23   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  82

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  83   NIQKESTLHLV  93



>ref|XP_006444583.1| hypothetical protein CICLE_v10024476mg, partial [Citrus clementina]
 gb|ESR57823.1| hypothetical protein CICLE_v10024476mg, partial [Citrus clementina]
Length=96

 Score =   144 bits (363),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  22   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  81

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  82   NIQKESTLHLV  92



>gb|EYU19679.1| hypothetical protein MIMGU_mgv1a015002mg [Erythranthe guttata]
Length=171

 Score =   146 bits (368),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  43   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  102

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  103  NIQKESTLHLV  113



>gb|KIL71143.1| hypothetical protein M378DRAFT_202901 [Amanita muscaria Koide 
BX008]
Length=102

 Score =   144 bits (362),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DY
Sbjct  23   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLNDY  82

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  83   NIQKESTLHLV  93



>emb|CCA26421.1| ubiquitinribosomal fusion protein putative [Albugo laibachii 
Nc14]
Length=128

 Score =   144 bits (364),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006373839.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 gb|ERP51636.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
Length=101

 Score =   144 bits (362),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003327364.1| ubiquitin-60S ribosomal protein L40 fusion protein [Puccinia 
graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP82945.1| large subunit ribosomal protein L40e [Puccinia graminis f. sp. 
tritici CRL 75-36-700-3]
Length=204

 Score =   147 bits (370),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  76   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  135

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  136  NIQKESTLHLV  146



>ref|XP_006292019.1| hypothetical protein CARUB_v10018208mg [Capsella rubella]
 gb|EOA24917.1| hypothetical protein CARUB_v10018208mg [Capsella rubella]
Length=142

 Score =   144 bits (364),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  14   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  73

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  74   NIQKESTLHLV  84



>gb|ABK93609.1| unknown [Populus trichocarpa]
Length=120

 Score =   144 bits (362),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CDX79186.1| BnaC06g21170D [Brassica napus]
Length=163

 Score =   145 bits (366),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  66   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  125

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  126  NIQKESTLHLV  136



>sp|P51423.2|RL40_BRARP RecName: Full=Ubiquitin-60S ribosomal protein L40; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=60S ribosomal 
protein L40; AltName: Full=CEP52; Flags: Precursor [Brassica 
rapa subsp. pekinensis]
 gb|AAA33014.1| ubiquitin/ribosomal protein [Brassica rapa]
 emb|CAA80863.1| ubiquitin/ribosomal protein [Brassica rapa]
Length=128

 Score =   144 bits (363),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CCI48433.1| unnamed protein product [Albugo candida]
Length=151

 Score =   145 bits (365),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            +MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  23   RMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  82

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  83   NIQKESTLHLV  93



>gb|ADQ55418.1| ubiquitin 2, partial [Oryza coarctata]
Length=76

 Score =   142 bits (358),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002465593.1| hypothetical protein SORBIDRAFT_01g041800 [Sorghum bicolor]
 ref|XP_002459842.1| hypothetical protein SORBIDRAFT_02g012040 [Sorghum bicolor]
 ref|XP_004956212.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2-like [Setaria 
italica]
 ref|XP_004985089.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2-like [Setaria 
italica]
 ref|XP_008653176.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 isoform X2 [Zea 
mays]
 ref|XP_008653188.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Zea mays]
 ref|XP_008670036.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Zea mays]
 gb|ACG24452.1| ubiquitin fusion protein [Zea mays]
 gb|ACG24619.1| ubiquitin fusion protein [Zea mays]
 gb|ACG25216.1| ubiquitin fusion protein [Zea mays]
 gb|ACG27388.1| ubiquitin fusion protein [Zea mays]
 gb|ACG30617.1| ubiquitin fusion protein [Zea mays]
 gb|ACG38853.1| ubiquitin fusion protein [Zea mays]
 gb|ACG39323.1| ubiquitin fusion protein [Zea mays]
 gb|ACN25894.1| unknown [Zea mays]
 gb|EER92591.1| hypothetical protein SORBIDRAFT_01g041800 [Sorghum bicolor]
 gb|EER96363.1| hypothetical protein SORBIDRAFT_02g012040 [Sorghum bicolor]
 tpg|DAA39608.1| TPA: Ubiquitin fusion protein [Zea mays]
 tpg|DAA44269.1| TPA: Ubiquitin fusion protein [Zea mays]
 tpg|DAA44272.1| TPA: Ubiquitin fusion protein [Zea mays]
Length=129

 Score =   144 bits (363),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|EPS73110.1| hypothetical protein M569_01646, partial [Genlisea aurea]
Length=157

 Score =   145 bits (365),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  1    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  60

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  61   NIQKESTLHLV  71



>gb|ABK93568.1| unknown [Populus trichocarpa]
Length=128

 Score =   144 bits (363),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002318470.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 ref|XP_002321972.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 ref|XP_004230014.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Solanum lycopersicum]
 ref|XP_004235004.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Solanum lycopersicum]
 ref|XP_004244655.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Solanum lycopersicum]
 ref|XP_004245458.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Solanum lycopersicum]
 ref|XP_004303537.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Fragaria vesca 
subsp. vesca]
 ref|XP_004307922.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Fragaria vesca 
subsp. vesca]
 ref|XP_006339755.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum 
tuberosum]
 ref|XP_006343783.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum 
tuberosum]
 ref|XP_006350492.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum 
tuberosum]
 ref|XP_006352212.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum 
tuberosum]
 ref|XP_006367353.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Solanum 
tuberosum]
 ref|XP_002322818.2| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 ref|XP_008381409.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Malus domestica]
 ref|XP_008376789.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Malus domestica]
 ref|XP_008387026.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Malus domestica]
 ref|XP_008343804.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Malus domestica]
 ref|XP_008367323.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Malus domestica]
 ref|XP_009351937.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Pyrus x bretschneideri]
 ref|XP_009361304.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Pyrus x bretschneideri]
 ref|XP_009366733.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Pyrus x bretschneideri]
 ref|XP_009372513.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Pyrus x bretschneideri]
 ref|XP_009350153.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Pyrus x bretschneideri]
 ref|XP_009399192.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411947.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414579.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009625575.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana tomentosiformis]
 ref|XP_009631115.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana tomentosiformis]
 ref|XP_011043720.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Populus euphratica]
 ref|XP_011044710.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Populus euphratica]
 ref|XP_011004705.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Populus euphratica]
 gb|ABK93924.1| unknown [Populus trichocarpa]
 gb|ABK94570.1| unknown [Populus trichocarpa]
 gb|ABK95887.1| unknown [Populus trichocarpa]
 gb|EEE96690.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 gb|EEF06099.1| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
 gb|ADW66126.1| ubiquitin extension protein [Solanum nigrum]
 gb|AFP55586.1| ubiquitin [Rosa rugosa]
 gb|EEF04579.2| UBIQUITIN EXTENSION protein 1 [Populus trichocarpa]
Length=128

 Score =   144 bits (362),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CEG01448.1| Ubiquitin supergroup [Ostreococcus tauri]
Length=128

 Score =   144 bits (362),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_008354260.1| PREDICTED: ubiquitin [Malus domestica]
Length=126

 Score =   144 bits (362),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>dbj|BAB32735.1| ubiquitin [Eustoma grandiflorum]
Length=100

 Score =   143 bits (360),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003558419.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Brachypodium 
distachyon]
 ref|XP_003578682.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Brachypodium 
distachyon]
 gb|EMS48574.1| Ubiquitin-60S ribosomal protein L40-2 [Triticum urartu]
Length=129

 Score =   144 bits (362),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AAX22106.1| polyubiquitin, partial [Oryza sativa Indica Group]
Length=79

 Score =   142 bits (358),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KFK38522.1| hypothetical protein AALP_AA3G124500 [Arabis alpina]
Length=128

 Score =   144 bits (362),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006430159.1| hypothetical protein CICLE_v10013083mg [Citrus clementina]
 gb|ESR43399.1| hypothetical protein CICLE_v10013083mg [Citrus clementina]
 gb|KDO70482.1| hypothetical protein CISIN_1g032678mg [Citrus sinensis]
 gb|KDO70483.1| hypothetical protein CISIN_1g032678mg [Citrus sinensis]
Length=136

 Score =   144 bits (363),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AAF78520.1|AF195224_1 ubiquitin fusion protein [Pyrus pyrifolia]
Length=108

 Score =   143 bits (360),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010683693.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Beta vulgaris 
subsp. vulgaris]
Length=128

 Score =   144 bits (362),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|EMD85945.1| hypothetical protein COCHEDRAFT_43242, partial [Bipolaris maydis 
C5]
Length=78

 Score =   142 bits (358),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  63   IQKESTLHLV  72



>gb|KEH35478.1| ubiquitin-60S ribosomal L40 fusion protein [Medicago truncatula]
Length=140

 Score =   144 bits (363),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|EGN93533.1| hypothetical protein SERLA73DRAFT_63550 [Serpula lacrymans var. 
lacrymans S7.3]
Length=101

