BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN033F12

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   306   2e-101   Nicotiana tomentosiformis
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  301   3e-99    Nicotiana tabacum [American tobacco]
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  301   5e-99    Nicotiana tabacum [American tobacco]
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   300   1e-98    Nicotiana sylvestris
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   299   2e-98    Nicotiana tomentosiformis
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               299   2e-98    Eucalyptus grandis [rose gum]
ref|NP_001289823.1|  aquaporin PIP2-1-like                              298   4e-98    Solanum lycopersicum
ref|XP_006367009.1|  PREDICTED: probable aquaporin PIP2-2-like          293   2e-97    
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        293   5e-96    Solanum tuberosum [potatoes]
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             293   5e-96    Populus trichocarpa [western balsam poplar]
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        293   6e-96    Solanum tuberosum [potatoes]
gb|KCW51391.1|  hypothetical protein EUGRSUZ_J00930                     290   6e-96    Eucalyptus grandis [rose gum]
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               291   3e-95    Populus euphratica
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   290   5e-95    Nicotiana tomentosiformis
emb|CDP06739.1|  unnamed protein product                                289   1e-94    Coffea canephora [robusta coffee]
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   289   2e-94    Eucalyptus grandis [rose gum]
gb|KJB36606.1|  hypothetical protein B456_006G166800                    285   3e-94    Gossypium raimondii
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               288   4e-94    Eucalyptus grandis [rose gum]
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             287   5e-94    
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   287   6e-94    Citrus sinensis [apfelsine]
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   287   7e-94    Nicotiana sylvestris
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         287   8e-94    Jatropha curcas
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          286   2e-93    Gossypium arboreum [tree cotton]
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             286   2e-93    Citrus clementina [clementine]
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   285   4e-93    
gb|AFH36337.1|  aquaporin PIP2;2                                        285   6e-93    Quercus petraea [durmast oak]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                284   1e-92    Theobroma cacao [chocolate]
gb|AAB18227.1|  MipC                                                    284   2e-92    Mesembryanthemum crystallinum
gb|AEC45513.1|  plasma membrane intrinsic protein                       283   2e-92    Hevea brasiliensis [jebe]
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   283   2e-92    Sesamum indicum [beniseed]
gb|AAV80229.1|  aquaporin 2                                             283   2e-92    Aegiceras corniculatum
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         283   3e-92    Ricinus communis
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         283   4e-92    Ricinus communis
gb|AIA83104.1|  putative aquaporin PIP2                                 283   6e-92    Citrus sinensis x Citrus trifoliata [Carrizo citrange]
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  283   6e-92    Mimosa pudica [sensitive-plant]
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   282   9e-92    Populus euphratica
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         282   1e-91    Jatropha curcas
gb|AAC17529.1|  aquaporin 2                                             282   1e-91    Samanea saman [cow-tamarind]
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   281   1e-91    Solanum tuberosum [potatoes]
gb|KHG08488.1|  putative aquaporin PIP2-2                               281   1e-91    Gossypium arboreum [tree cotton]
gb|KJB21561.1|  hypothetical protein B456_004G001400                    281   2e-91    Gossypium raimondii
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                281   2e-91    Populus trichocarpa x Populus deltoides
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   281   2e-91    Tarenaya hassleriana [spider flower]
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             281   2e-91    Populus trichocarpa [western balsam poplar]
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          280   4e-91    Gossypium arboreum [tree cotton]
gb|AAO39008.1|  plasma intrinsic protein 2,2                            280   5e-91    Juglans regia
gb|ACX37450.1|  plasma membrane intrinsic protein                       280   5e-91    Hevea brasiliensis [jebe]
gb|AAO39007.1|  plasma intrinsic protein 2,1                            280   5e-91    Juglans regia
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             280   6e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   279   7e-91    
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   280   9e-91    Phoenix dactylifera
ref|XP_010920406.1|  PREDICTED: aquaporin PIP2-4 isoform X2             277   1e-90    Elaeis guineensis
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   279   2e-90    Gossypium raimondii
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   279   2e-90    Nelumbo nucifera [Indian lotus]
ref|NP_001274308.1|  aquaporin PIP2-1-like                              278   2e-90    Solanum lycopersicum
gb|AEQ20672.1|  PIP2;1                                                  279   2e-90    Karelinia caspia
gb|AIA83106.1|  putative aquaporin PIP2                                 279   2e-90    Citrus trifoliata [hardy orange]
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         279   2e-90    Jatropha curcas
gb|ABK60195.2|  PIP2 protein                                            278   2e-90    Gossypium hirsutum [American cotton]
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   279   2e-90    Phoenix dactylifera
ref|XP_010325989.1|  PREDICTED: aquaporin PIP2-1-like                   277   3e-90    
gb|KJB62460.1|  hypothetical protein B456_009G418100                    275   4e-90    Gossypium raimondii
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               278   4e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             278   6e-90    Elaeis guineensis
emb|CAH60724.1|  putative plasma membrane intrinsic protein             277   6e-90    Populus tremula x Populus tremuloides
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   277   7e-90    Populus euphratica
gb|ABB88840.1|  aquaporin                                               277   9e-90    Stevia rebaudiana
gb|KJB56129.1|  hypothetical protein B456_009G107200                    275   1e-89    Gossypium raimondii
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         276   1e-89    Helianthemum almeriense
gb|AEQ29857.1|  aquaporin PIP2                                          276   2e-89    Malus prunifolia
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        276   2e-89    Malus domestica [apple tree]
gb|KJB62459.1|  hypothetical protein B456_009G418100                    276   2e-89    Gossypium raimondii
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   276   2e-89    Populus euphratica
gb|AIG92831.1|  aquaporin PIP2                                          276   2e-89    Chrysanthemum x morifolium [florist's chrysanthemum]
emb|CDY56697.1|  BnaCnng31040D                                          276   2e-89    Brassica napus [oilseed rape]
gb|ABK60196.1|  PIP2 protein                                            276   2e-89    Gossypium hirsutum [American cotton]
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   276   2e-89    Setaria italica
gb|AFH36338.1|  aquaporin PIP2;3                                        276   3e-89    Quercus petraea [durmast oak]
emb|CDX74983.1|  BnaA05g07290D                                          273   3e-89    
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             276   3e-89    Eutrema salsugineum [saltwater cress]
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       276   4e-89    Raphanus sativus
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   275   5e-89    Fragaria vesca subsp. vesca
gb|KJB56128.1|  hypothetical protein B456_009G107200                    275   5e-89    Gossypium raimondii
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             275   5e-89    Phaseolus vulgaris [French bean]
gb|ACV70048.1|  aquaporin PIP2;1                                        273   6e-89    Quercus macrocarpa [burr oak]
gb|AFK47400.1|  unknown                                                 275   6e-89    Lotus japonicus
gb|ACU87558.1|  PIP protein                                             275   6e-89    Gossypium hirsutum [American cotton]
gb|AGG39693.1|  aquaporin protein AQU15                                 275   7e-89    Camellia sinensis [black tea]
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   275   7e-89    Glycine max [soybeans]
gb|AGD98708.1|  aquaporin protein 5                                     275   7e-89    Camellia sinensis [black tea]
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   275   7e-89    Elaeis guineensis
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               275   8e-89    Brassica rapa
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   274   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               274   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        274   1e-88    Phoenix dactylifera
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        274   1e-88    Brassica rapa
ref|NP_001268058.1|  aquaporin-like                                     274   1e-88    Vitis vinifera
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   274   1e-88    Fragaria vesca subsp. vesca
gb|ACZ06859.1|  plasma membrane intrinsic protein                       274   1e-88    Glycine soja [wild soybean]
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               274   1e-88    Prunus mume [ume]
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                                 273   2e-88    Gossypium hirsutum [American cotton]
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               274   2e-88    Malus domestica [apple tree]
gb|KHG00060.1|  putative aquaporin PIP2-2                               274   2e-88    Gossypium arboreum [tree cotton]
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               273   2e-88    
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        273   2e-88    Brassica rapa
ref|XP_006291621.1|  hypothetical protein CARUB_v10017773mg             273   2e-88    
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               273   2e-88    Populus euphratica
gb|KJB26182.1|  hypothetical protein B456_004G229000                    273   2e-88    Gossypium raimondii
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               273   2e-88    Brassica rapa
gb|KJB20285.1|  hypothetical protein B456_003G141600                    275   3e-88    Gossypium raimondii
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   273   3e-88    Eucalyptus grandis [rose gum]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               273   3e-88    Pyrus x bretschneideri [bai li]
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               273   3e-88    Pyrus x bretschneideri [bai li]
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    273   3e-88    Brassica rapa
emb|CDX91341.1|  BnaC04g08090D                                          273   3e-88    
ref|XP_008345410.1|  PREDICTED: aquaporin PIP2-1-like                   271   3e-88    
gb|ACU24483.1|  unknown                                                 273   3e-88    Glycine max [soybeans]
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          273   4e-88    Sorghum bicolor [broomcorn]
gb|ACG33001.1|  aquaporin PIP2.2                                        273   4e-88    Zea mays [maize]
gb|AHA84284.1|  prolactin-inducible protein                             273   4e-88    Phaseolus vulgaris [French bean]
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               273   4e-88    Populus euphratica
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             273   4e-88    Phaseolus vulgaris [French bean]
ref|NP_001105026.1|  aquaporin PIP2-4                                   273   4e-88    Zea mays [maize]
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   273   4e-88    Cucumis melo [Oriental melon]
gb|AHG32324.1|  PIP2-3                                                  273   5e-88    Pisum sativum [garden pea]
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             273   5e-88    Prunus persica
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              273   5e-88    
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           272   5e-88    Raphanus sativus
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   273   5e-88    Setaria italica
gb|EAY86778.1|  hypothetical protein OsI_08158                          273   5e-88    Oryza sativa Indica Group [Indian rice]
gb|AGD98714.1|  aquaporin protein 11                                    273   5e-88    Camellia sinensis [black tea]
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        273   5e-88    Petunia x hybrida [garden petunia]
ref|NP_001047491.1|  Os02g0629200                                       273   6e-88    
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   272   6e-88    Glycine max [soybeans]
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              272   6e-88    Populus trichocarpa [western balsam poplar]
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                     274   6e-88    Eucalyptus grandis [rose gum]
emb|CDX67611.1|  BnaA07g16510D                                          272   7e-88    
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             272   8e-88    Citrus clementina [clementine]
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             272   8e-88    Phaseolus vulgaris [French bean]
gb|AGD98707.1|  aquaporin protein 4                                     272   1e-87    Camellia sinensis [black tea]
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                272   1e-87    Hevea brasiliensis [jebe]
ref|NP_001240039.1|  uncharacterized protein LOC100782155               272   1e-87    Glycine max [soybeans]
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     274   1e-87    Eucalyptus grandis [rose gum]
emb|CDX91340.1|  BnaC04g08100D                                          272   1e-87    
gb|KCW51593.1|  hypothetical protein EUGRSUZ_J01087                     273   1e-87    Eucalyptus grandis [rose gum]
gb|KHG29841.1|  putative aquaporin PIP2-2                               272   1e-87    Gossypium arboreum [tree cotton]
gb|KHN00691.1|  Aquaporin PIP2-2                                        271   1e-87    Glycine soja [wild soybean]
gb|ABU94631.1|  putative aquaporin PIP2;3                               271   1e-87    Phaseolus vulgaris [French bean]
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             271   1e-87    Capsella rubella
emb|CDY13298.1|  BnaC06g14590D                                          271   1e-87    Brassica napus [oilseed rape]
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               271   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        271   1e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    271   2e-87    Pyrus x bretschneideri [bai li]
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        271   2e-87    Eucalyptus grandis [rose gum]
emb|CDY07519.1|  BnaC06g15450D                                          271   2e-87    Brassica napus [oilseed rape]
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             271   2e-87    Eutrema salsugineum [saltwater cress]
ref|NP_191042.1|  putative aquaporin PIP2-5                             271   2e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    271   2e-87    
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   271   2e-87    Brassica rapa
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   271   2e-87    Glycine max [soybeans]
ref|XP_010098191.1|  Aquaporin PIP2-7                                   271   2e-87    Morus notabilis
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               271   2e-87    Tarenaya hassleriana [spider flower]
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               271   2e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               271   2e-87    Camelina sativa [gold-of-pleasure]
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             271   2e-87    
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             271   2e-87    Eutrema salsugineum [saltwater cress]
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               271   2e-87    
emb|CDX74984.1|  BnaA05g07300D                                          271   2e-87    
gb|AEY75242.1|  plasma membrane intrinsic protein                       271   3e-87    Malus hupehensis
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  270   3e-87    Pyrus communis
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                     270   3e-87    Eucalyptus grandis [rose gum]
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           270   3e-87    Raphanus sativus
gb|AAW80918.1|  putative plasma membrane intrinsic protein              270   3e-87    Astragalus membranaceus
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   270   4e-87    Brassica rapa
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  270   4e-87    Pyrus communis
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        270   4e-87    Cucumis melo [Oriental melon]
ref|XP_003625627.1|  Aquaporin PIP2-1                                   270   4e-87    Medicago truncatula
ref|XP_006436426.1|  hypothetical protein CICLE_v10032302mg             267   4e-87    
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             270   4e-87    Eutrema salsugineum [saltwater cress]
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   270   5e-87    Fragaria vesca subsp. vesca
gb|AFK33316.1|  unknown                                                 270   5e-87    Medicago truncatula
ref|NP_001268056.1|  aquaporin PIP2                                     270   5e-87    Vitis vinifera
gb|ACJ85211.1|  unknown                                                 269   6e-87    Medicago truncatula
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          270   6e-87    Cicer arietinum [garbanzo]
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               270   6e-87    Camelina sativa [gold-of-pleasure]
gb|ACU20229.1|  unknown                                                 270   6e-87    Glycine max [soybeans]
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg             268   6e-87    
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               270   7e-87    Eucalyptus grandis [rose gum]
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   270   7e-87    Citrus sinensis [apfelsine]
gb|AAD31846.1|AF133530_1  water channel protein MipH                    270   7e-87    Mesembryanthemum crystallinum
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          270   8e-87    Gossypium arboreum [tree cotton]
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          270   8e-87    Sorghum bicolor [broomcorn]
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               270   8e-87    Elaeis guineensis
ref|NP_001105616.1|  aquaporin PIP2-5                                   270   8e-87    Zea mays [maize]
gb|ACU19125.1|  unknown                                                 270   9e-87    Glycine max [soybeans]
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        270   9e-87    
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               270   9e-87    Tarenaya hassleriana [spider flower]
emb|CDX10333.1|  aquaporin                                              270   9e-87    Coffea arabica [arabica coffee]
gb|KDO44717.1|  hypothetical protein CISIN_1g0196812mg                  268   9e-87    Citrus sinensis [apfelsine]
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   269   9e-87    Camelina sativa [gold-of-pleasure]
ref|XP_002316367.1|  putative aquaporin family protein                  269   1e-86    Populus trichocarpa [western balsam poplar]
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         269   1e-86    
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               269   1e-86    Camelina sativa [gold-of-pleasure]
gb|ACV70050.1|  aquaporin PIP2;1                                        267   1e-86    Quercus macrocarpa [burr oak]
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               269   1e-86    Sesamum indicum [beniseed]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             269   1e-86    Phaseolus vulgaris [French bean]
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     272   1e-86    Eucalyptus grandis [rose gum]
ref|XP_009413716.1|  PREDICTED: probable aquaporin PIP2-3 isoform X2    268   1e-86    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                269   1e-86    Populus trichocarpa x Populus deltoides
gb|EPS68613.1|  hypothetical protein M569_06155                         269   1e-86    Genlisea aurea
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   269   2e-86    Tarenaya hassleriana [spider flower]
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    268   2e-86    Arabis alpina [alpine rockcress]
ref|XP_002322877.1|  major intrinsic protein 1                          268   2e-86    Populus trichocarpa [western balsam poplar]
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                268   2e-86    Erythranthe guttata [common monkey flower]
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   268   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5               268   2e-86    Brassica rapa
gb|ADK25057.1|  plasma membrane intrinsic protein                       268   3e-86    Glycine max [soybeans]
ref|NP_001240223.1|  prolactin-inducible protein                        268   3e-86    Glycine max [soybeans]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   268   3e-86    Setaria italica
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        268   3e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001237286.1|  PIP2,2                                             268   3e-86    
gb|ABB13430.2|  plasma membrane intrinsic protein                       268   3e-86    Olea europaea
ref|NP_001105639.1|  aquaporin PIP2-7                                   268   3e-86    
dbj|BAE02729.1|  PIP aquaporin                                          268   3e-86    Hordeum vulgare [barley]
emb|CDX73446.1|  BnaC08g25570D                                          268   4e-86    
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   268   4e-86    Nicotiana tomentosiformis
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               268   4e-86    Brassica rapa
gb|KHN05685.1|  Aquaporin PIP2-7                                        268   4e-86    Glycine soja [wild soybean]
emb|CDY46759.1|  BnaA03g17030D                                          268   4e-86    Brassica napus [oilseed rape]