 Score =   143 bits (360),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>dbj|BAK18566.1| N-terminal end of polyubiquitin [Mesembryanthemum crystallinum]
Length=75

 Score =   142 bits (358),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>sp|P69310.1|UBIQ_AVESA RecName: Full=Ubiquitin [Avena sativa]
 gb|AAB18258.1| ubiquitin, partial [Malus domestica]
 emb|CAB96875.1| ubiquitin [Medicago truncatula]
 emb|CAH56488.1| ubiquitin [Plantago major]
 gb|ABH08967.1| ubiquitin [Bombyx mandarina]
 gb|ABJ91200.1| ubiquitin [synthetic construct]
 gb|ABN49925.1| ubiquitin [Solanum lycopersicum]
 gb|ABQ08184.1| ubiquitin, partial [Aloe vera]
 gb|ADO17492.1| polyubiquitin [Solanum tuberosum]
 gb|AFD33420.1| ubiquitin, partial [Rosa roxburghii]
 prf||1207189A ubiquitin
Length=76

 Score =   142 bits (358),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AAA96951.1| polyubiquitin, partial [Solanum tuberosum]
Length=99

 Score =   142 bits (359),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/23 (100%), Positives = 23/23 (100%), Gaps = 0/23 (0%)
 Frame = +2

Query  5   MQIFVKTLTGKTITLEVESSDTI  73
           MQIFVKTLTGKTITLEVESSDTI
Sbjct  77  MQIFVKTLTGKTITLEVESSDTI  99



>ref|XP_007202754.1| hypothetical protein PRUPE_ppa013349mg [Prunus persica]
 ref|XP_007218596.1| hypothetical protein PRUPE_ppa013338mg [Prunus persica]
 ref|XP_008234674.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Prunus mume]
 ref|XP_008243521.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Prunus mume]
 gb|EMJ03953.1| hypothetical protein PRUPE_ppa013349mg [Prunus persica]
 gb|EMJ19795.1| hypothetical protein PRUPE_ppa013338mg [Prunus persica]
Length=128

 Score =   144 bits (362),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>tpe|CAI56329.1| TPA: ubiquitin-60S ribosomal L40 fusion protein [Vitis vinifera]
Length=128

 Score =   144 bits (362),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>sp|P49636.2|RL40_NICSY RecName: Full=Ubiquitin-60S ribosomal protein L40; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=60S ribosomal 
protein L40; AltName: Full=CEP52; Flags: Precursor [Nicotiana 
sylvestris]
 gb|AAA34064.1| ubiquitin fusion protein [Nicotiana sylvestris]
Length=128

 Score =   144 bits (362),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002530306.1| ubiquitin, putative [Ricinus communis]
 ref|XP_002530340.1| ubiquitin, putative [Ricinus communis]
 ref|XP_003523336.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Glycine 
max]
 ref|XP_003526741.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Glycine 
max]
 ref|XP_003554448.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like isoform X1 
[Glycine max]
 ref|XP_004137208.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis 
sativus]
 ref|XP_004145956.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis 
sativus]
 ref|XP_004160396.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cucumis 
sativus]
 ref|XP_006295234.1| hypothetical protein CARUB_v10024320mg [Capsella rubella]
 ref|XP_006403788.1| hypothetical protein EUTSA_v10010818mg [Eutrema salsugineum]
 ref|XP_006410789.1| hypothetical protein EUTSA_v10017417mg [Eutrema salsugineum]
 ref|XP_006430158.1| hypothetical protein CICLE_v10013083mg [Citrus clementina]
 ref|XP_006441206.1| hypothetical protein CICLE_v10022855mg [Citrus clementina]
 ref|XP_006481744.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Citrus sinensis]
 ref|XP_006493171.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Citrus sinensis]
 ref|XP_007027811.1| Ubiquitin extension protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007162922.1| hypothetical protein PHAVU_001G191700g [Phaseolus vulgaris]
 ref|XP_008437646.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Cucumis melo]
 ref|XP_008788944.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Phoenix dactylifera]
 ref|XP_008806099.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Phoenix dactylifera]
 ref|XP_008778063.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Phoenix dactylifera]
 ref|XP_009133066.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Brassica rapa]
 ref|XP_009115957.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Brassica rapa]
 ref|XP_009611807.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana tomentosiformis]
 ref|XP_009591639.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana tomentosiformis]
 ref|XP_009782560.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana sylvestris]
 ref|XP_009785771.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana sylvestris]
 ref|XP_009796884.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nicotiana sylvestris]
 ref|XP_010048686.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Eucalyptus grandis]
 ref|XP_010036664.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Eucalyptus grandis]
 ref|XP_010090891.1| Ubiquitin-60S ribosomal protein L40 [Morus notabilis]
 ref|XP_010245724.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Nelumbo nucifera]
 ref|XP_010509505.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Camelina sativa]
 ref|XP_010516825.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Camelina sativa]
 ref|XP_010527444.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Tarenaya hassleriana]
 ref|XP_010543797.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Tarenaya hassleriana]
 ref|XP_010553389.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Tarenaya hassleriana]
 ref|XP_010558020.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Tarenaya hassleriana]
 ref|XP_010654111.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Vitis vinifera]
 ref|XP_010931116.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Elaeis guineensis]
 ref|XP_010943781.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Elaeis guineensis]
 ref|XP_010943822.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Elaeis guineensis]
 ref|XP_011094277.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Sesamum indicum]
 ref|XP_011075913.1| PREDICTED: ubiquitin-60S ribosomal protein L40 [Sesamum indicum]
 gb|AAZ20285.1| ubiquitin fusion protein [Arachis hypogaea]
 emb|CAN60770.1| hypothetical protein VITISV_012429 [Vitis vinifera]
 gb|ABR17437.1| unknown [Picea sitchensis]
 gb|EEF32056.1| ubiquitin, putative [Ricinus communis]
 gb|EEF32073.1| ubiquitin, putative [Ricinus communis]
 gb|ADB85098.1| ubiquitin C variant [Jatropha curcas]
 emb|CBI30322.3| unnamed protein product [Vitis vinifera]
 gb|AEC10952.1| ubiquitin fusion protein [Camellia sinensis]
 gb|AFK46422.1| unknown [Lotus japonicus]
 gb|EOA28132.1| hypothetical protein CARUB_v10024320mg [Capsella rubella]
 gb|EOY08313.1| Ubiquitin extension protein 1 isoform 1 [Theobroma cacao]
 gb|ESQ45241.1| hypothetical protein EUTSA_v10010818mg [Eutrema salsugineum]
 gb|ESQ52242.1| hypothetical protein EUTSA_v10017417mg [Eutrema salsugineum]
 gb|ESR43398.1| hypothetical protein CICLE_v10013083mg [Citrus clementina]
 gb|ESR54446.1| hypothetical protein CICLE_v10022855mg [Citrus clementina]
 gb|ESW34916.1| hypothetical protein PHAVU_001G191700g [Phaseolus vulgaris]
 gb|EXB41096.1| Ubiquitin-60S ribosomal protein L40 [Morus notabilis]
 gb|KDO70480.1| hypothetical protein CISIN_1g032678mg [Citrus sinensis]
 emb|CDP12226.1| unnamed protein product [Coffea canephora]
 emb|CDP08635.1| unnamed protein product [Coffea canephora]
 emb|CDX95351.1| BnaC04g28070D [Brassica napus]
 emb|CDX84576.1| BnaA03g16540D [Brassica napus]
 emb|CDX84153.1| BnaC04g09150D [Brassica napus]
 emb|CDX79660.1| BnaC03g19960D [Brassica napus]
 emb|CDX78108.1| BnaA09g33030D [Brassica napus]
 emb|CDX75065.1| BnaA05g08110D [Brassica napus]
 emb|CDX75066.1| BnaA05g08120D [Brassica napus]
 gb|KHG22768.1| Ubiquitin-60S ribosomal L40 [Gossypium arboreum]
 gb|KHN18789.1| Ubiquitin-60S ribosomal protein L40 [Glycine soja]
 gb|KHN23324.1| Ubiquitin-60S ribosomal protein L40 [Glycine soja]
 gb|KJB36319.1| hypothetical protein B456_006G153600 [Gossypium raimondii]
 gb|KJB36336.1| hypothetical protein B456_006G153300 [Gossypium raimondii]
 gb|KJB39497.1| hypothetical protein B456_007G016700 [Gossypium raimondii]
 gb|KJB46427.1| hypothetical protein B456_007G368200 [Gossypium raimondii]
 gb|KJB52528.1| hypothetical protein B456_008G266000 [Gossypium raimondii]
Length=128

 Score =   144 bits (362),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002273568.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Vitis vinifera]
 emb|CBI23063.3| unnamed protein product [Vitis vinifera]
Length=128

 Score =   144 bits (362),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_009419594.1| PREDICTED: ubiquitin [Musa acuminata subsp. malaccensis]
Length=77

 Score =   142 bits (358),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_565836.1| 60S ribosomal protein L40-1 [Arabidopsis thaliana]
 ref|NP_566969.1| ubiquitin extension protein 1 [Arabidopsis thaliana]
 ref|XP_010504006.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Camelina sativa]
 ref|XP_010515730.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Camelina sativa]
 ref|XP_010426881.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 [Camelina sativa]
 sp|Q42202.2|RL40B_ARATH RecName: Full=Ubiquitin-60S ribosomal protein L40-2; AltName: 
Full=Protein EARLY-RESPONSIVE TO DEHYDRATION 16; AltName: Full=Protein 
EMBRYO DEFECTIVE 2167; AltName: Full=Protein HAPLESS 
4; Contains: RecName: Full=Ubiquitin; Contains: RecName: 
Full=60S ribosomal protein L40-2; AltName: Full=CEP52; Flags: 
Precursor [Arabidopsis thaliana]
 sp|B9DHA6.1|RL40A_ARATH RecName: Full=Ubiquitin-60S ribosomal protein L40-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=60S ribosomal 
protein L40-1; AltName: Full=CEP52; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK26021.1|AF360311_1 putative ubiquitin extension protein UBQ2 [Arabidopsis thaliana]
 gb|AAA32904.1| ubiquitin extension protein (UBQ1) [Arabidopsis thaliana]
 gb|AAA32905.1| ubiquitin extension protein (UBQ2) [Arabidopsis thaliana]
 emb|CAB43405.1| ubiquitin / ribosomal protein CEP52 [Arabidopsis thaliana]
 gb|AAK59652.1| putative ubiquitin extension protein UBQ1 [Arabidopsis thaliana]
 gb|AAL07246.1| putative ubiquitin extension protein UBQ2 [Arabidopsis thaliana]
 gb|AAL15186.1| putative ubiquitin extension protein UBQ1 [Arabidopsis thaliana]
 gb|AAM15407.1| ubiquitin extension protein (UBQ2) [Arabidopsis thaliana]
 gb|AAM63036.1| ubiquitin extension protein UBQ1 [Arabidopsis thaliana]
 dbj|BAH20123.1| AT2G36170 [Arabidopsis thaliana]
 gb|AEC09212.1| 60S ribosomal protein L40-1 [Arabidopsis thaliana]
 gb|AEE78966.1| ubiquitin extension protein 1 [Arabidopsis thaliana]
 gb|KFK36512.1| hypothetical protein AALP_AA4G133700 [Arabis alpina]
Length=128

 Score =   144 bits (362),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>sp|P69326.2|UBIQ_WHEAT RecName: Full=Ubiquitin; Flags: Precursor [Triticum aestivum]
 emb|CAA40138.1| ubiquitin [Triticum aestivum]
 emb|CAA39938.1| ubiquitin [Triticum aestivum]
 gb|AAP50253.1| ubiquitin [Triticum aestivum]
 gb|AAX55761.1| ubiquitin [Triticum aestivum]
Length=77

 Score =   142 bits (358),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KJB46428.1| hypothetical protein B456_007G368200 [Gossypium raimondii]
Length=101

 Score =   142 bits (359),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CDY71775.1| BnaUnng04590D, partial [Brassica napus]
Length=83

 Score =   142 bits (358),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001063337.1| Os09g0452700 [Oryza sativa Japonica Group]
 dbj|BAD38019.1| putative ubiquitin / ribosomal protein CEP52 [Oryza sativa Japonica 
Group]
 dbj|BAF25251.1| Os09g0452700 [Oryza sativa Japonica Group]
 gb|EAZ09338.1| hypothetical protein OsI_31610 [Oryza sativa Indica Group]
 gb|EAZ44953.1| hypothetical protein OsJ_29596 [Oryza sativa Japonica Group]
Length=140

 Score =   144 bits (363),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AFK47149.1| unknown [Lotus japonicus]
Length=128

 Score =   144 bits (362),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003602319.1| Ubiquitin [Medicago truncatula]
 ref|XP_004494208.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cicer arietinum]
 ref|XP_004502715.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cicer arietinum]
 ref|XP_004515215.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Cicer arietinum]
 gb|ABQ32305.1| putative ubiquitin-conjugating enzyme [Artemisia annua]
 gb|ACJ84010.1| unknown [Medicago truncatula]
 gb|AES72570.1| ubiquitin-60S ribosomal L40 fusion protein [Medicago truncatula]
 gb|AFK33676.1| unknown [Medicago truncatula]
 gb|AFK34296.1| unknown [Medicago truncatula]
 gb|AFK38276.1| unknown [Medicago truncatula]
 gb|EYU32285.1| hypothetical protein MIMGU_mgv1a016271mg [Erythranthe guttata]
 gb|KEH24146.1| ubiquitin-60S ribosomal L40 fusion protein [Medicago truncatula]
 gb|KEH42002.1| ubiquitin-60S ribosomal L40 fusion protein [Medicago truncatula]
Length=128

 Score =   144 bits (362),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABH08968.1| ubiquitin [Morus bombycis]
Length=78

 Score =   142 bits (357),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KIK29708.1| hypothetical protein PISMIDRAFT_439235 [Pisolithus microcarpus 
441]
Length=102

 Score =   142 bits (359),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001049479.1| Os03g0234200 [Oryza sativa Japonica Group]
 ref|XP_006649691.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2-like isoform 
X2 [Oryza brachyantha]
 ref|XP_006660995.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2-like [Oryza 
brachyantha]
 sp|P0CH35.1|RL40B_ORYSJ RecName: Full=Ubiquitin-60S ribosomal protein L40-2; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=60S ribosomal 
protein L40-2; AltName: Full=CEP52; Flags: Precursor [Oryza 
sativa Japonica Group]
 sp|P0CH34.1|RL40A_ORYSJ RecName: Full=Ubiquitin-60S ribosomal protein L40-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=60S ribosomal 
protein L40-1; AltName: Full=CEP52; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAA02154.1| ubiquitin/ribosomal polyprotein [Oryza sativa Japonica Group]
 dbj|BAB33149.1| ubiquitin fused to ribosomal protein L40 [Oryza sativa]
 dbj|BAB33150.1| ubiquitin fused to ribosomal protein L40 [Oryza sativa]
 dbj|BAD46215.1| ubiquitin / ribosomal protein CEP52 [Oryza sativa Japonica Group]
 gb|ABF94825.1| ubiquitin fusion protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11393.1| Os03g0234200 [Oryza sativa Japonica Group]
 gb|EAZ45723.1| hypothetical protein OsJ_30399 [Oryza sativa Japonica Group]
 gb|EEC85088.1| hypothetical protein OsI_32449 [Oryza sativa Indica Group]
Length=129

 Score =   144 bits (362),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_007027812.1| Ubiquitin extension protein 1 isoform 2 [Theobroma cacao]
 gb|EOY08314.1| Ubiquitin extension protein 1 isoform 2 [Theobroma cacao]
Length=98

 Score =   142 bits (359),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|EPT03401.1| hypothetical protein FOMPIDRAFT_51332 [Fomitopsis pinicola FP-58527 
SS1]
Length=100

 Score =   142 bits (359),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABK42077.1| ubiquitin extension protein [Capsicum annuum]
Length=179

 Score =   145 bits (366),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  23   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  82

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  83   NIQKESTLHLV  93



>emb|CDX95544.1| BnaC01g34360D [Brassica napus]
Length=77

 Score =   142 bits (357),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001059668.2| Os07g0489500 [Oryza sativa Japonica Group]
 dbj|BAF21582.2| Os07g0489500 [Oryza sativa Japonica Group]
Length=135

 Score =   144 bits (362),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABR25913.1| polyubiquitin containing 7 ubiquitin monomers [Oryza sativa Indica 
Group]
Length=81

 Score =   142 bits (357),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  64

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  65   IQKESTLHLV  74



>gb|KCW48292.1| hypothetical protein EUGRSUZ_K020232, partial [Eucalyptus grandis]
 gb|KDO44261.1| hypothetical protein CISIN_1g0330481mg, partial [Citrus sinensis]
Length=97

 Score =   142 bits (359),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CDY71299.1| BnaA08g30590D, partial [Brassica napus]
Length=82

 Score =   142 bits (358),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|EAZ03906.1| hypothetical protein OsI_26040 [Oryza sativa Indica Group]
 gb|EAZ39848.1| hypothetical protein OsJ_24288 [Oryza sativa Japonica Group]
Length=139

 Score =   144 bits (362),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CDY70361.1| BnaAnng33460D, partial [Brassica napus]
Length=105

 Score =   142 bits (359),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70


 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAK  91
            MQIFVKTLTGKTITLEVESSDTIDNVK K
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKTK  105



>gb|AEI29169.1| ubiquitin-like protein [Vanilla planifolia]
Length=95

 Score =   142 bits (359),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  19   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  78

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  79   IQKESTLHLV  88



>ref|XP_004957594.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Setaria 
italica]
Length=141

 Score =   144 bits (362),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>tpg|DAA44271.1| TPA: polyubiquitin-like protein [Zea mays]
Length=100

 Score =   142 bits (359),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_009803293.1| PREDICTED: ubiquitin-60S ribosomal protein L40 isoform X1 [Nicotiana 
sylvestris]
Length=128