gb|AEO13898.1|  aquaporin 7                                             268   5e-86    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        268   5e-86    Camelina sativa [gold-of-pleasure]
gb|AAY22203.1|  putative aquaporin                                      268   5e-86    Phaseolus vulgaris [French bean]
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   267   5e-86    Nicotiana sylvestris
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               267   6e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010507447.1|  PREDICTED: probable aquaporin PIP2-5               268   6e-86    Camelina sativa [gold-of-pleasure]
gb|ABH09326.1|  putative aquaporin                                      267   6e-86    Vitis vinifera
gb|AAV69744.1|  aquaporin                                               267   6e-86    Vitis vinifera
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               267   6e-86    Nicotiana tomentosiformis
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               267   6e-86    
gb|ACV70053.1|  aquaporin PIP2;2                                        265   6e-86    Quercus macrocarpa [burr oak]
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   267   6e-86    Citrus sinensis [apfelsine]
ref|NP_001267922.1|  aquaporin-like                                     267   6e-86    Vitis vinifera
ref|NP_001105025.1|  aquaporin PIP2-3                                   267   6e-86    Zea mays [maize]
emb|CAN75442.1|  hypothetical protein VITISV_019657                     267   6e-86    Vitis vinifera
gb|AIK66515.1|  putative aquaporin                                      267   7e-86    Vitis vinifera
gb|ACV70051.1|  aquaporin PIP2;1                                        265   8e-86    Quercus macrocarpa [burr oak]
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     267   9e-86    Vitis cinerea var. helleri x Vitis rupestris
gb|AEY75244.1|  plasma membrane intrinsic protein                       266   9e-86    Malus hupehensis
gb|AFK47442.1|  unknown                                                 267   9e-86    Medicago truncatula
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             267   9e-86    Arabidopsis lyrata subsp. lyrata
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   267   1e-85    
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        267   1e-85    Brachypodium distachyon [annual false brome]
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             266   1e-85    Citrus clementina [clementine]
gb|KHN38765.1|  Aquaporin PIP2-7                                        266   1e-85    Glycine soja [wild soybean]
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   266   1e-85    Cucumis melo [Oriental melon]
gb|EMT09900.1|  Putative aquaporin PIP2-2                               267   1e-85    
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 266   1e-85    Nicotiana tabacum [American tobacco]
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             266   1e-85    Eutrema salsugineum [saltwater cress]
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        266   1e-85    Citrus sinensis [apfelsine]
gb|ACV70047.1|  aquaporin PIP2;1                                        264   2e-85    Quercus macrocarpa [burr oak]
gb|ABK93567.1|  unknown                                                 266   2e-85    Populus trichocarpa [western balsam poplar]
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   266   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             266   2e-85    Arabidopsis lyrata subsp. lyrata
dbj|BAA23744.1|  HvPIP2;1                                               266   2e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                266   2e-85    Erythranthe guttata [common monkey flower]
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   266   2e-85    Nelumbo nucifera [Indian lotus]
gb|ACR56613.1|  plasma intrinsic protein 2;3                            266   2e-85    Juglans regia
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  266   2e-85    Mimosa pudica [sensitive-plant]
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             266   3e-85    Capsella rubella
gb|ACV70049.1|  aquaporin PIP2;1                                        263   3e-85    Quercus macrocarpa [burr oak]
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        265   3e-85    Glycine max [soybeans]
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        265   3e-85    Pyrus x bretschneideri [bai li]
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             265   3e-85    Phaseolus vulgaris [French bean]
gb|ABC69040.1|  aquaporin PIP2-1                                        265   4e-85    Rhododendron catawbiense [Catawba rosebay]
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  267   4e-85    Citrus sinensis [apfelsine]
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             265   4e-85    Prunus persica
gb|ABX83874.1|  plasma membrane intrinsic protein                       265   5e-85    Rhododendron catawbiense [Catawba rosebay]
ref|NP_001235204.1|  Pip1 protein                                       265   7e-85    
gb|ACJ85173.1|  unknown                                                 265   8e-85    Medicago truncatula
gb|ADJ67992.1|  aquaporin                                               265   8e-85    
ref|XP_003606384.1|  Aquaporin PIP2-7                                   261   9e-85    
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                264   9e-85    
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               264   1e-84    
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                264   1e-84    
gb|ACU21481.1|  unknown                                                 264   1e-84    
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               264   1e-84    
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   264   1e-84    
emb|CAH60723.1|  putative plasma membrane intrinsic protein             264   1e-84    
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    264   1e-84    
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             264   1e-84    
ref|NP_001274397.1|  aquaporin PIP2-1-like                              264   1e-84    
dbj|BAE06148.1|  PIP aquaporin isoform                                  264   2e-84    
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         263   2e-84    
ref|XP_002876271.1|  PIP2_5/PIP2D                                       264   2e-84    
gb|ABH09328.1|  putative aquaporin                                      263   2e-84    
ref|NP_001053335.1|  Os04g0521100                                       263   2e-84    
gb|ADG03686.1|  aquaporin                                               263   2e-84    
ref|XP_006481456.1|  PREDICTED: aquaporin PIP2-2-like                   260   2e-84    
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   263   3e-84    
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        263   3e-84    
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        263   3e-84    
gb|ACV70052.1|  aquaporin PIP2;1                                        261   3e-84    
dbj|BAG06231.1|  plasma membrane intrinsic protein                      263   3e-84    
gb|AHB33479.1|  plasma intrinsic protein 2-3                            263   3e-84    
gb|ABU94630.1|  putative aquaporin PIP2;2                               263   3e-84    
ref|XP_004143248.1|  PREDICTED: aquaporin PIP2-1-like                   261   3e-84    
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        263   3e-84    
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               263   4e-84    
gb|AAG44947.1|AF290620_1  putative PIP2                                 263   4e-84    
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   263   4e-84    
gb|KJB73581.1|  hypothetical protein B456_011G239500                    261   4e-84    
ref|NP_181254.1|  aquaporin PIP2-2                                      262   5e-84    
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   263   5e-84    
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          263   5e-84    
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        262   5e-84    
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   262   5e-84    
ref|NP_001274386.1|  aquaporin PIP2-1-like                              262   6e-84    
ref|NP_001274381.1|  aquaporin PIP2-7-like                              262   6e-84    
emb|CAC82712.1|  major intrinsic protein 1                              262   6e-84    
ref|NP_190910.1|  aquaporin PIP2-1                                      262   7e-84    
gb|ABI96813.1|  plasma membrane intrinsic protein                       262   7e-84    
ref|NP_181255.1|  aquaporin PIP2-3                                      262   7e-84    
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        262   8e-84    
dbj|BAF33069.1|  aquaporin                                              261   1e-83    
gb|AFQ23567.1|  aquaporin PIP2;2                                        261   1e-83    
gb|AHG32323.1|  PIP2-2                                                  261   1e-83    
ref|XP_003606383.1|  Aquaporin PIP2-7                                   261   2e-83    
ref|NP_200874.1|  putative aquaporin PIP2-4                             261   2e-83    
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               261   2e-83    
ref|XP_010107541.1|  Aquaporin PIP2-2                                   261   2e-83    
gb|ABO69705.2|  aquaporin PIP2                                          260   2e-83    
emb|CAB45651.1|  putative plasma membrane intrinsic protein             260   3e-83    
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          260   3e-83    
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   260   3e-83    
gb|EMS51072.1|  Aquaporin PIP2-5                                        260   3e-83    
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        260   3e-83    
ref|NP_001280185.1|  aquaporin PIP2-2                                   260   4e-83    
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 260   4e-83    
gb|KJB73580.1|  hypothetical protein B456_011G239500                    260   4e-83    
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  260   5e-83    
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   259   6e-83    
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             259   6e-83    
gb|EMS56715.1|  putative aquaporin PIP2-2                               261   7e-83    
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   259   7e-83    
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    259   7e-83    
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          259   7e-83    
gb|ABI96814.1|  plasma membrane intrinsic protein                       259   8e-83    
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   259   8e-83    
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                   259   1e-82    
gb|AAL32127.1|  aquaporin                                               259   1e-82    
ref|NP_001289999.1|  aquaporin PIP2-1                                   259   1e-82    
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    259   1e-82    
gb|AFQ23186.1|  aquaporin PIP2;1                                        259   1e-82    
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             259   1e-82    
ref|NP_001234625.1|  aquaporin                                          258   1e-82    
gb|AAF61464.1|AF139815_1  plasma membrane intrinsic protein 2           258   1e-82    
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     259   2e-82    
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               258   2e-82    
ref|NP_001275065.1|  major intrinsic protein 2                          258   2e-82    
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   258   2e-82    
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   258   2e-82    
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 258   2e-82    
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          258   3e-82    
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter        257   3e-82    
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   258   4e-82    
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   257   4e-82    
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   257   6e-82    
gb|ABN11917.1|  aquaporin                                               257   8e-82    
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    256   8e-82    
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          256   2e-81    
ref|XP_003597235.1|  Aquaporin PIP2-7                                   256   2e-81    
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             256   2e-81    
gb|AGD98705.1|  aquaporin                                               255   2e-81    
ref|NP_001289846.1|  probable aquaporin PIP2-1                          255   3e-81    
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          255   4e-81    
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         255   4e-81    
ref|XP_010100853.1|  Aquaporin PIP2-1                                   255   4e-81    
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        262   5e-81    
gb|AGD98712.1|  aquaporin protein 9                                     254   7e-81    
emb|CDP07111.1|  unnamed protein product                                254   8e-81    
gb|EAZ03711.1|  hypothetical protein OsI_25843                          254   1e-80    
ref|NP_001059542.1|  Os07g0448100                                       254   1e-80    
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        254   1e-80    
gb|ACR38689.1|  unknown                                                 252   1e-80    
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          254   1e-80    
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               253   1e-80    
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        253   1e-80    
tpg|DAA60471.1|  TPA: plasma membrane intrinsic protein2                252   2e-80    
dbj|BAG68661.1|  plasma membrane intrinsic protein                      253   2e-80    
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          253   2e-80    
gb|ABM54183.1|  aquaporin                                               253   3e-80    
ref|XP_010689549.1|  PREDICTED: aquaporin PIP2-1-like                   252   4e-80    
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               252   4e-80    
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          252   5e-80    
ref|NP_001059545.1|  Os07g0448800                                       252   5e-80    
ref|NP_001105024.1|  aquaporin PIP2-1                                   252   9e-80    
gb|AAF65845.1|AF255795_1  aquaporin 1                                   251   9e-80    
gb|ACB87734.1|  aquaporin                                               251   1e-79    
tpg|DAA39707.1|  TPA: plasma membrane intrinsic protein2                250   1e-79    
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                252   1e-79    
gb|ACM50914.1|  aquaporin                                               251   1e-79    
emb|CAB46351.1|  major intrinsic protein 2                              251   1e-79    
ref|NP_001105027.1|  aquaporin PIP2-6                                   251   2e-79    
gb|AAO86707.1|  aquaporin                                               250   3e-79    
ref|XP_010042277.1|  PREDICTED: aquaporin PIP2-1-like                   249   4e-79    
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             250   4e-79    
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  249   5e-79    
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   249   5e-79    
ref|NP_001105638.1|  aquaporin PIP2-2                                   249   6e-79    
gb|ACF79873.1|  unknown                                                 249   1e-78    
gb|ACG39551.1|  aquaporin PIP2.1                                        248   2e-78    
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               247   3e-78    
gb|ACG32567.1|  aquaporin PIP2.1                                        247   5e-78    
ref|XP_003521392.1|  PREDICTED: aquaporin PIP2-7-like                   247   6e-78    
gb|AAC16545.1|  aquaporin                                               247   7e-78    
gb|EAZ03714.1|  hypothetical protein OsI_25847                          246   9e-78    
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                   246   1e-77    
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        246   1e-77    
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          245   3e-77    
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          245   3e-77    
gb|KGN47819.1|  hypothetical protein Csa_6G405320                       244   3e-77    
emb|CDX71032.1|  BnaC03g11160D                                          244   5e-77    
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    244   9e-77    
emb|CDY53629.1|  BnaC09g53920D                                          243   1e-76    
ref|NP_001267957.1|  aquaporin PIP2;2                                   243   2e-76    
emb|CDY31523.1|  BnaA10g13480D                                          242   2e-76    
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   243   2e-76    
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        243   2e-76    
emb|CDY09192.1|  BnaA02g06180D                                          241   3e-76    
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  243   3e-76    
gb|ABH09327.1|  putative aquaporin                                      242   3e-76    
ref|XP_009345758.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        242   3e-76    
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    242   4e-76    
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               242   4e-76    
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               242   5e-76    
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               242   5e-76    
gb|ACV70056.1|  aquaporin PIP2;3                                        239   5e-76    
ref|XP_006412151.1|  hypothetical protein EUTSA_v10025940mg             240   5e-76    
ref|XP_007041805.1|  Plasma membrane intrinsic protein 3 isoform 2      238   6e-76    
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     241   6e-76    
ref|XP_006422583.1|  hypothetical protein CICLE_v10029003mg             239   7e-76    
dbj|BAF32042.1|  putative aquaporin                                     241   7e-76    
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             241   8e-76    
gb|ACV70057.1|  aquaporin PIP2;3                                        239   9e-76    
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                241   9e-76    
emb|CDX88767.1|  BnaA03g08820D                                          240   1e-75    
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                        241   1e-75    
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               241   1e-75    
ref|XP_002879778.1|  PIP2_6/PIP2E                                       241   1e-75    
gb|ACV70054.1|  aquaporin PIP2;3                                        238   1e-75    
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             240   2e-75    
emb|CDP21564.1|  unnamed protein product                                240   2e-75    
ref|NP_179277.1|  putative aquaporin PIP2-8                             240   2e-75    
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               240   3e-75    
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               239   3e-75    
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             239   4e-75    
gb|EAZ39657.1|  hypothetical protein OsJ_24085                          241   5e-75    
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             239   5e-75    
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   239   5e-75    
gb|AFH36336.1|  aquaporin PIP2;1                                        239   6e-75    
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               239   6e-75    
ref|XP_010935141.1|  PREDICTED: aquaporin PIP2-7-like                   239   6e-75    
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               239   7e-75    
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                   238   7e-75    
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               239   8e-75    
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               239   8e-75    
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    238   1e-74    
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             239   1e-74    
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               239   1e-74    
ref|NP_001288933.1|  probable aquaporin PIP2-6                          239   1e-74    
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     238   1e-74    
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                238   1e-74    
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     238   1e-74    
dbj|BAF32141.1|  putative aquaporin                                     238   1e-74    
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               238   1e-74    
gb|ABK24173.1|  unknown                                                 237   1e-74    
emb|CDY14415.1|  BnaC03g21800D                                          238   1e-74    
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                238   2e-74    
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6               238   2e-74    
gb|ACV66986.1|  plasma membrane aquaporin 2                             238   2e-74    
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        238   2e-74    
emb|CDX69112.1|  BnaC01g03410D                                          238   2e-74    
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 238   2e-74    
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        238   2e-74    
gb|ABL76066.1|  aquaporin 2                                             237   2e-74    
gb|ACU87555.1|  PIP protein                                             237   2e-74    
gb|ABK24624.1|  unknown                                                 237   3e-74    
gb|AFQ23181.1|  aquaporin PIP2;2                                        237   3e-74    
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                      237   3e-74    
ref|XP_010107654.1|  Aquaporin PIP2-7                                   237   4e-74    
ref|XP_009345757.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    238   4e-74    
ref|XP_006384579.1|  hypothetical protein POPTR_0004s18240g             234   4e-74    
gb|ABK21046.1|  unknown                                                 237   4e-74    
gb|AAC32107.1|  probable aquaporin                                      237   5e-74    
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                  237   5e-74    
gb|ABK22504.1|  unknown                                                 237   5e-74    
gb|ACV70055.1|  aquaporin PIP2;3                                        234   5e-74    
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        236   5e-74    
gb|ACR56615.1|  plasma intrinsic protein 2;5                            236   6e-74    
dbj|BAG68662.1|  plasma membrane intrinsic protein                      236   6e-74    



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/183 (90%), Positives = 174/183 (95%), Gaps = 2/183 (1%)
 Frame = +1

Query  67   KMAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            +MAKD E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  8    QMAKDTEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  66

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQTDP+ KG ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  67   GYKSQTDPDHKG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  125

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRA+MYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  126  VSLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSSGTGLGAEIIGTF  185

Query  607  VLV  615
            VLV
Sbjct  186  VLV  188



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 172/183 (94%), Gaps = 2/183 (1%)
 Frame = +1

Query  67   KMAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            +MAKD E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  8    QMAKDTEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  66

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  67   GYKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  125

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRA+MYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGY+ GTGLGAEIIGTF
Sbjct  126  VSLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGTF  185

Query  607  VLV  615
            VLV
Sbjct  186  VLV  188



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   301 bits (770),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+MYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFV
Sbjct  119  SLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 171/182 (94%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+MYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGY+ GTGLGAEIIGTFV
Sbjct  119  SLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_009619670.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=283

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD +  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDTDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+MYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFV
Sbjct  119  SLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   299 bits (765),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+EGA    A +DYQDPPPAPL+DPEELGKWSFYRA+IAEFIAT+LFLY+TVLTVIG
Sbjct  1    MGKDLEGAQPPLAARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP + G+D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTMNGSD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAVMYMVAQCLGAICGCGLVKAFQ+AYY RYGGGAN L DGYSKG GLGAEI+GTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGCGLVKAFQRAYYTRYGGGANELADGYSKGVGLGAEIVGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|NP_001289823.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18626.1| plasmamembrane intrinsic protein 2;1 [Solanum lycopersicum]
Length=279

 Score =   298 bits (763),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 170/182 (93%), Gaps = 6/182 (3%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDMEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ+      TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQSS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+MY+VAQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFV
Sbjct  115  SLVRAIMYIVAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFV  174

Query  610  LV  615
            LV
Sbjct  175  LV  176



>ref|XP_006367009.1| PREDICTED: probable aquaporin PIP2-2-like [Solanum tuberosum]
Length=204

 Score =   293 bits (751),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 167/182 (92%), Gaps = 6/182 (3%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ       TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQNS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+MY+VAQCLGAICGCGLVK FQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFV
Sbjct  115  SLVRAIMYIVAQCLGAICGCGLVKCFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFV  174

Query  610  LV  615
            LV
Sbjct  175  LV  176



>ref|XP_006367007.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Solanum tuberosum]
Length=287