 Score =   143 bits (361),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003058683.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57138.1| predicted protein [Micromonas pusilla CCMP1545]
Length=98

 Score =   142 bits (359),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_009601703.1| PREDICTED: ubiquitin-like isoform X1 [Nicotiana tomentosiformis]
Length=108

 Score =   142 bits (359),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_009601704.1| PREDICTED: ubiquitin-like isoform X2 [Nicotiana tomentosiformis]
Length=101

 Score =   142 bits (359),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001235900.1| polyubiquitin [Glycine max]
 ref|XP_004173651.1| PREDICTED: ubiquitin-like [Cucumis sativus]
 ref|XP_006377836.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 sp|P69313.2|UBIQ_HELAN RecName: Full=Ubiquitin; Flags: Precursor [Helianthus annuus]
 sp|P69317.2|UBIQ_LUPPO RecName: Full=Ubiquitin; Flags: Precursor [Lupinus polyphyllus]
 emb|CAA31627.1| unnamed protein product [Glycine max]
 emb|CAA32511.1| unnamed protein product [Helianthus annuus]
 emb|CAA38256.1| ubiquitin [Lupinus polyphyllus]
 gb|AAR83892.1| polyubiquitin 4.4 [Capsicum annuum]
 gb|ERP55633.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|KDP42861.1| hypothetical protein JCGZ_23803 [Jatropha curcas]
Length=77

 Score =   142 bits (357),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KFK24775.1| hypothetical protein AALP_AA8G023100 [Arabis alpina]
Length=78

 Score =   142 bits (357),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CAD56223.1| polyubiquitin [Cicer arietinum]
Length=89

 Score =   142 bits (358),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  13   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  72

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  73   IQKESTLHLV  82



>dbj|BAA76429.1| polyubiquitin [Cicer arietinum]
Length=108

 Score =   142 bits (359),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70


 Score = 63.5 bits (153),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/32 (100%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  100
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD  108



>emb|CAA70324.1| ubiquitin [Nicotiana plumbaginifolia]
Length=78

 Score =   142 bits (357),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002503063.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64321.1| predicted protein [Micromonas sp. RCC299]
Length=98

 Score =   142 bits (358),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABC68439.1| putative polyubiquitin [Tragopogon dubius]
Length=90

 Score =   142 bits (358),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  13   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  72

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  73   IQKESTLHLV  82



>ref|XP_009803295.1| PREDICTED: ubiquitin isoform X3 [Nicotiana sylvestris]
Length=119

 Score =   143 bits (360),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_009803294.1| PREDICTED: ubiquitin isoform X2 [Nicotiana sylvestris]
Length=119

 Score =   143 bits (360),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010046733.1| PREDICTED: ubiquitin [Eucalyptus grandis]
Length=78

 Score =   142 bits (357),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABB55360.1| polyubiquitin-like [Solanum tuberosum]
Length=78

 Score =   142 bits (357),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CDY39163.1| BnaC09g21810D [Brassica napus]
Length=101

 Score =   142 bits (358),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AGZ90161.1| ubiquitin, partial [Litsea cubeba]
Length=103

 Score =   142 bits (359),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  20   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  79

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  80   IQKESTLHLV  89



>gb|KJB22478.1| hypothetical protein B456_004G049300, partial [Gossypium raimondii]
Length=131

 Score =   143 bits (361),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006576160.1| PREDICTED: uncharacterized protein LOC100306626 isoform X1 [Glycine 
max]
Length=136

 Score =   143 bits (361),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>dbj|GAA98827.1| hypothetical protein E5Q_05515 [Mixia osmundae IAM 14324]
Length=164

 Score =   144 bits (363),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  37   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  96

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  97   IQKESTLHLV  106



>gb|KJB46429.1| hypothetical protein B456_007G368200 [Gossypium raimondii]
Length=103

 Score =   142 bits (358),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AEA86332.1| ubiquitin extension protein [Solanum nigrum]
Length=129

 Score =   143 bits (360),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006430157.1| hypothetical protein CICLE_v10013083mg [Citrus clementina]
 gb|ESR43397.1| hypothetical protein CICLE_v10013083mg [Citrus clementina]
Length=126

 Score =   143 bits (360),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|EPS71799.1| hypothetical protein M569_02961, partial [Genlisea aurea]
Length=129

 Score =   143 bits (360),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 70/71 (99%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  1    KMQIFVKTLTGKTITLEVESSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  60

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  61   NIQKESTLHLV  71



>emb|CDR41652.1| CYFA0S07e04632g1_1 [Cyberlindnera fabianii]
Length=198

 Score =   145 bits (366),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  70   KMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  129

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  130  NIQKESTLHLV  140



>emb|CEF98605.1| Ubiquitin supergroup [Ostreococcus tauri]
Length=150

 Score =   144 bits (362),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ELU38056.1| ubiquitin domain-containing protein [Rhizoctonia solani AG-1 
IA]
Length=179

 Score =   144 bits (364),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABJ91201.1| ubiquitin K48R [synthetic construct]
Length=76

 Score =   141 bits (356),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG+QLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGRQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABJ91202.1| ubiquitin K63R [synthetic construct]
Length=76

 Score =   141 bits (356),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQ+ESTLHLV
Sbjct  61   IQRESTLHLV  70



>gb|KDO70481.1| hypothetical protein CISIN_1g032678mg [Citrus sinensis]
Length=116

 Score =   142 bits (359),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ADC29516.1| polyubiquitin [Citrus sinensis]
 gb|AFB18313.1| ubiquitin, partial [Citrus maxima]
Length=106

 Score =   142 bits (358),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  33   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  92

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  93   IQKESTLHLV  102


 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/26 (100%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +2

Query  137  FAGKQLEDGRTLADYNIQKESTLHLV  214
            FAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    FAGKQLEDGRTLADYNIQKESTLHLV  26



>emb|CAC84144.1| polyubiquitin-like protein [Nicotiana tabacum]
Length=109

 Score =   142 bits (358),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  33   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  92

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  93   IQKESTLHLV  102


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/20 (100%), Positives = 20/20 (100%), Gaps = 0/20 (0%)
 Frame = +2

Query  155  EDGRTLADYNIQKESTLHLV  214
            EDGRTLADYNIQKESTLHLV
Sbjct  7    EDGRTLADYNIQKESTLHLV  26



>ref|XP_006604643.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like isoform X2 
[Glycine max]
Length=138

 Score =   143 bits (361),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AGH68503.1| ubiquitin extension protein, partial [Ipomoea batatas]
Length=131

 Score =   143 bits (360),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AIZ74336.1| polyubiquitin 4, partial [Pinus massoniana]
Length=107

 Score =   142 bits (358),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  33   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  92

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  93   IQKESTLHLV  102


 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/26 (100%), Positives = 26/26 (100%), Gaps = 0/26 (0%)
 Frame = +2

Query  137  FAGKQLEDGRTLADYNIQKESTLHLV  214
            FAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    FAGKQLEDGRTLADYNIQKESTLHLV  26



>ref|XP_003063272.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52408.1| predicted protein [Micromonas pusilla CCMP1545]
Length=205

 Score =   145 bits (366),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_011003162.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
Length=202

 Score =   145 bits (366),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  46   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  105

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  106  NIQKESTLHLV  116



>gb|AIH15195.1| ubiquitin-40S ribosomal protein S27a-like protein [Hedychium 
coronarium]
Length=157

 Score =   144 bits (362),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AGO97083.1| ubiquitin, partial [Cymbidium faberi]
Length=140

 Score =   143 bits (361),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_001909229.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP70361.1| unnamed protein product, partial [Podospora anserina S mat+]
Length=169

 Score =   144 bits (363),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/71 (99%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  41   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  100

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  101  NIQKESTLHLV  111



>ref|XP_008221845.1| PREDICTED: ubiquitin [Prunus mume]
Length=134

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_001418619.1| Ribosomal protein S27a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO96912.1| Ribosomal protein S27a, component of cytosolic 80S ribosome and 
40S small subunit [Ostreococcus lucimarinus CCE9901]
Length=150

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_985832.1| ubiquitin-60S ribosomal protein L40 fusion protein [Ashbya gossypii 
ATCC 10895]
 gb|AAS53656.1| AFR285Cp [Ashbya gossypii ATCC 10895]
 gb|AEY97969.1| FAFR285Cp [Ashbya gossypii FDAG1]
 emb|CCK72830.1| hypothetical protein KNAG_0L02120 [Kazachstania naganishii CBS 
8797]
Length=128

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010519353.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2, partial [Tarenaya 
hassleriana]
Length=150

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AAA70104.1| ubiquitin fusion protein [Zea mays]
 prf||2211240A ubiquitin fusion protein
Length=155

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AGO97081.1| ubiquitin, partial [Cymbidium faberi]
Length=140

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ADB85771.1| polyubiquitin-like protein [Wolffia arrhiza]
Length=114

 Score =   142 bits (358),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  38   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  97

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  98   IQKESTLHLV  107


 Score = 66.2 bits (160),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +2

Query  122  QQRLIFAGKQLEDGRTLADYNIQKESTLHLV  214
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    QQRLIFAGKQLEDGRTLADYNIQKESTLHLV  31



>gb|KIJ06560.1| hypothetical protein PAXINDRAFT_91823 [Paxillus involutus ATCC 
200175]
Length=92

 Score =   142 bits (357),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ACG31121.1| 40S ribosomal protein S27a [Zea mays]
Length=155

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AHW57997.1| ubiquitin [Xanthophyllomyces dendrorhous]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>dbj|BAK19068.1| ubiquitin [Ipomoea nil]
Length=121

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  11   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  70

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  71   IQKESTLHLV  80


 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/35 (100%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  109
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  87   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  121



>ref|XP_009104378.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3 [Brassica rapa]
 emb|CDY66301.1| BnaA04g27270D [Brassica napus]
 emb|CDY25100.1| BnaC06g18420D [Brassica napus]
 emb|CDY11410.1| BnaA09g39760D [Brassica napus]
 emb|CDX93983.1| BnaC04g21420D [Brassica napus]
 emb|CDX76623.1| BnaC08g32090D [Brassica napus]
 emb|CDX67885.1| BnaA07g19250D [Brassica napus]
Length=157

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ACJ83917.1| unknown [Medicago truncatula]
 gb|ACJ86209.1| unknown [Medicago truncatula]
 gb|AET04371.2| ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula]
Length=155

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_009383724.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_001829580.1| ubiquitin-60S ribosomal protein L40 fusion protein [Coprinopsis 
cinerea okayama7#130]
 ref|XP_003028164.1| ubiquitin-60S ribosomal protein L40 fusion protein [Schizophyllum 
commune H4-8]
 gb|EAU92224.1| ubiquitin-carboxy extension protein fusion [Coprinopsis cinerea 
okayama7#130]
 gb|EFI93261.1| hypothetical protein SCHCODRAFT_70430 [Schizophyllum commune 
H4-8]
 emb|CCO33060.1| Ubiquitin-60S ribosomal protein L40 [Rhizoctonia solani AG-1 
IB]
 gb|EUC53537.1| ubiquitin-60S ribosomal protein L40, partial [Rhizoctonia solani 
AG-3 Rhs1AP]
 emb|CEL63629.1| Ubiquitin-60S ribosomal protein L40 OS=Cryptococcus neoformans 
var, neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBI1 
PE=1 SV=2 [Rhizoctonia solani AG-1 IB]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KFK35409.1| hypothetical protein AALP_AA5G280900 [Arabis alpina]
 gb|KFK37468.1| hypothetical protein AALP_AA4G260800 [Arabis alpina]
Length=157

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_008653168.1| PREDICTED: ubiquitin-60S ribosomal protein L40-2 isoform X1 [Zea 
mays]
 tpg|DAA44270.1| TPA: polyubiquitin-like protein [Zea mays]
Length=159

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABD61727.1| polyubiquitin [Lupinus albus]
Length=132

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  95   IQKESTLHLV  104


 Score = 60.8 bits (146),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/28 (100%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  131  LIFAGKQLEDGRTLADYNIQKESTLHLV  214
            LIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    LIFAGKQLEDGRTLADYNIQKESTLHLV  28


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDT  70
            MQIFVKTLTGKTITLEVESSDT
Sbjct  111  MQIFVKTLTGKTITLEVESSDT  132



>ref|XP_003645919.1| hypothetical protein Ecym_4019 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET39102.1| hypothetical protein Ecym_4019 [Eremothecium cymbalariae DBVPG#7215]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CDO73416.1| hypothetical protein BN946_scf185013.g50 [Trametes cinnabarina]
Length=132

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|EMS20171.1| large subunit ribosomal protein L40e [Rhodosporidium toruloides 
NP11]
 emb|CDR48641.1| RHTO0S19e01398g1_1 [Rhodosporidium toruloides]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_001880516.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EDR09203.1| predicted protein [Laccaria bicolor S238N-H82]
Length=72

 Score =   141 bits (355),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AEE98366.1| ubiquitin [Deschampsia antarctica]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_191784.1| ubiquitin-40S ribosomal protein S27a-3 [Arabidopsis thaliana]
 sp|P59233.2|R27AC_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-3; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAA32906.1| ubiquitin extension protein (UBQ5) [Arabidopsis thaliana]
 emb|CAB71885.1| ubiquitin extension protein (UBQ5) [Arabidopsis thaliana]
 gb|AAK97689.1| AT3g62250/T17J13_210 [Arabidopsis thaliana]
 gb|AAM61537.1| ubiquitin extension protein UBQ5 [Arabidopsis thaliana]
 gb|AAM98116.1| At3g62250/T17J13_210 [Arabidopsis thaliana]
 dbj|BAE98979.1| ubiquitin extension protein [Arabidopsis thaliana]
 gb|AEE80327.1| ubiquitin-40S ribosomal protein S27a-3 [Arabidopsis thaliana]
Length=157

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KJB49764.1| hypothetical protein B456_008G136200, partial [Gossypium raimondii]
Length=210

 Score =   145 bits (366),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  54   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  113

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  114  NIQKESTLHLV  124



>ref|XP_007877546.1| hypothetical protein PFL1_06936 [Pseudozyma flocculosa PF-1]
 gb|EPQ30828.1| hypothetical protein PFL1_06936 [Pseudozyma flocculosa PF-1]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AAC39466.1| polyubiquitin [Arabidopsis thaliana]
Length=137

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  29   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  88

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  89   IQKESTLHLV  98


 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDK  103
            MQIFVKTLTGKTI+LEVESSDTIDNVKAKIQDK
Sbjct  105  MQIFVKTLTGKTISLEVESSDTIDNVKAKIQDK  137


 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  149  QLEDGRTLADYNIQKESTLHLV  214
            QLEDGRTLADYNIQKESTLHLV
Sbjct  1    QLEDGRTLADYNIQKESTLHLV  22



>gb|ABR16172.1| unknown [Picea sitchensis]
 gb|ABR16495.1| unknown [Picea sitchensis]
 gb|ABR16621.1| unknown [Picea sitchensis]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ADF36485.1| ubiquitin extension protein [Ageratina adenophora]
 gb|AID52926.1| ubiquitin [Carthamus tinctorius]
Length=153

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_004504241.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cicer arietinum]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003568865.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Brachypodium 
distachyon]
 dbj|BAJ88878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_009133797.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-3-like [Brassica 
rapa]
 emb|CDY50916.1| BnaC03g72450D [Brassica napus]
 emb|CDX83344.1| BnaA03g21620D [Brassica napus]
Length=157

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_009540734.1| hypothetical protein HETIRDRAFT_377330 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW86741.1| hypothetical protein HETIRDRAFT_377330 [Heterobasidion irregulare 
TC 32-1]
 gb|KDN39276.1| Ubiquitin-60S ribosomal protein L40, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_566095.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 ref|NP_001189768.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 ref|XP_002880283.1| hypothetical protein ARALYDRAFT_904186 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006296217.1| hypothetical protein CARUB_v10025382mg [Capsella rubella]
 sp|P59232.2|R27AB_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-2; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK53000.1|AF375416_1 At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|AAA32907.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAC34235.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAM65909.1| ubiquitin extension protein (UBQ6) [Arabidopsis thaliana]
 gb|AAM98297.1| At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|AAN28749.1| At2g47110/F14M4.6 [Arabidopsis thaliana]
 gb|EFH56542.1| hypothetical protein ARALYDRAFT_904186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC10801.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 gb|AEC10802.1| ubiquitin-40S ribosomal protein S27a-2 [Arabidopsis thaliana]
 gb|EOA29115.1| hypothetical protein CARUB_v10025382mg [Capsella rubella]
Length=157

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KJB36337.1| hypothetical protein B456_006G153300 [Gossypium raimondii]
Length=108

 Score =   142 bits (357),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KFH71638.1| ubiquitin-60S ribosomal protein L40 [Mortierella verticillata 
NRRL 6337]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_001597677.1| ubiquitin-60S ribosomal protein L40 fusion protein [Sclerotinia 
sclerotiorum 1980 UF-70]
 gb|EDN96945.1| ubiquitin fusion protein [Sclerotinia sclerotiorum 1980 UF-70]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|EYU46866.1| hypothetical protein MIMGU_mgv1a015483mg [Erythranthe guttata]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001150700.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG40048.1| 40S ribosomal protein S27a [Zea mays]
 tpg|DAA48105.1| TPA: polyubiquitin-like protein [Zea mays]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006488031.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
Length=164

 Score =   144 bits (362),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  9    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  68

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  69   IQKESTLHLV  78



>ref|NP_001042915.1| Os01g0328400 [Oryza sativa Japonica Group]
 ref|XP_006644130.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Oryza 
brachyantha]
 sp|Q9ARZ9.1|R27AA_ORYSJ RecName: Full=Ubiquitin-40S ribosomal protein S27a-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB39294.1| ubiquitin / ribosomal protein S27a.1 [Oryza sativa Japonica Group]
 dbj|BAF04829.1| Os01g0328400 [Oryza sativa Japonica Group]
 gb|EAY73811.1| hypothetical protein OsI_01687 [Oryza sativa Indica Group]
 gb|EAY73815.1| hypothetical protein OsI_01691 [Oryza sativa Indica Group]
 gb|EAZ11698.1| hypothetical protein OsJ_01558 [Oryza sativa Japonica Group]
 dbj|BAG88191.1| unnamed protein product [Oryza sativa Japonica Group]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010506742.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Camelina sativa]
Length=157