 Score =   293 bits (750),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 169/185 (91%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKG---TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            Y SQ   +  G   TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   YNSQNSTDQCGGNSTDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA+MY+VAQCLGAICGCGLVK+FQKAYYV+YGGGAN L DGYS GTGLGAEIIG
Sbjct  120  RKVSLVRAIMYIVAQCLGAICGCGLVKSFQKAYYVQYGGGANKLNDGYSTGTGLGAEIIG  179

Query  601  TFVLV  615
            TF+LV
Sbjct  180  TFILV  184



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   293 bits (750),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E A      KDYQDPPPAPLID EELG+WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVAEHGETVKDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP+ KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPD-KGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICGCGLVKAFQK+YY  YGGGAN LQ+GY+KGTGLGAEIIGTFV
Sbjct  120  SLIRAVLYMVAQCLGAICGCGLVKAFQKSYYNHYGGGANELQEGYNKGTGLGAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_006367008.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Solanum tuberosum]
Length=279

 Score =   293 bits (749),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 167/182 (92%), Gaps = 6/182 (3%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            Y SQ       TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YNSQNS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+MY+VAQCLGAICGCGLVK+FQKAYYV+YGGGAN L DGYS GTGLGAEIIGTF+
Sbjct  115  SLVRAIMYIVAQCLGAICGCGLVKSFQKAYYVQYGGGANKLNDGYSTGTGLGAEIIGTFI  174

Query  610  LV  615
            LV
Sbjct  175  LV  176



>gb|KCW51391.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=209

 Score =   290 bits (742),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 168/184 (91%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGA--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE A   E+AA KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPAEFAA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTDP +KGTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDPALKGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RAV YMVAQCLGAICGCGLVKAFQKAYY RYGGGAN +Q GYSKGT LGAEIIGT
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCGLVKAFQKAYYTRYGGGANEVQPGYSKGTALGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   291 bits (744),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 168/182 (92%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E A      +DYQDPPPAPLID EELG+WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVAEHGETVRDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP+ KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPD-KGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICGCGLVKAFQK++Y  YGGGAN LQ+GY+KGTGLGAEIIGTFV
Sbjct  120  SLIRAVLYMVAQCLGAICGCGLVKAFQKSFYNHYGGGANELQEGYNKGTGLGAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   290 bits (743),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 166/183 (91%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E G  +YA  KDYQDPPPAPLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSDTKHNG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            +SL RAVMYM+AQCLGAICGCGLVKAFQK+YYVRYGGGAN L  GYS GTGL AEIIGTF
Sbjct  120  ISLARAVMYMIAQCLGAICGCGLVKAFQKSYYVRYGGGANELATGYSTGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 166/185 (90%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKD+E      E+   KDYQDPPPAPL+DPEEL +WSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIATLLFLYITVLT  60

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            VIGYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  61   VIGYKSQSDTKANG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRAV+YMVAQCLGAICGCGLVKAFQ+AYYVRYGGGANGL DGYS GTGLGAEIIG
Sbjct  120  RKVSLVRAVLYMVAQCLGAICGCGLVKAFQRAYYVRYGGGANGLSDGYSTGTGLGAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 168/184 (91%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGA--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE A   E+AA KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPAEFAA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTDP +KGTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDPALKGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RAV YMVAQCLGAICGCGLVKAFQKAYY RYGGGAN +Q GYSKGT LGAEIIGT
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCGLVKAFQKAYYTRYGGGANEVQPGYSKGTALGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>gb|KJB36606.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=203

 Score =   285 bits (730),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 165/182 (91%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVE   E+ A KDY DPPPAPL+D EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ DP+ KG+DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+ YM AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAIFYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_010043747.1| PREDICTED: probable aquaporin PIP2-5 [Eucalyptus grandis]
 gb|KCW85738.1| hypothetical protein EUGRSUZ_B02500 [Eucalyptus grandis]
Length=284

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E        +DYQDPPPAPL+DPEELGKWSFYRA+IAEFIAT+LFLY+TVLTVIG
Sbjct  1    MGKDMESGEPPFGARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ DP + GT EC GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQVDPALNGT-ECDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAVMYMVAQCLGAICGCGLVKAFQKA Y RYGGGAN L DGYSKG GLGAEIIGTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGCGLVKAFQKARYTRYGGGANELSDGYSKGVGLGAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score =   287 bits (734),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 169/188 (90%), Gaps = 8/188 (4%)
 Frame = +1

Query  70   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  231
            M KDVE      G  E++A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLYVT
Sbjct  1    MGKDVEVAEQQGGGGEFSA-KDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVT  59

Query  232  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  411
            VLTVIGYKSQTDPN+  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  60   VLTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  118

Query  412  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  591
            FL RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGAN L DGY+KGTGLGAE
Sbjct  119  FLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAE  178

Query  592  IIGTFVLV  615
            IIGTFVLV
Sbjct  179  IIGTFVLV  186



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score =   287 bits (734),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 169/188 (90%), Gaps = 8/188 (4%)
 Frame = +1

Query  70   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  231
            M KDVE      G  E++A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLYVT
Sbjct  1    MGKDVEVAEQQGGGGEFSA-KDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVT  59

Query  232  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  411
            VLTVIGYKSQTDPN+  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  60   VLTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  118

Query  412  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  591
            FL RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGAN L DGY+KGTGLGAE
Sbjct  119  FLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAE  178

Query  592  IIGTFVLV  615
            IIGTFVLV
Sbjct  179  IIGTFVLV  186



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   287 bits (735),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 165/183 (90%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E G  +YA  KDYQDPPPAPLID EELGKWSFYRAI+AEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIVAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSDTKHNG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            +SL RAVMYM+AQCLGAICGCGLVKAFQK+YYV YGGGAN L  GYS GTGL AEIIGTF
Sbjct  120  ISLARAVMYMIAQCLGAICGCGLVKAFQKSYYVNYGGGANELATGYSTGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   287 bits (735),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 164/182 (90%), Gaps = 3/182 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDVEG    A  KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDVEGGDFQA--KDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVIG  58

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP+ K +D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YKSQTDPS-KNSDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  117

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YM AQCLGAICGCGLVKAFQKAYY RYGGGAN L DGYSKGTGLGAEIIGTFV
Sbjct  118  SLVRAILYMAAQCLGAICGCGLVKAFQKAYYTRYGGGANELADGYSKGTGLGAEIIGTFV  177

Query  610  LV  615
            LV
Sbjct  178  LV  179



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 165/182 (91%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVE   E+ A KDY DPPPAPL+D EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ DP+ KG+DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+ YM AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAIFYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 169/188 (90%), Gaps = 8/188 (4%)
 Frame = +1

Query  70   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  231
            M KDVE      G  E++A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLYVT
Sbjct  1    MGKDVEVAEQQGGGGEFSA-KDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVT  59

Query  232  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  411
            VLTVIGYKSQTDPN+  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  60   VLTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  118

Query  412  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  591
            FL RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGAN L DGY+KGTGLGAE
Sbjct  119  FLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAE  178

Query  592  IIGTFVLV  615
            IIGTFVLV
Sbjct  179  IIGTFVLV  186



>ref|XP_006367014.1| PREDICTED: aquaporin PIP2-1-like, partial [Solanum tuberosum]
Length=279

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 164/177 (93%), Gaps = 4/177 (2%)
 Frame = +1

Query  94   TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPN  273
            TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ   +
Sbjct  1    TEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQNSTD  59

Query  274  VKG---TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA  444
              G   TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA
Sbjct  60   QCGGNSTDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRA  119

Query  445  VMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            +MY+VAQCLGAICGCGLVK FQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLV
Sbjct  120  IMYIVAQCLGAICGCGLVKCFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFVLV  176



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   285 bits (730),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 168/184 (91%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE A   EY+A KDY DPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGEYSA-KDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTDP +K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDP-LKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RAV+YMVAQCLGAICG GLVKAFQK+ Y RYGGGAN L  GY+KGTGLGAEIIGT
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKSLYTRYGGGANELAAGYNKGTGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 164/182 (90%), Gaps = 4/182 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E   ++ A KDY DPPPAPL+D EEL KWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGQFQA-KDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ D   KG DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQID---KGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  116

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YM AQCLGAICGCGLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGTFV
Sbjct  117  SLVRAILYMAAQCLGAICGCGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTFV  176

Query  610  LV  615
            LV
Sbjct  177  LV  178



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   284 bits (727),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 165/185 (89%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVEGATEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            M KDVE A + A   + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLYITVLT  60

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            VIGYKSQTDPN    D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKSQTDPNTNA-DQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSL++AV+YMVAQCLGAICG G VKAFQKAYYVRYGGGAN +  GY+KGTGLGAEIIG
Sbjct  120  RKVSLIKAVLYMVAQCLGAICGVGFVKAFQKAYYVRYGGGANEMASGYTKGTGLGAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 166/185 (90%), Gaps = 5/185 (3%)
 Frame = +1

Query  70   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE A    E++A KDY DPPPAPLID EELGKWS YRA+IAEFIATLLFLY TVLT
Sbjct  1    MAKDVEVAENPGEFSA-KDYHDPPPAPLIDVEELGKWSLYRALIAEFIATLLFLYNTVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            VIGYKSQTDP +K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL 
Sbjct  60   VIGYKSQTDP-LKNADVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  118

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSL+RA++YMVAQCLGAICGCGLVKAFQKAYY RYGGGAN L DGY+KGTGLGAEIIG
Sbjct  119  RKVSLIRALLYMVAQCLGAICGCGLVKAFQKAYYNRYGGGANELSDGYNKGTGLGAEIIG  178

Query  601  TFVLV  615
            TFVLV
Sbjct  179  TFVLV  183



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 166/183 (91%), Gaps = 7/183 (4%)
 Frame = +1

Query  70   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E G TEY A KDYQDPPPAPLIDPEELGKWS YRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEVGGTEYGA-KDYQDPPPAPLIDPEELGKWSLYRAVIAEFIATLLFLYITVLTVI  59

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+      TDECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   GYKSQS-----ATDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  114

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAV+Y++AQCLGAI G GLVKAFQKAYYVRYGGGAN L DGYS GTGL AEIIGTF
Sbjct  115  VSLVRAVLYIIAQCLGAISGVGLVKAFQKAYYVRYGGGANELADGYSTGTGLAAEIIGTF  174

Query  607  VLV  615
            VLV
Sbjct  175  VLV  177



>gb|AAV80229.1| aquaporin 2 [Aegiceras corniculatum]
Length=284

 Score =   283 bits (725),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 165/182 (91%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E      APKDYQDPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGPGANAPKDYQDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVLTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            Y SQTDP+ K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLA+KV
Sbjct  61   YSSQTDPD-KNPDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLAQKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YM+AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGY+KGTGLGAEIIGTFV
Sbjct  120  SLVRAMLYMMAQCLGAICGCGLVKAFQKSYYTKYGGGANYLHDGYNKGTGLGAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   283 bits (725),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 168/186 (90%), Gaps = 6/186 (3%)
 Frame = +1

Query  70   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAKDVE A     E++A KDY DPPPAPLID +ELGKWSFYRA+IAEFIATLLFLY+TVL
Sbjct  1    MAKDVEVAEATGGEFSA-KDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLYITVL  59

Query  238  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  417
            TVIGYKSQTDP+ K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   TVIGYKSQTDPD-KNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  118

Query  418  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  597
             RKVSL+RA+ YMVAQCLGAICGCGLVKAFQKAYY RYGGGAN L DGY+KGTGLGAEII
Sbjct  119  GRKVSLIRALGYMVAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNKGTGLGAEII  178

Query  598  GTFVLV  615
            GTFVLV
Sbjct  179  GTFVLV  184



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 163/185 (88%), Gaps = 5/185 (3%)
 Frame = +1