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KIR50412.1| ubiquitin [Cryptococcus gattii CA1280]
Length=129

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003535084.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
1 [Glycine max]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010507927.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 ref|XP_010518402.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2 [Camelina sativa]
Length=157

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KJB06862.1| hypothetical protein B456_001G146500 [Gossypium raimondii]
Length=183

 Score =   144 bits (363),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  27   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  86

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  87   NIQKESTLHLV  97



>gb|ACA24140.1| ubiquitin [Lolium temulentum]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_008793306.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
X2 [Phoenix dactylifera]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AAL66206.1|AF386524_1 ubiquitin extension protein [Pyrus communis]
Length=154

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>sp|P47905.2|RS27A_LUPAL RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Lupinus albus]
 emb|CAA80333.1| ubiquitin extension protein [Lupinus albus]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010107560.1| Ubiquitin-40S ribosomal protein S27a [Morus notabilis]
 gb|EXC16242.1| Ubiquitin-40S ribosomal protein S27a [Morus notabilis]
Length=149

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006402395.1| hypothetical protein EUTSA_v10006290mg [Eutrema salsugineum]
 gb|ESQ43848.1| hypothetical protein EUTSA_v10006290mg [Eutrema salsugineum]
Length=157

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>dbj|BAC80055.1| putative ubiquitin / ribosomal protein CEP52 [Oryza sativa Japonica 
Group]
 dbj|BAD31532.1| putative ubiquitin / ribosomal protein CEP52 [Oryza sativa Japonica 
Group]
Length=143

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_007154497.1| hypothetical protein PHAVU_003G1236000g, partial [Phaseolus vulgaris]
 ref|XP_007154498.1| hypothetical protein PHAVU_003G1236000g, partial [Phaseolus vulgaris]
 gb|AAC08400.1| ubiquitin, partial [Mesembryanthemum crystallinum]
 gb|ESW26491.1| hypothetical protein PHAVU_003G1236000g, partial [Phaseolus vulgaris]
 gb|ESW26492.1| hypothetical protein PHAVU_003G1236000g, partial [Phaseolus vulgaris]
Length=111

 Score =   142 bits (357),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  95   IQKESTLHLV  104


 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/28 (100%), Positives = 28/28 (100%), Gaps = 0/28 (0%)
 Frame = +2

Query  131  LIFAGKQLEDGRTLADYNIQKESTLHLV  214
            LIFAGKQLEDGRTLADYNIQKESTLHLV
Sbjct  1    LIFAGKQLEDGRTLADYNIQKESTLHLV  28



>gb|KHN22999.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
Length=151

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CDP26955.1| Putative fusion protein: ubiquitin-cytosolic 60S ribosomal protein 
Rpl40 [Podospora anserina S mat+]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>sp|P59272.2|RS27A_DAUCA RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor, partial [Daucus carota]
 gb|AAC26159.1| ubiquitin-carboxyl extension [Daucus carota]
Length=143

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CAA80334.1| ubiquitin extension protein [Lupinus albus]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABI84265.1| ubiquitin/ribosomal protein S27a [Arachis hypogaea]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010552656.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Tarenaya hassleriana]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>sp|P0CG86.1|RS271_HORVU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Hordeum vulgare]
 gb|AAA62698.1| ubiquitin [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_008026131.1| hypothetical protein SETTUDRAFT_56731, partial [Setosphaeria 
turcica Et28A]
 gb|EOA86216.1| hypothetical protein SETTUDRAFT_56731, partial [Setosphaeria 
turcica Et28A]
Length=131

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  64   IQKESTLHLV  73



>ref|XP_008781194.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Phoenix dactylifera]
 ref|XP_008810072.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Phoenix dactylifera]
 ref|XP_010921349.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Elaeis guineensis]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|EYU38434.1| hypothetical protein MIMGU_mgv1a015486mg [Erythranthe guttata]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_007855933.1| ubiquitin [Moniliophthora roreri MCA 2997]
 gb|ESK84758.1| ubiquitin [Moniliophthora roreri MCA 2997]
Length=123

 Score =   142 bits (358),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KIM38209.1| hypothetical protein M413DRAFT_247932 [Hebeloma cylindrosporum 
h7]
Length=85

 Score =   141 bits (355),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KDO86852.1| hypothetical protein CISIN_1g031604mg [Citrus sinensis]
Length=145

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KCW58175.1| hypothetical protein EUGRSUZ_H00892 [Eucalyptus grandis]
Length=145

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003567648.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Brachypodium 
distachyon]
 sp|P0CG87.1|RS272_HORVU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Hordeum vulgare]
 gb|AAA62699.1| ubiquitin [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92072.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AFK43562.1| unknown [Medicago truncatula]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003613203.1| Ubiquitin [Medicago truncatula]
 gb|AES96161.1| ubiquitin-40S ribosomal S27a-like protein [Medicago truncatula]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006397903.1| hypothetical protein EUTSA_v10001668mg [Eutrema salsugineum]
 gb|ESQ39356.1| hypothetical protein EUTSA_v10001668mg [Eutrema salsugineum]
Length=157

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KDO50669.1| hypothetical protein CISIN_1g0317061mg, partial [Citrus sinensis]
Length=117

 Score =   142 bits (358),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70


 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  127
            I VKTLTGK I +++E +DTI+ +K ++++KEGIPP QQ
Sbjct  79   IKVKTLTGKEIEIDIEPTDTIERIKERVEEKEGIPPVQQ  117



>gb|KIE01056.1| ubiquitin, partial [Metarhizium majus ARSEF 297]
Length=161

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  33   KMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  92

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  93   NIQKESTLHLV  103



>ref|XP_006654079.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Oryza brachyantha]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AFK49579.1| unknown [Lotus japonicus]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CBQ68978.1| probable ubiquitin [Sporisorium reilianum SRZ2]
Length=152

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CCK69751.1| hypothetical protein KNAG_0C06580 [Kazachstania naganishii CBS 
8797]
Length=149

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_009416508.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391524.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414159.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Musa acuminata 
subsp. malaccensis]
Length=157

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_173755.1| 40S ribosomal protein S27a-1 [Arabidopsis thaliana]
 sp|P59271.2|R27AA_ARATH RecName: Full=Ubiquitin-40S ribosomal protein S27a-1; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF79581.1|AC007945_1 F28C11.5 [Arabidopsis thaliana]
 gb|AAF87001.1|AC005292_10 F26F24.28 [Arabidopsis thaliana]
 gb|AAM62617.1| ubiquitin extension protein, putative [Arabidopsis thaliana]
 gb|ABD59101.1| At1g23410 [Arabidopsis thaliana]
 gb|AEE30384.1| 40S ribosomal protein S27a-1 [Arabidopsis thaliana]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002525394.1| ubiquitin, putative [Ricinus communis]
 ref|XP_009617530.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana tomentosiformis]
 ref|XP_009629268.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana tomentosiformis]
 ref|XP_009761349.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana sylvestris]
 ref|XP_009773069.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Nicotiana sylvestris]
 emb|CAA11268.1| ubiquitin extension protein [Nicotiana tabacum]
 gb|AAX07419.1| ubiquitin/s27a 40S ribosomal protein [Nicotiana benthamiana]
 gb|EEF37032.1| ubiquitin, putative [Ricinus communis]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006680275.1| ubiquitin [Batrachochytrium dendrobatidis JAM81]
 sp|P19848.1|UBIQ_COPCO RecName: Full=Ubiquitin [Coprinellus congregatus]
 emb|CAA38483.1| ubiquitin [Coprinellus congregatus]
 dbj|BAD97865.1| ubiquitin [Lemna paucicostata]
 gb|EGF78908.1| ubiquitin [Batrachochytrium dendrobatidis JAM81]
Length=76

 Score =   140 bits (354),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_007157375.1| hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris]
 ref|XP_007157378.1| hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris]
 gb|ESW29369.1| hypothetical protein PHAVU_002G065000g [Phaseolus vulgaris]
 gb|ESW29372.1| hypothetical protein PHAVU_002G065200g [Phaseolus vulgaris]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002457768.1| hypothetical protein SORBIDRAFT_03g013260 [Sorghum bicolor]
 ref|XP_008655871.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Zea mays]
 gb|EES02888.1| hypothetical protein SORBIDRAFT_03g013260 [Sorghum bicolor]
 gb|AFW80667.1| polyubiquitin-like protein isoform 1 [Zea mays]
 gb|AFW80668.1| polyubiquitin-like protein isoform 2 [Zea mays]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_004968668.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1-like [Setaria 
italica]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006460460.1| hypothetical protein AGABI2DRAFT_192160 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV48597.1| hypothetical protein AGABI2DRAFT_192160 [Agaricus bisporus var. 
bisporus H97]
Length=144