Query  70   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            M KDVE      E+ A KDY DPPPAPLID EEL KWSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEVGGHGGEFHA-KDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            VIGYKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKSQTDP-AKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA+MYM AQCLGAICGCGLVKAFQ+AYY RYGGGAN L DGYS GTGLGAEIIG
Sbjct  119  RKVSLVRAIMYMAAQCLGAICGCGLVKAFQRAYYNRYGGGANELADGYSTGTGLGAEIIG  178

Query  601  TFVLV  615
            TFVLV
Sbjct  179  TFVLV  183



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 164/188 (87%), Gaps = 7/188 (4%)
 Frame = +1

Query  70   MAKDVEGATEYA------APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  231
            M KDVE A +        + KDY DPPPAPLID EELGKWSFYRA+IAEFIATL FLYVT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLSFLYVT  60

Query  232  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  411
            VLT IGYKSQTDP +  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   VLTAIGYKSQTDPTLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  119

Query  412  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  591
            FL RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGAN L DGY+KGTGLGAE
Sbjct  120  FLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAE  179

Query  592  IIGTFVLV  615
            IIGTFVLV
Sbjct  180  IIGTFVLV  187



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 165/184 (90%), Gaps = 3/184 (2%)
 Frame = +1

Query  70   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE A    Y+A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGSYSA-KDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTD  V   D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDTTVATGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RA++Y+VAQCLGAICG GLVKAFQKAYY +YGGGAN L DGYS GTGLGAEIIGT
Sbjct  120  KVSLIRAILYIVAQCLGAICGVGLVKAFQKAYYTKYGGGANTLGDGYSVGTGLGAEIIGT  179

Query  604  FVLV  615
            FVLV
Sbjct  180  FVLV  183



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   282 bits (722),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 165/182 (91%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E   E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD N  G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDVNKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGANGL  GYSKG GLGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTSYGGGANGLAIGYSKGNGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 166/184 (90%), Gaps = 3/184 (2%)
 Frame = +1

Query  70   MAKDVEGA--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE A  T   + KDY DPPPAPLID +ELG+WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLYITVLTV  60

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTDPN K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKSQTDPN-KNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RA+ YM+AQCLGAICGCGLVKAFQKAYY RYGGGAN L DGY+KGTGLGAEIIGT
Sbjct  120  KVSLIRALGYMIAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNKGTGLGAEIIGT  179

Query  604  FVLV  615
            FVLV
Sbjct  180  FVLV  183



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 165/184 (90%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE A    Y+A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGSYSA-KDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSDTKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RA++YMVAQCLGAICG GLVKAFQKAYY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KVSLIRAILYMVAQCLGAICGVGLVKAFQKAYYSRYGGGANTLSDGYSTGTGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_006339071.1| PREDICTED: aquaporin PIP2-1-like [Solanum tuberosum]
Length=281

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 165/183 (90%), Gaps = 6/183 (3%)
 Frame = +1

Query  70   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E G  +YA  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEYGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRA+ Y+VAQCLGAICGCGLVK FQKAYYV+YGGGAN L  GY+  TGLGAEIIGTF
Sbjct  116  VSLVRAIFYIVAQCLGAICGCGLVKLFQKAYYVKYGGGANELAVGYNTATGLGAEIIGTF  175

Query  607  VLV  615
            VLV
Sbjct  176  VLV  178



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 161/183 (88%), Gaps = 1/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E + E  + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIESSVEQVSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLTVIG  60

Query  250  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  61   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  120

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ G++KGTGLGAEIIGTF
Sbjct  121  VSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQSGFNKGTGLGAEIIGTF  180

Query  607  VLV  615
            VLV
Sbjct  181  VLV  183



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 161/183 (88%), Gaps = 1/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E + E  + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIESSVEQGSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLTVIG  60

Query  250  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  61   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  120

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ G++KGTGLGAEIIGTF
Sbjct  121  VSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQSGFNKGTGLGAEIIGTF  180

Query  607  VLV  615
            VLV
Sbjct  181  VLV  183



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E   E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGREFIA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAV+YMVAQCLGAICGCGLVKAFQK+YY +YGGGAN L  G+SKGTGLGAEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 166/185 (90%), Gaps = 5/185 (3%)
 Frame = +1

Query  70   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE    A E+ A KDY DPPPAPLIDPEEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQESAPEFTA-KDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYVTVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            VIGYK Q+D    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKVQSDTKAGG-DDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA++YMVAQCLGAICGCGLVKAFQK+YY RYGGGAN L  GY+KGTGLGAEIIG
Sbjct  119  RKVSLVRALLYMVAQCLGAICGCGLVKAFQKSYYNRYGGGANVLASGYNKGTGLGAEIIG  178

Query  601  TFVLV  615
            TFVLV
Sbjct  179  TFVLV  183



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDVE   E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDVEVRGEFIA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAV+YMVAQCLGAICGCGLVKAFQK+YY +YGGGAN L  G+SKGTGLGAEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   280 bits (717),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 164/182 (90%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVE   E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ DP+ KG+ +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGSQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YM AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E A +   + KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQTD   KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTD-KAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAV YM AQCLGA+CGCGLVKAFQKAYY +YGGGAN L DGYSKGTGL AEIIGTF
Sbjct  120  VSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 163/185 (88%), Gaps = 5/185 (3%)
 Frame = +1

Query  70   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE      E+ A KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVGGQGGEFQA-KDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            VIGYKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  60   VIGYKSQTDP-AKNADPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  118

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA++YM AQCLGAICGCGLVKAFQKAYY RYGGGAN L DGYSKGTGLGAEIIG
Sbjct  119  RKVSLVRAILYMAAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYSKGTGLGAEIIG  178

Query  601  TFVLV  615
            TFVLV
Sbjct  179  TFVLV  183



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E A +   + KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQTD   KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTD-KAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAV YM AQCLGA+CGCGLVKAFQKAYY +YGGGAN L DGYSKGTGL AEIIGTF
Sbjct  120  VSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   280 bits (716),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E   E++A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAV+YMVAQCLGAICGCGLVKAFQK+YY +YGGG N L  G+SKGTGLGAEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGVNELATGFSKGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_010325988.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=269

 Score =   279 bits (714),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +1

Query  112  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  291
            K YQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ+      TD+
Sbjct  4    KTYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQSS-----TDQ  58

Query  292  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  471
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCL
Sbjct  59   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCL  118

Query  472  GAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            GAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLV
Sbjct  119  GAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLV  166



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   280 bits (715),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 158/183 (86%), Gaps = 1/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E        KDY DPPPAPLID EEL KWS YRA+IAEF+ATLLFLY+TV TVIG
Sbjct  1    MGKDMEAGAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVATVIG  60

Query  250  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            YK Q+DPNV GTD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   YKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  120

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YM+AQCLGAICG GLVK FQKAYYVRYGGGAN L  GYSKGTGL AEIIGTF
Sbjct  121  VSLIRALLYMIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGYSKGTGLAAEIIGTF  180

Query  607  VLV  615
            VLV
Sbjct  181  VLV  183



>ref|XP_010920406.1| PREDICTED: aquaporin PIP2-4 isoform X2 [Elaeis guineensis]
Length=238

 Score =   277 bits (709),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E   E+ A KDY DPPPAPL+D EEL KWS YRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MRKDMEAGAEFTA-KDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVATVIG  59

Query  250  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            YK Q+DPNV G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   YKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YM+AQCLGAICG GLVKAFQKAYY RYGGG N L  GYSKGTGL AEIIGTF
Sbjct  120  VSLIRALLYMIAQCLGAICGVGLVKAFQKAYYNRYGGGVNELSSGYSKGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVE   E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ DP+ KG  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YM AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 166/184 (90%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGA--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE +  ++++A KDY DPPPA LIDP+EL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVESSEHSQFSA-KDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYK QTD +  GTD CGGVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKRQTDSSHNGTD-CGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RAVMY++AQCLGAICG GLVK FQK+YYVRYGGGAN L DGYSKG GL AEIIGT
Sbjct  119  KVSLIRAVMYIIAQCLGAICGVGLVKGFQKSYYVRYGGGANELADGYSKGVGLAAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|NP_001274308.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18628.1| plasmamembrane intrinsic protein 2;5 [Solanum lycopersicum]
Length=281

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 164/183 (90%), Gaps = 6/183 (3%)
 Frame = +1

Query  70   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E G  +YA  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEYGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARK  115

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRA+ Y+VAQCLGAICGCGLVK FQKAYYV+YGGGAN L  GY+  TGLGAEIIGTF
Sbjct  116  VSLVRAIFYIVAQCLGAICGCGLVKLFQKAYYVKYGGGANELAVGYNIATGLGAEIIGTF  175

Query  607  VLV  615
            VLV
Sbjct  176  VLV  178



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 162/183 (89%), Gaps = 3/183 (2%)
 Frame = +1

Query  70   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E G  +Y A KDYQDPPPA L D EEL KWSFYRAIIAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDIEVGGNDYGA-KDYQDPPPAELFDAEELTKWSFYRAIIAEFIATLLFLYVTVLTVI  59

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQTDP    +D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR 
Sbjct  60   GYKSQTDP-ANSSDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARX  118

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL RA MYMVAQCLGAICGCGLVKAFQK YY +YGGGAN L DGYS GTGLGAEI+GTF
Sbjct  119  VSLPRAFMYMVAQCLGAICGCGLVKAFQKTYYTKYGGGANELADGYSNGTGLGAEIVGTF  178

Query  607  VLV  615
            VLV
Sbjct  179  VLV  181



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 165/190 (87%), Gaps = 9/190 (5%)
 Frame = +1

Query  70   MAKDVEGATEYA--------APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllfly  225
            M KDVE A +          + KDY D PPAPLID +ELGKWSFYRA+IAEFIATLLFLY
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60

Query  226  vtvltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  405
            VTVLTVIGYKSQTDP +  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  61   VTVLTVIGYKSQTDPTLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  119

Query  406  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLG  585
            GLFL RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGAN L DGY+KGTGLG
Sbjct  120  GLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLG  179

Query  586  AEIIGTFVLV  615
            AEIIGTFVLV
Sbjct  180  AEIIGTFVLV  189



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDV     ++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MVKDVAEQGSFSA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDP-AKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAVMYMVAQ LGAICG GLVKAFQ AYY RYGGGAN L DGYS G GLGAEIIGTFV
Sbjct  119  SLVRAVMYMVAQSLGAICGVGLVKAFQSAYYKRYGGGANTLADGYSTGVGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVE   E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIA LLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAALLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ DP+ KG  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YM AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 159/185 (86%), Gaps = 3/185 (2%)
 Frame = +1

Query  70   MAKDVEGATEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            M KDVE A E      KDY DPPPAPLID EEL  WS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEAGEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIATLLFLYITVATV  60

Query  244  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            IGYK Q+DPNV GTD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSL+RA++YM+AQCLGAICG GLV+ FQKAYYVRYGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYMIAQCLGAICGAGLVRGFQKAYYVRYGGGANELSSGYSKGTGLAAEIIG  180

Query  601  TFVLV  615
            TFVLV
Sbjct  181  TFVLV  185



>ref|XP_010325989.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=259

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +1

Query  112  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  291
            K YQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ+      TD+
Sbjct  4    KIYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQSS-----TDQ  58

Query  292  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  471
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCL
Sbjct  59   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCL  118

Query  472  GAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            GAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLV
Sbjct  119  GAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLV  166



>gb|KJB62460.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=202

 Score =   275 bits (703),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+ YM AQCLGAICGCGLVKAFQ +YY +YGGGAN L +GYS GTGL AEIIGTFV
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   278 bits (711),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 163/185 (88%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+E A   EY A KDY DPPPAPL+D EEL KWS YRA IAEFIAT+LFLYVTVLTV
Sbjct  1    MAKDIEVAEQGEYTA-KDYTDPPPAPLVDVEELTKWSLYRAAIAEFIATMLFLYVTVLTV  59

Query  244  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            IGYK Q+DPNV  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   IGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA +Y+VAQCLGAICG GLVK FQKAY+VRYGGGAN L DGYSKGTGLGAEIIG
Sbjct  120  RKVSLVRAFLYIVAQCLGAICGVGLVKGFQKAYFVRYGGGANELSDGYSKGTGLGAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   278 bits (710),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E   E+ A KDY DPPPAPL+D EEL KWS YRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MRKDMEAGAEFTA-KDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVATVIG  59

Query  250  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            YK Q+DPNV G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   YKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YM+AQCLGAICG GLVKAFQKAYY RYGGG N L  GYSKGTGL AEIIGTF
Sbjct  120  VSLIRALLYMIAQCLGAICGVGLVKAFQKAYYNRYGGGVNELSSGYSKGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   277 bits (709),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E   E+ A KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFIA-KDYHDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD   K  D CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TAKNGDVCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY +YGGGANGL  G+SKGT LGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANGLASGFSKGTALGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   277 bits (709),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E   E++A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ D   K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQID-TTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGAN L  G+SKGTGLGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   277 bits (708),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 159/173 (92%), Gaps = 1/173 (1%)
 Frame = +1

Query  97   EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNV  276
            E+   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIGYKSQTDPN+
Sbjct  7    EHHGGKDYHDPPPAPLIDGEELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYKSQTDPNL  66

Query  277  KGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYM  456
              TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM
Sbjct  67   N-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYM  125

Query  457  VAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            VAQCLGAICG GLVKAFQ +YY RYGGGAN L DGY+KGTGLG EIIGTFVLV
Sbjct  126  VAQCLGAICGVGLVKAFQSSYYNRYGGGANELADGYNKGTGLGTEIIGTFVLV  178



>gb|KJB56129.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=232

 Score =   275 bits (702),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 162/186 (87%), Gaps = 4/186 (2%)
 Frame = +1

Query  70   MAKDVEGATEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            M KD+E A ++    + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  241  vIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  417
            VIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  418  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  597
             RKVSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ G++KGTGLGAEII
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGFNKGTGLGAEII  180

Query  598  GTFVLV  615
            GTFVLV
Sbjct  181  GTFVLV  186



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   276 bits (707),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 163/182 (90%), Gaps = 6/182 (3%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAK+ E A E+ A KDY DPPPAPL D EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKEAEAAGEFRA-KDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQID----GGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  115

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YMVAQCLGAICGCGLVKAFQK++Y RY GGAN L  GYSKGTGLGAEIIGTFV
Sbjct  116  SLVRAILYMVAQCLGAICGCGLVKAFQKSHYSRY-GGANELSGGYSKGTGLGAEIIGTFV  174

Query  610  LV  615
            LV
Sbjct  175  LV  176



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 167/184 (91%), Gaps = 8/184 (4%)
 Frame = +1

Query  70   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+EGA   E+A+ KDYQDPPP PL D EEL KWSFYRA+IAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDIEGAEHGEFAS-KDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RAV+Y+VAQCLGAICG GLVKAFQK+YYV+YGGGAN L DGY+KGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGT  174

Query  604  FVLV  615
            FVLV
Sbjct  175  FVLV  178



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 164/183 (90%), Gaps = 6/183 (3%)
 Frame = +1

Query  70   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+EGA     A KDYQDPPP PL D EEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEGAEHGEFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAV+Y+VAQCLGAICG GLVKAFQK+YYV+YGGGAN L DGY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTF  175

Query  607  VLV  615
            VLV
Sbjct  176  VLV  178



>gb|KJB62459.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=285

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+ YM AQCLGAICGCGLVKAFQ +YY +YGGGAN L +GYS GTGL AEIIGTFV
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E   E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFNA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ D   K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQID-TTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGAN L  G+SKGTGLGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDV     ++A KDY DPPPAPLIDP EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKDVPEQGSFSA-KDYHDPPPAPLIDPGELAKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKS TDP +   D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSTTDPALNA-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RA+MYMVAQCLGAICG GLVKAF K+ Y RYGGGAN L DGY+KGTGLGAEIIGTFV
Sbjct  119  SLIRAIMYMVAQCLGAICGVGLVKAFNKSLYNRYGGGANSLADGYNKGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE  + E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRA++YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+ YM AQCLGAICGCGLVKAFQ +YY +YGGGAN L +GYS GTGL AEIIGTFV
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 159/176 (90%), Gaps = 1/176 (1%)
 Frame = +1

Query  88   GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTD  267
            G  E+AA KDY DPPPAPLID  ELG WS YRA+IAEFIATLLFLY+TVLTVIGYK QTD
Sbjct  12   GGGEFAA-KDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTD  70

Query  268  PNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV  447
            PNV GTD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+
Sbjct  71   PNVAGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAL  130

Query  448  MYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            +Y+VAQCLGAICG GLVKAFQ AY+ RYGGGAN L  GYS+GTGLGAEIIGTFVLV
Sbjct  131  LYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLV  186



>gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea]
Length=286

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDV     + A KDY DPPPAPL DP EL KWSFYRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MTKDVAEHGSFPA-KDYHDPPPAPLFDPVELTKWSFYRALIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ DP +KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDPALKG-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICG  LVKAFQ AYYV+YGGGAN L DGYS G GLGAEI+GTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVALVKAFQSAYYVKYGGGANSLSDGYSTGVGLGAEIVGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>emb|CDX74983.1| BnaA05g07290D [Brassica napus]
Length=197

 Score =   273 bits (697),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEGA  +AA +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_006403531.1| hypothetical protein EUTSA_v10010603mg [Eutrema salsugineum]
 gb|ESQ44984.1| hypothetical protein EUTSA_v10010603mg [Eutrema salsugineum]
Length=286

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGEKRSFSGKDYQDPPPEPLFDAAELGKWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLN-PDQCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            +LVRAVMYMVAQCLGAICG  LVK+FQ AYY RYGGGANGL DGYS GTG+ AEI+GTFV
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVKSFQSAYYTRYGGGANGLADGYSVGTGVAAEIVGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score =   276 bits (705),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE  + E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYK +TD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIETDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_004304426.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   275 bits (703),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 164/182 (90%), Gaps = 3/182 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M +D+E    +AA KDYQDPPP PLIDPEE GKWSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGRDIE-VGGFAA-KDYQDPPPTPLIDPEEFGKWSFYRAIIAEFVATLLFLYITVLTVIG  58

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL RAV+Y+VAQCLGAICGCGLVK+FQ A Y  YGGGANGL DGYS+GTGL AEIIGTFV
Sbjct  118  SLPRAVLYIVAQCLGAICGCGLVKSFQSALYSNYGGGANGLADGYSEGTGLAAEIIGTFV  177

Query  610  LV  615
            LV
Sbjct  178  LV  179



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   275 bits (704),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 162/186 (87%), Gaps = 4/186 (2%)
 Frame = +1

Query  70   MAKDVEGATEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            M KD+E A ++    + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  241  vIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  417
            VIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  418  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  597
             RKVSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ G++KGTGLGAEII
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGFNKGTGLGAEII  180

Query  598  GTFVLV  615
            GTFVLV
Sbjct  181  GTFVLV  186



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   275 bits (703),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 162/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE  TE  +   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVE-VTERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKHQSDLKDHG-DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RA+MYMVAQCLGAICG GLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>gb|ACV70048.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=224

 Score =   273 bits (697),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 157/169 (93%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQT-DPNVKGTD  288
            KDY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+TVLTVIGYKSQT DP     D
Sbjct  1    KDYVDPPPAPLVDAEELTQWSFYRAIIAEFIATLLFLYITVLTVIGYKSQTADPT---AD  57

Query  289  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQC  468
            +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM+AQC
Sbjct  58   QCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMIAQC  117

Query  469  LGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            LGAICGCGLVKAFQ+AYY +YGGGANGL DGYSKGTGL AEIIGTFVLV
Sbjct  118  LGAICGCGLVKAFQRAYYSKYGGGANGLSDGYSKGTGLAAEIIGTFVLV  166



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE A   + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYK Q+D    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKVQSDVK-NGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YMVAQCLGAICG GLVKAFQK++Y +YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  120  VSLIRAILYMVAQCLGAICGVGLVKAFQKSHYNKYGGGANSLNDGYSTGTGLGAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   275 bits (702),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 161/183 (88%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDVE     AA +DY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MVKDVE----MAAGRDYHDPPPAPLIDSEELTQWSFYRALIAEFIATLLFLYVTVLTVIG  56

Query  250  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            Y+ QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  57   YRVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAVMYMVAQCLGAICGCGLVK FQK+YY  YGGGAN LQDG++KGTGLGAEIIGTF
Sbjct  117  VSLVRAVMYMVAQCLGAICGCGLVKGFQKSYYNTYGGGANELQDGFNKGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   275 bits (703),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 164/184 (89%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+  A +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RAVMY+VAQCLGAICG  LVKAFQ +YY  YGGGAN L  GYSKGTGLGAEIIGT
Sbjct  119  KVSLIRAVMYIVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSKGTGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 162/183 (89%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTD----HADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+Y+ +YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  117  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 165/184 (90%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+  A +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RAVMY+VAQCLGAICG  LVKAFQ+AYY RYGGGAN +  GY+KGT LGAEIIGT
Sbjct  119  KVSLIRAVMYIVAQCLGAICGVALVKAFQRAYYDRYGGGANEVAPGYNKGTALGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 160/183 (87%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDVE   E+ A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MGKDVEA--EFTA-KDYTDPPPAPLIDAEELAKWSLYRAVIAEFIATLLFLYITVATVIG  57

Query  250  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            YK Q+DPNV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  58   YKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YM+AQCLGAICG GLVK+FQKAYY RYGGGAN L  GYSKGTGL AEIIGTF
Sbjct  118  VSLIRALLYMIAQCLGAICGVGLVKSFQKAYYNRYGGGANELSSGYSKGTGLAAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   275 bits (702),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E   E  A +DYQDPPPAPL D EELGKWS YRA+IAEF+ATLLFLYV++LTVIG
Sbjct  1    MAKDLE-VQEGRAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKAQTDASAGGAD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L +GY+KGTGLGAEIIGTFV
Sbjct  119  SLVRTVLYIVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLAEGYNKGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 158/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEGA  Y A +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGYQA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 160/186 (86%), Gaps = 5/186 (3%)
 Frame = +1

Query  70   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE A    EYA  KDY DPPPAPL D EEL KWS YRA IAEFIAT+LFLYVTV T
Sbjct  1    MAKDVEAAAGHGEYAV-KDYTDPPPAPLFDWEELTKWSLYRAAIAEFIATMLFLYVTVAT  59

Query  241  vIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  417
            VIGYK Q+DPNV  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  418  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  597
            ARKVSL+RA++YM+ QCLGAICG GLVK FQKA++VRYGGGAN L DGYSKGTGL AEII
Sbjct  120  ARKVSLIRALLYMIGQCLGAICGVGLVKGFQKAFFVRYGGGANELSDGYSKGTGLAAEII  179

Query  598  GTFVLV  615
            GTFVLV
Sbjct  180  GTFVLV  185



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 158/185 (85%), Gaps = 3/185 (2%)
 Frame = +1

Query  70   MAKDVEGATEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            M KDVE A E      KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEAGEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVATV  60

Query  244  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            IGYK Q+D NV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDANVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSL+RA++YM+AQCLGAICG GLVK FQKAYYVRYGGGAN L  GYS+GTGL AEIIG
Sbjct  121  RKVSLIRALLYMIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGYSRGTGLAAEIIG  180

Query  601  TFVLV  615
            TFVLV
Sbjct  181  TFVLV  185



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEGA  +AA +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|NP_001268058.1| aquaporin-like [Vitis vinifera]
 gb|ABN14352.1| aquaporin PIP2;3 [Vitis vinifera]
 emb|CAN77241.1| hypothetical protein VITISV_029527 [Vitis vinifera]
 gb|AIK66516.1| putative aquaporin [Vitis vinifera]
Length=287