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AAZ83341.1| ubiquitin extension protein [Gossypium hirsutum]
 gb|KJB41754.1| hypothetical protein B456_007G119500 [Gossypium raimondii]
 gb|KJB69904.1| hypothetical protein B456_011G049100 [Gossypium raimondii]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AHA83529.1| ubiquitin extension protein [Hevea brasiliensis]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002279878.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
 emb|CAN71283.1| hypothetical protein VITISV_027093 [Vitis vinifera]
 emb|CAN70884.1| hypothetical protein VITISV_029192 [Vitis vinifera]
 gb|KDP28317.1| hypothetical protein JCGZ_14088 [Jatropha curcas]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010731693.1| PREDICTED: ubiquitin-60S ribosomal protein L40-like [Larimichthys 
crocea]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_008649366.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Zea mays]
 gb|ACG24702.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG24773.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG36278.1| 40S ribosomal protein S27a [Zea mays]
 gb|ACG38230.1| 40S ribosomal protein S27a [Zea mays]
 gb|AFW77223.1| polyubiquitin-like protein [Zea mays]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_004489824.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Cicer arietinum]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KJB84421.1| hypothetical protein B456_N024400, partial [Gossypium raimondii]
Length=118

 Score =   142 bits (358),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70


 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  11   IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  130
            I VKTLTGK I +++E +DTID +K ++++KEGIPP QQR
Sbjct  79   IKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQR  118



>gb|ELQ39973.1| ubiquitin [Magnaporthe oryzae Y34]
 gb|ELQ68028.1| ubiquitin [Magnaporthe oryzae P131]
Length=144

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/71 (97%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY
Sbjct  16   KMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY  75

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  76   NIQKESTLHLV  86



>gb|AAZ53360.1| ubiquitin extension protein [Nicotiana tabacum]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006424488.1| hypothetical protein CICLE_v10029476mg [Citrus clementina]
 gb|ESR37728.1| hypothetical protein CICLE_v10029476mg [Citrus clementina]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003629895.1| Ubiquitin [Medicago truncatula]
Length=232

 Score =   145 bits (367),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%), Gaps = 0/71 (0%)
 Frame = +2

Query  2    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  181
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  77   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  136

Query  182  NIQKESTLHLV  214
            NIQKESTLHLV
Sbjct  137  NIQKESTLHLV  147



>ref|NP_001131602.1| ubiquitin [Zea mays]
 ref|XP_002439338.1| hypothetical protein SORBIDRAFT_09g004630 [Sorghum bicolor]
 sp|P27923.2|RS27A_MAIZE RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Zea mays]
 pir||JS0657 ubiquitin / ribosomal protein S27a - maize
 gb|AAA33519.1| ubiquitin fusion protein [Zea mays]
 gb|AAA70105.1| ubiquitin fusion protein [Zea mays]
 gb|ACF80088.1| unknown [Zea mays]
 gb|EES17768.1| hypothetical protein SORBIDRAFT_09g004630 [Sorghum bicolor]
 gb|AFW84849.1| ubiquitin-40S ribosomal protein S27a Precursor [Zea mays]
 prf||2211240B ubiquitin fusion protein
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001237759.1| uncharacterized protein LOC100306626 [Glycine max]
 gb|ACU14903.1| unknown [Glycine max]
Length=128

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ+RLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQRRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_004977103.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Setaria 
italica]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002890580.1| hypothetical protein ARALYDRAFT_472603 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66839.1| hypothetical protein ARALYDRAFT_472603 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ACJ84122.1| unknown [Medicago truncatula]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KIJ45726.1| hypothetical protein M422DRAFT_166624 [Sphaerobolus stellatus 
SS14]
Length=77

 Score =   140 bits (354),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>emb|CCL98913.1| predicted protein [Fibroporia radiculosa]
Length=123

 Score =   142 bits (358),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010675161.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Beta vulgaris 
subsp. vulgaris]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_011082406.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sesamum indicum]
 gb|AFJ42574.1| ubiquitin extension protein 5 [Sesamum indicum]
 gb|KDP45613.1| hypothetical protein JCGZ_17220 [Jatropha curcas]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001105472.1| ubiquitin-40S ribosomal protein S27a [Zea mays]
 emb|CAA63150.1| ORF [Zea mays]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KIO16717.1| hypothetical protein M407DRAFT_183161 [Tulasnella calospora MUT 
4182]
Length=77

 Score =   140 bits (354),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_008793305.1| PREDICTED: ubiquitin-like isoform X1 [Phoenix dactylifera]
Length=129

 Score =   142 bits (358),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001063507.2| Os09g0483200 [Oryza sativa Japonica Group]
 gb|EEC84779.1| hypothetical protein OsI_31818 [Oryza sativa Indica Group]
 gb|EEE69935.1| hypothetical protein OsJ_29804 [Oryza sativa Japonica Group]
 dbj|BAF25421.2| Os09g0483200 [Oryza sativa Japonica Group]
Length=139

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGK+ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKSITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001238483.1| uncharacterized protein LOC100527854 [Glycine max]
 gb|ACU17047.1| unknown [Glycine max]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001054720.2| Os05g0160200 [Oryza sativa Japonica Group]
 sp|P51431.3|R27AB_ORYSJ RecName: Full=Ubiquitin-40S ribosomal protein S27a-2; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a-2; Flags: Precursor [Oryza sativa Japonica 
Group]
 pdb|3J60|FF Chain f, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAT93912.1| putative ubiquitin extension protein [Oryza sativa Japonica Group]
 gb|AAV43924.1| putative ubiquitin fusion protein [Oryza sativa Japonica Group]
 gb|ABR25414.1| 40S ribosomal protein S27a [Oryza sativa Indica Group]
 dbj|BAG99770.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62418.1| hypothetical protein OsJ_17209 [Oryza sativa Japonica Group]
 dbj|BAF16634.2| Os05g0160200 [Oryza sativa Japonica Group]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_007685506.1| hypothetical protein COCMIDRAFT_88724 [Bipolaris oryzae ATCC 
44560]
 ref|XP_007700377.1| hypothetical protein COCSADRAFT_37257 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_007708418.1| hypothetical protein COCCADRAFT_1856 [Bipolaris zeicola 26-R-13]
 gb|EMD63482.1| hypothetical protein COCSADRAFT_37257 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD85786.1| hypothetical protein COCHEDRAFT_1228811 [Bipolaris maydis C5]
 gb|ENH99827.1| hypothetical protein COCC4DRAFT_207287 [Bipolaris maydis ATCC 
48331]
 gb|EUC37275.1| hypothetical protein COCCADRAFT_1856 [Bipolaris zeicola 26-R-13]
 gb|EUC47932.1| hypothetical protein COCMIDRAFT_88724 [Bipolaris oryzae ATCC 
44560]
 gb|EUN28291.1| hypothetical protein COCVIDRAFT_36742 [Bipolaris victoriae FI3]
Length=154

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_007334275.1| hypothetical protein AGABI1DRAFT_26321, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM75077.1| hypothetical protein AGABI1DRAFT_26321, partial [Agaricus bisporus 
var. burnettii JB137-S8]
Length=100

 Score =   141 bits (356),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>sp|P62980.2|RS27A_SOLLC RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Solanum lycopersicum]
 sp|P62981.2|RS27A_SOLTU RecName: Full=Ubiquitin-40S ribosomal protein S27a; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=40S ribosomal 
protein S27a; Flags: Precursor [Solanum tuberosum]
 emb|CAA41207.1| ubiquitin [Solanum lycopersicum]
 emb|CAA77735.1| ubiquitin monomer/ribosomal protein [Solanum tuberosum]
 gb|AAA19247.1| ubiquitin/ribosomal fusion protein [Solanum tuberosum]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001238181.1| uncharacterized protein LOC100527579 [Glycine max]
 ref|XP_003517689.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like isoform 
1 [Glycine max]
 gb|ACU16690.1| unknown [Glycine max]
 gb|KHN00366.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
 gb|KHN14565.1| Ubiquitin-40S ribosomal protein S27a [Glycine soja]
Length=155

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|AEX13272.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13273.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13274.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13275.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13276.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13277.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13278.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13279.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13280.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13281.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13282.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13283.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13284.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13285.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13286.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13287.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13288.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13289.1| hypothetical protein CL958Contig1_06, partial [Pinus taeda]
 gb|AEX13290.1| hypothetical protein CL958Contig1_06, partial [Pinus radiata]
Length=90

 Score =   141 bits (355),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  13   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  72

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  73   IQKESTLHLV  82



>gb|AGF25315.1| ubiquitin 2, partial [x Doritaenopsis hybrid cultivar]
Length=140