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E A       KDY DPPPAPL+DPEELG WSFYRAIIAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEVAGHGDLTLKDYHDPPPAPLVDPEELGSWSFYRAIIAEFVATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYK+QTDP   G +EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKNQTDPYHHG-NECNGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAVMYMVAQC GAICGCGLVK FQ  YY+RYGGGAN L  GYS GTGL AEIIGTF
Sbjct  120  VSLVRAVMYMVAQCGGAICGCGLVKLFQDIYYIRYGGGANELASGYSIGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 162/182 (89%), Gaps = 3/182 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E    +AA KDY DPPP PLIDPEE GKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIE-VGGFAA-KDYHDPPPTPLIDPEEFGKWSFYRAIIAEFIATLLFLYITVLTVIG  58

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL RAVMY+VAQ LGAICGC LVK+FQ A Y  YGGGANGL DGY+KGTGL AEIIGTFV
Sbjct  118  SLPRAVMYIVAQSLGAICGCALVKSFQSALYTNYGGGANGLADGYNKGTGLAAEIIGTFV  177

Query  610  LV  615
            LV
Sbjct  178  LV  179



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 162/183 (89%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTD----HADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+Y+ +YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  117  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>ref|XP_008243934.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=284

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 163/184 (89%), Gaps = 7/184 (4%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD E  G     + KDYQDPPPAPLID EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDSEVGGGHNRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVRA++YMVAQ LGAICG GLVKAFQKAY+ +YGGGANGL DGYS+GTGL AEIIGT
Sbjct  116  KVSLVRAILYMVAQSLGAICGVGLVKAFQKAYFTKYGGGANGLADGYSQGTGLAAEIIGT  175

Query  604  FVLV  615
            FVLV
Sbjct  176  FVLV  179



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 163/189 (86%), Gaps = 8/189 (4%)
 Frame = +1

Query  70   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  231
            M KD+E      G  E++A KDYQDPPPAPLID EEL KWS YRA IAEFIATLLFLYVT
Sbjct  1    MTKDIETTAEQGGGAEFSA-KDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYVT  59

Query  232  vltvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  408
            VLTVIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG
Sbjct  60   VLTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  119

Query  409  LFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGA  588
            LF+ RKVSL+RA++YMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQDG++KGTGLGA
Sbjct  120  LFVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLGA  179

Query  589  EIIGTFVLV  615
            EIIGTFVLV
Sbjct  180  EIIGTFVLV  188



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E    Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDTALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YM AQ LGAICG GLVKAFQ +YY +YGGGAN L DGYS GTGLGAEI+GTFV
Sbjct  119  SLVRAILYMTAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 163/187 (87%), Gaps = 6/187 (3%)
 Frame = +1

Query  70   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            M KD+E A     E++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVL
Sbjct  1    MTKDIETAEQRGGEFSA-KDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVL  59

Query  238  tvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  414
            TVIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  415  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  594
            + RKVSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ G++KGTGLGAEI
Sbjct  120  VGRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGFNKGTGLGAEI  179

Query  595  IGTFVLV  615
            IGTFVLV
Sbjct  180  IGTFVLV  186



>ref|XP_008366675.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=281

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E    Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDTALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YM AQ LGAICG GLVKAFQ +YY +YGGGAN L DGYS GTGLGAEI+GTFV
Sbjct  119  SLVRAILYMTAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 158/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE  + E    +DYQDPPPAPL DP EL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPAELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRA++YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_006291621.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
 gb|EOA24519.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
Length=271

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDV G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MMKDVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP++   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPHLH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAVMYMVAQCLGAICG  LVK+FQ  YY RYGGGANGL DGYS GTG+ AEIIGTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVKSFQSGYYNRYGGGANGLSDGYSIGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 161/183 (88%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKDIEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ D N    D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADPCNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAVMYMVAQCLGAICG GLVKAFQK+YY +Y GGAN L DGYS GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYTKYQGGANILADGYSTGTGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>gb|KJB26182.1| hypothetical protein B456_004G229000 [Gossypium raimondii]
Length=282

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 161/183 (88%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDVE A    A +DY DPPPAPLI+ EEL +WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MVKDVETA----AGRDYHDPPPAPLINAEELTQWSFYRALIAEFIATLLFLYVTVLTVIG  56

Query  250  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  57   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAVMYMVAQCLGAICGCGLVK FQK+YY  YGGGAN LQDG++KGTGLGAEIIGTF
Sbjct  117  VSLVRAVMYMVAQCLGAICGCGLVKWFQKSYYNTYGGGANELQDGFNKGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 162/183 (89%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E     A A +DYQDPPPAPL D EELGKWS YRA+IAEF+ATLLFLYV++LTVI
Sbjct  1    MAKDLEVQEGGAMAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLARK
Sbjct  61   GYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTF
Sbjct  120  VSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLADGYNKGTGLGAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 163/190 (86%), Gaps = 8/190 (4%)
 Frame = +1

Query  67   KMAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyv  228
             M KD+E      G  E++A KDYQDPPPAPLID EEL KWS YRA IAEFIATLLFLYV
Sbjct  29   NMTKDIETTAEQGGGAEFSA-KDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYV  87

Query  229  tvltvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  405
            TVLTVIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  88   TVLTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  147

Query  406  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLG  585
            GLF+ RKVSL+RA++YMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQDG++KGTGLG
Sbjct  148  GLFVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLG  207

Query  586  AEIIGTFVLV  615
            AEIIGTFVLV
Sbjct  208  AEIIGTFVLV  217



>ref|XP_010046653.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=286

 Score =   273 bits (699),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 162/184 (88%), Gaps = 5/184 (3%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+E  G       KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVRAV+YMVAQCLGA+CGCGLVK FQKAYY+  GGGANGL +GYS GTGL AEIIGT
Sbjct  118  KVSLVRAVLYMVAQCLGAVCGCGLVKQFQKAYYIEQGGGANGLSEGYSTGTGLAAEIIGT  177

Query  604  FVLV  615
            FVLV
Sbjct  178  FVLV  181



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 165/184 (90%), Gaps = 8/184 (4%)
 Frame = +1

Query  70   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVEGA   E+AA KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEGAEHGEFAA-KDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RAV+Y++AQCLGAICG GLVKAFQK+YYV+YGGGAN L  GY+KGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGT  174

Query  604  FVLV  615
            FVLV
Sbjct  175  FVLV  178



>ref|XP_009345759.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009345763.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=285

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E    Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YMVAQ LGAICG GLVKAFQ +YY +YGGGAN L DGYS  TGLGAEI+GTFV
Sbjct  119  SLVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTSTGLGAEIVGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 163/186 (88%), Gaps = 8/186 (4%)
 Frame = +1

Query  70   MAKDVE----GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAKD+E    GAT   A +DY DPPPAPL+D EE GKWS YRA+IAEF+ TLLFLYV+VL
Sbjct  1    MAKDLEVQEGGAT---AARDYVDPPPAPLLDMEEFGKWSLYRAVIAEFVXTLLFLYVSVL  57

Query  238  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  417
            TVIGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  58   TVIGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  116

Query  418  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  597
            ARKVSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEII
Sbjct  117  ARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEII  176

Query  598  GTFVLV  615
            GTFVLV
Sbjct  177  GTFVLV  182



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEGA  +AA +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_008345410.1| PREDICTED: aquaporin PIP2-1-like [Malus domestica]
Length=227

 Score =   271 bits (693),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 162/183 (89%), Gaps = 3/183 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E  +   A KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVGSGNPA-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGG-HINPAVTFGLFLARK  426
            YK QTD  + G ++CGGVGI GIAWAFGGMIF+LVYCTAGISGG HINPAVTFGLFL RK
Sbjct  60   YKQQTDTTLNG-NQCGGVGIHGIAWAFGGMIFVLVYCTAGISGGGHINPAVTFGLFLTRK  118

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YMVAQ LGAICG GLVKAFQ AYY +YGGGAN L DGYS GTGLGAEI+GTF
Sbjct  119  VSLMRAILYMVAQSLGAICGVGLVKAFQSAYYTKYGGGANKLADGYSTGTGLGAEIVGTF  178

Query  607  VLV  615
            VLV
Sbjct  179  VLV  181



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 161/183 (88%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTD----HADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCL AICG GLVKAFQK+Y+ +YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  117  VSLIRAIMYMVAQCLSAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>ref|XP_002446796.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
 gb|EES11124.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
Length=292

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 162/190 (85%), Gaps = 9/190 (5%)
 Frame = +1

Query  70   MAKDVEGAT-------EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyv  228
            MAKD+E A        EY A KDY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLY+
Sbjct  1    MAKDIEAAAAAHGGGGEYTA-KDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYI  59

Query  229  tvltvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  405
            TV TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVTF
Sbjct  60   TVATVIGYKHQTDASSSGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTF  119

Query  406  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLG  585
            GLFLARKVSLVRA++Y+VAQCLGAICG GLVK FQ A+YVRYGGGANGL DGYSKGTGL 
Sbjct  120  GLFLARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAFYVRYGGGANGLSDGYSKGTGLA  179

Query  586  AEIIGTFVLV  615
            AEIIGTFVLV
Sbjct  180  AEIIGTFVLV  189



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 162/187 (87%), Gaps = 6/187 (3%)
 Frame = +1

Query  70   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAKD+E     A E++A KDY DPPPAPL+D EEL +WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYTDPPPAPLVDAEELTQWSLYRAVIAEFIATLLFLYITVA  59

Query  238  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  414
            TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  415  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  594
            LARKVSLVRA++Y+VAQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AEI
Sbjct  120  LARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEI  179

Query  595  IGTFVLV  615
            IGTFVLV
Sbjct  180  IGTFVLV  186



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 162/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE     EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RA++Y+VAQC GAICG GL K FQKAYY RYGGGAN + DGY+KGT LGAEIIGT
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNKGTALGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   273 bits (697),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 161/183 (88%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E A   + + KDY DPPPAPL D +EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ D N    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAVMYMVAQCLGAICG GLVKAFQK+YY RYGGGAN L DG+S GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKRYGGGANTLADGFSTGTGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   273 bits (697),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 162/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE     EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RA++Y+VAQC GAICG GL K FQKAYY RYGGGAN + DGY+KGT LGAEIIGT
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNKGTALGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 162/187 (87%), Gaps = 6/187 (3%)
 Frame = +1

Query  70   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAKD+E     A E++A KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVA  59

Query  238  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  414
            TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  415  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  594
            LARKVSLVRA++Y++AQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AEI
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEI  179

Query  595  IGTFVLV  615
            IGTFVLV
Sbjct  180  IGTFVLV  186



>ref|XP_008446888.1| PREDICTED: aquaporin PIP2-1-like [Cucumis melo]
Length=287

 Score =   273 bits (697),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD   A    + KDY DPPPAPL D  ELGKWSFYRAIIAEFIATLLFLYVT+LT+IG
Sbjct  1    MAKDDVTAARGFSGKDYHDPPPAPLFDAAELGKWSFYRAIIAEFIATLLFLYVTILTIIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            Y SQTD N  GT+ C GVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YNSQTDTNKPGTNACDGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  120

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAV YM+AQCLGA+CG GLVKAFQK+YY +YGGGAN L  GYSKGTGLGAEI+GTF+
Sbjct  121  SLVRAVAYMIAQCLGAVCGAGLVKAFQKSYYNKYGGGANQLAHGYSKGTGLGAEIVGTFI  180

Query  610  LV  615
            LV
Sbjct  181  LV  182



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 161/183 (88%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE A   + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GY  QTD    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYSIQTDVKAGG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAVMYMVAQ LGAICG GLVKAFQK+Y+VRYGGGAN LQ GYS G GLGAEI+GTF
Sbjct  120  VSLIRAVMYMVAQSLGAICGVGLVKAFQKSYFVRYGGGANFLQPGYSTGVGLGAEIVGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_007207344.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
 gb|EMJ08543.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
Length=284