 Score =   142 bits (359),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_008358198.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Malus domestica]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006492389.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
 gb|KDO86853.1| hypothetical protein CISIN_1g031604mg [Citrus sinensis]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001275598.1| ubiquitin-40S ribosomal protein S27a-like [Solanum tuberosum]
 ref|XP_002297752.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_002301539.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa]
 ref|XP_002515213.1| ubiquitin, putative [Ricinus communis]
 ref|XP_004252948.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_004252949.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_004252950.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Solanum 
lycopersicum]
 ref|XP_006376957.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_006438329.1| hypothetical protein CICLE_v10032969mg [Citrus clementina]
 ref|XP_006483898.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Citrus 
sinensis]
 ref|XP_007044700.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 ref|XP_007221513.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica]
 ref|XP_007223652.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica]
 ref|XP_008227802.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Prunus mume]
 ref|XP_009609224.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009609225.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009609226.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
tomentosiformis]
 ref|XP_009775091.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
 ref|XP_009775093.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Nicotiana 
sylvestris]
 ref|XP_010044607.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Eucalyptus grandis]
 ref|XP_010999619.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Populus euphratica]
 emb|CAA71132.1| ubiquitin extension protein [Solanum tuberosum]
 gb|ABA46785.1| ubiquitin extension protein-like protein [Solanum tuberosum]
 gb|ABK92566.1| unknown [Populus trichocarpa]
 gb|ABK93901.1| unknown [Populus trichocarpa]
 gb|ABK94236.1| unknown [Populus trichocarpa]
 gb|ABK94239.1| unknown [Populus trichocarpa]
 gb|ABK94284.1| unknown [Populus trichocarpa]
 gb|ACG70965.1| ubiquitin extensive-like protein [Ziziphus jujuba]
 gb|EEE80812.1| ubiquitin/ribosomal fusion family protein [Populus trichocarpa]
 gb|EEE82557.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|EEF47197.1| ubiquitin, putative [Ricinus communis]
 gb|EMJ22712.1| hypothetical protein PRUPE_ppa012754mg [Prunus persica]
 gb|EMJ24851.1| hypothetical protein PRUPE_ppa012746mg [Prunus persica]
 gb|EOY00532.1| Ribosomal protein S27a / Ubiquitin family protein [Theobroma 
cacao]
 gb|ERP54754.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 gb|ESR51569.1| hypothetical protein CICLE_v10032969mg [Citrus clementina]
 gb|KCW86699.1| hypothetical protein EUGRSUZ_B03309 [Eucalyptus grandis]
 gb|KDO60231.1| hypothetical protein CISIN_1g031613mg [Citrus sinensis]
 emb|CDO98715.1| unnamed protein product [Coffea canephora]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006846976.1| hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda]
 gb|ERN08557.1| hypothetical protein AMTR_s00017p00094950 [Amborella trichopoda]
Length=156

 Score =   143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABR29645.1| ubiquitin, partial [Lolium perenne]
Length=155

 Score =   143 bits (360),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010413295.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
Length=157

 Score =   143 bits (361),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002876668.1| hypothetical protein ARALYDRAFT_486730 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006293091.1| hypothetical protein CARUB_v10019378mg [Capsella rubella]
 ref|XP_010512610.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 ref|XP_010468976.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-2-like [Camelina 
sativa]
 gb|EFH52927.1| hypothetical protein ARALYDRAFT_486730 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA25989.1| hypothetical protein CARUB_v10019378mg [Capsella rubella]
Length=157

 Score =   143 bits (361),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|KDQ32340.1| hypothetical protein PLEOSDRAFT_1074537 [Pleurotus ostreatus 
PC15]
Length=77

 Score =   140 bits (354),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_004288657.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fragaria vesca 
subsp. vesca]
 ref|XP_004297391.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Fragaria vesca 
subsp. vesca]
 gb|AEQ75492.1| ubiquitin extension protein [Rosa multiflora]
Length=156

 Score =   143 bits (361),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|NP_001275323.1| putative ubiquitin extension protein [Solanum tuberosum]
 gb|ABY21245.1| putative ubiquitin extension protein [Solanum tuberosum]
Length=156

 Score =   143 bits (361),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002506532.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67790.1| predicted protein [Micromonas sp. RCC299]
Length=205

 Score =   144 bits (364),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_008389677.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008389867.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008343199.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008350959.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008353873.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_008360710.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Malus domestica]
 ref|XP_009363083.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
 ref|XP_009367168.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
 ref|XP_009376181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Pyrus x bretschneideri]
Length=156

 Score =   143 bits (361),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>gb|ABN72579.1| ubiquitin extension protein [Hevea brasiliensis]
Length=156

 Score =   143 bits (361),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002320950.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
 ref|XP_011040582.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-like [Populus 
euphratica]
 gb|ABK92725.1| unknown [Populus trichocarpa]
 gb|EEE99265.1| ubiquitin/ribosomal protein 27a [Populus trichocarpa]
Length=156

 Score =   143 bits (361),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003634320.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Vitis vinifera]
 emb|CAN75420.1| hypothetical protein VITISV_037877 [Vitis vinifera]
Length=156

 Score =   143 bits (361),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_001700313.1| ribosomal protein L40, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 sp|P0CH11.1|RL401_CHLRE RecName: Full=Ubiquitin-60S ribosomal protein L40; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=60S ribosomal 
protein L40; AltName: Full=CEP52; Flags: Precursor [Chlamydomonas 
reinhardtii]
 sp|P0CH10.1|RL403_CHLRE RecName: Full=Ubiquitin-60S ribosomal protein L40; Contains: 
RecName: Full=Ubiquitin; Contains: RecName: Full=60S ribosomal 
protein L40; AltName: Full=CEP52; Flags: Precursor [Chlamydomonas 
reinhardtii]
 emb|CAA43216.1| ubiquitin extension protein (UbCEP52) [Chlamydomonas reinhardtii]
 emb|CAA33466.1| unnamed protein product [Chlamydomonas reinhardtii]
 gb|EDO98280.1| ribosomal protein L40 [Chlamydomonas reinhardtii]
Length=128

 Score =   142 bits (358),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_001729044.1| hypothetical protein MGL_3832 [Malassezia globosa CBS 7966]
 gb|EDP41830.1| hypothetical protein MGL_3832 [Malassezia globosa CBS 7966]
Length=166

 Score =   143 bits (361),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  39   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  98

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  99   IQKESTLHLV  108



>ref|XP_001227904.1| ubiquitin [Chaetomium globosum CBS 148.51]
 gb|EAQ83573.1| ubiquitin [Chaetomium globosum CBS 148.51]
Length=91

 Score =   141 bits (355),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/70 (97%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_003062279.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53098.1| predicted protein [Micromonas pusilla CCMP1545]
Length=155

 Score =   143 bits (360),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_002501200.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62458.1| predicted protein [Micromonas sp. RCC299]
Length=152

 Score =   143 bits (360),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_006495490.1| PREDICTED: polyubiquitin 4-like, partial [Citrus sinensis]
Length=120

 Score =   142 bits (357),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70


 Score = 89.0 bits (219),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/44 (100%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  136
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120



>ref|XP_011011438.1| PREDICTED: ubiquitin-NEDD8-like protein RUB2 isoform X1 [Populus 
euphratica]
Length=163

 Score =   143 bits (361),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70


 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  11   IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  130
            I VKTLTGK I +++E +DTID +K ++++KEGIPP QQR
Sbjct  79   IKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQR  118



>ref|XP_011079491.1| PREDICTED: ubiquitin-40S ribosomal protein S27a [Sesamum indicum]
Length=156

 Score =   143 bits (360),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_007692333.1| hypothetical protein COCMIDRAFT_76755, partial [Bipolaris oryzae 
ATCC 44560]
 gb|EUC41150.1| hypothetical protein COCMIDRAFT_76755, partial [Bipolaris oryzae 
ATCC 44560]
Length=69

 Score =   140 bits (353),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/69 (100%), Positives = 69/69 (100%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHL  211
            IQKESTLHL
Sbjct  61   IQKESTLHL  69



>ref|XP_009103181.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Brassica rapa]
 ref|XP_009115529.1| PREDICTED: ubiquitin-40S ribosomal protein S27a-1 [Brassica rapa]
 emb|CDY44146.1| BnaA09g31060D [Brassica napus]
 emb|CDY25783.1| BnaA07g09990D [Brassica napus]
 emb|CDY12472.1| BnaC07g13120D [Brassica napus]
Length=156

 Score =   143 bits (360),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70



>ref|XP_010064065.1| PREDICTED: ubiquitin isoform X2 [Eucalyptus grandis]
 gb|KCW71369.1| hypothetical protein EUGRSUZ_F04448 [Eucalyptus grandis]
Length=122

 Score =   142 bits (358),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  61   IQKESTLHLV  70


 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  11   IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  127
            I VKTLTGK I +++E +DTID +K ++++KEGIPP QQ
Sbjct  79   IKVKTLTGKEIEIDIEPTDTIDRIKERVEEKEGIPPVQQ  117



>gb|KDN47865.1| Polyubiquitin, partial [Rhizoctonia solani AG-8 WAC10335]
Length=99

 Score =   141 bits (356),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 70/70 (100%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  184
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  13   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  72

Query  185  IQKESTLHLV  214
            IQKESTLHLV
Sbjct  73   IQKESTLHLV  82



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556171087500