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 163/184 (89%), Gaps = 7/184 (4%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+E  G     + KDYQDPPPAPLID EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGGQHRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQSE-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVRA++YMVAQ LGAICG GLVKAFQ AY+ +YGGGANGL DGYS+GTGL AEIIGT
Sbjct  116  KVSLVRAILYMVAQSLGAICGVGLVKAFQNAYFTKYGGGANGLADGYSQGTGLAAEIIGT  175

Query  604  FVLV  615
            FVLV
Sbjct  176  FVLV  179



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 163/187 (87%), Gaps = 6/187 (3%)
 Frame = +1

Query  70   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAK+VE A     E++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYV+VL
Sbjct  1    MAKEVETAEQGGGEFSA-KDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLYVSVL  59

Query  238  tvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  414
            TVIGYK QTD      D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKVQTDTLKNTVDADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  415  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  594
            L RKVSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ GY+KGTGLGAEI
Sbjct  120  LGRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNTYGGGANELQPGYNKGTGLGAEI  179

Query  595  IGTFVLV  615
            IGTFVLV
Sbjct  180  IGTFVLV  186



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   272 bits (696),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEGA E    +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLY+TVLTVIG
Sbjct  1    MAKDVEGA-EGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK  +D    G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 159/188 (85%), Gaps = 7/188 (4%)
 Frame = +1

Query  70   MAKDVEGAT-----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  234
            MAKD+E A      EY A KDY DPPPAPLID EEL KWS YRA+IAEF+ATLLFLY+TV
Sbjct  1    MAKDIEAAAAPEGGEYTA-KDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITV  59

Query  235  ltvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  411
             TVIGYK QTD    G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVT GL
Sbjct  60   ATVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTLGL  119

Query  412  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  591
            FLARKVSLVRA++Y+VAQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AE
Sbjct  120  FLARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAE  179

Query  592  IIGTFVLV  615
            IIGTFVLV
Sbjct  180  IIGTFVLV  187



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 161/187 (86%), Gaps = 6/187 (3%)
 Frame = +1

Query  70   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAKD+E +     E++A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASAPEGGEFSA-KDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVA  59

Query  238  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  414
            TVIGYK Q+D  V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  415  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  594
            LARKVSL+RAV+Y++AQCLGAICG GLVK FQ +YY RYGGGAN L DGYSKGTGLGAEI
Sbjct  120  LARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEI  179

Query  595  IGTFVLV  615
            IGTFVLV
Sbjct  180  IGTFVLV  186



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 164/186 (88%), Gaps = 6/186 (3%)
 Frame = +1

Query  70   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAK+VE       E++A KDY DPPPAPL+D  EL KWSFYRAIIAEFIATLLFLY+TVL
Sbjct  1    MAKEVEETVVTEQEFSA-KDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLYITVL  59

Query  238  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  417
            TVIGYKSQTDP +K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  60   TVIGYKSQTDP-IKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  118

Query  418  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  597
            ARKVSL+RA++YMVAQC GAICG GLVKAFQ+AYY RYGGGAN +  GY+KGT LGAEII
Sbjct  119  ARKVSLIRALLYMVAQCSGAICGVGLVKAFQRAYYDRYGGGANEVAPGYNKGTALGAEII  178

Query  598  GTFVLV  615
            GTFVLV
Sbjct  179  GTFVLV  184



>gb|AAL49752.1|AF452014_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAK+V     +   KDYQDPPPAPLIDP EL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNVGSEGSFTT-KDYQDPPPAPLIDPAELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKS++DP  K  D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSESDP-AKNADPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAVMYMVAQCLGAICG GLVKAFQ AYY RY GGAN L DGYSK  GL AEIIGTFV
Sbjct  119  SLIRAVMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSKSVGLSAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   273 bits (697),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 161/187 (86%), Gaps = 6/187 (3%)
 Frame = +1

Query  70   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAKD+E +     E++A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASAPEGGEFSA-KDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVA  59

Query  238  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  414
            TVIGYK Q+D  V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  415  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  594
            LARKVSL+RAV+Y++AQCLGAICG GLVK FQ +YY RYGGGAN L DGYSKGTGLGAEI
Sbjct  120  LARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEI  179

Query  595  IGTFVLV  615
            IGTFVLV
Sbjct  180  IGTFVLV  186



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 162/183 (89%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAK DVEG +   A KDY DPPPAPLID EEL +WSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKHDVEGGS--FAAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVI  58

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>ref|XP_002311092.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK95655.1| unknown [Populus trichocarpa]
 gb|EEE88459.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=285

 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 160/183 (87%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD E A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKDTEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ D N    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAVMYMVAQC GAICG GLVKAFQK+YY +Y GGAN L DGYS GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCAGAICGVGLVKAFQKSYYTKYNGGANVLADGYSTGTGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>gb|KCW88816.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=325

 Score =   274 bits (700),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 163/187 (87%), Gaps = 5/187 (3%)
 Frame = +1

Query  61   ELKMAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  234
            E  MAKD+E  G       KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TV
Sbjct  68   EAGMAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITV  127

Query  235  ltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  414
            LTVIGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLF
Sbjct  128  LTVIGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  184

Query  415  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  594
            LARKVSLVRAV+YMVAQCLGA+CGCGLVK FQKAYY+  GGGANGL +GYS GTGL AEI
Sbjct  185  LARKVSLVRAVLYMVAQCLGAVCGCGLVKQFQKAYYIEQGGGANGLSEGYSTGTGLAAEI  244

Query  595  IGTFVLV  615
            IGTFVLV
Sbjct  245  IGTFVLV  251



>emb|CDX67611.1| BnaA07g16510D [Brassica napus]
Length=286

 Score =   272 bits (696),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDV G     + KDYQDPPP PL D  ELG+WSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKDVAGEKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLN-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            +LVRAVMYMVAQCLGAICG  LVK+FQ +YY RYGGGANGL  GYS GTG+ AEIIGTFV
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVKSFQSSYYTRYGGGANGLTHGYSIGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score =   272 bits (696),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 161/184 (88%), Positives = 166/184 (90%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+E  G  E+ A KDY DPPPAPLID EEL KWSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGQGEFHA-KDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVRAVMYMVAQCLGAICGCGLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   272 bits (695),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 162/183 (89%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAK DVEG +  A  KDY DPPPAPLID +EL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDAKAGG-DLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYTRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 163/184 (89%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+  A +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RA +YMVAQCLGAICG  LVKAFQ +YY  YGGGAN L  GYSKGTGLGAEIIGT
Sbjct  119  KVSLIRAGLYMVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSKGTGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDV     + A KDY DPPPAPLID  EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MVKDVTEQGSFPA-KDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDP-AKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAVMYMVAQCLGAI G GLVKAFQ ++Y RYGGGAN L  GYSKG GLGAEIIGTFV
Sbjct  119  SLVRAVMYMVAQCLGAIAGVGLVKAFQSSFYKRYGGGANSLAAGYSKGVGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 162/183 (89%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAK DVEG +  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVI  58

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>gb|KCW88815.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=356

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 163/187 (87%), Gaps = 5/187 (3%)
 Frame = +1

Query  61   ELKMAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  234
            E  MAKD+E  G       KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TV
Sbjct  68   EAGMAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITV  127

Query  235  ltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  414
            LTVIGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLF
Sbjct  128  LTVIGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  184

Query  415  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  594
            LARKVSLVRAV+YMVAQCLGA+CGCGLVK FQKAYY+  GGGANGL +GYS GTGL AEI
Sbjct  185  LARKVSLVRAVLYMVAQCLGAVCGCGLVKQFQKAYYIEQGGGANGLSEGYSTGTGLAAEI  244

Query  595  IGTFVLV  615
            IGTFVLV
Sbjct  245  IGTFVLV  251



>emb|CDX91340.1| BnaC04g08100D [Brassica napus]
Length=285

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAK+VEGA  +A+ +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKEVEGAEGFAS-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|KCW51593.1| hypothetical protein EUGRSUZ_J01087 [Eucalyptus grandis]
Length=336

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  106  APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGT  285
            + KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+TVLTVIGYKSQTD    GT
Sbjct  111  SAKDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITVLTVIGYKSQTDDKKPGT  170

Query  286  DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQ  465
            D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYMVAQ
Sbjct  171  DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMVAQ  230

Query  466  CLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            CLGAICG GLVK FQK+YY +YGGGAN L +GY    GLGAEIIGTFVLV
Sbjct  231  CLGAICGVGLVKLFQKSYYEQYGGGANMLAEGYKTRVGLGAEIIGTFVLV  280



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 165/190 (87%), Gaps = 10/190 (5%)
 Frame = +1

Query  70   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  231
            M KD+E      G  E++A KDY DPPPAPLID EEL KWS YRA IAEFIATLLFLYVT
Sbjct  1    MTKDIETTAEQGGGAEFSA-KDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLYVT  59

Query  232  vltvIGYKSQTDPNVKGTDE--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  405
            VLTVIGYK QTDP VK T++  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  60   VLTVIGYKVQTDP-VKNTNDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  118

Query  406  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLG  585
            GLF+ RKVSL+RA++YMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQDG++KGTGLG
Sbjct  119  GLFVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLG  178

Query  586  AEIIGTFVLV  615
            AEIIGTFVLV
Sbjct  179  AEIIGTFVLV  188



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 162/183 (89%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAK DVEG +  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 161/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE  TE  +   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVE-VTERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYK Q+D    G D CGGVGILGIAWAFGGMIFILVY TAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKHQSDLKDHG-DACGGVGILGIAWAFGGMIFILVYWTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RA+MYMVAQCLGAICG GLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_006291622.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
 gb|EOA24520.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
Length=286

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDV G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MMKDVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP++   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPHLH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAVMYMVAQCLGAICG  LVK+FQ  YY RYGGGANGL DGYS GTG+ AEIIGTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVKSFQSGYYNRYGGGANGLSDGYSIGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>emb|CDY13298.1| BnaC06g14590D [Brassica napus]
Length=287

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 158/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEG-ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE  A E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVAGEGFQSRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
             YK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   CYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRA++YMVAQCLGAICG G V+AFQ +YYVRYGGGAN L DGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVQAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 160/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E A   + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQTDP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAV+YMVAQ LGAI G  LVKAFQK+YY++YGGGAN L DGYS G GLGAEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLGAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 158/185 (85%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE  G  EY   KDY DPPP PL+D EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDVEAGGRGEYGG-KDYSDPPPEPLVDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  244  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            IGYK Q+DP V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   IGYKHQSDPAVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RK+SLVRA++YM+AQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AEIIG
Sbjct  120  RKISLVRALLYMIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>ref|XP_009342858.1| PREDICTED: probable aquaporin PIP2-5 isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E    Y+A KDYQD PP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDLPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YMVAQ LGAICG GLVKAFQ +YY +YGGGAN L DGYS GTGLGAEI+GTFV
Sbjct  119  SLVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_010032196.1| PREDICTED: aquaporin PIP2-1 [Eucalyptus grandis]
Length=284

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M K       ++A KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKHAAEHGSFSA-KDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD    GTD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDDKKPGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+MYMVAQCLGAICG GLVK FQK+YY +YGGGAN L +GY    GLGAEIIGTFV
Sbjct  120  SLVRAIMYMVAQCLGAICGVGLVKLFQKSYYEQYGGGANMLAEGYKTRVGLGAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>emb|CDY07519.1| BnaC06g15450D [Brassica napus]
Length=286

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDV G     + KDYQDPPP PL D  ELG+WSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKDVAGEKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLY-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            +LVRAVMYMVAQCLGAICG  LVK+FQ +YY RYGGGANGL  GYS GTG+ AEIIGTFV
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVKSFQSSYYTRYGGGANGLTHGYSIGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 158/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE    E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVPGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRA++YMVAQCLGAICG G VKAFQ +YY+RYGGGAN L +GYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSSYYIRYGGGANSLAEGYSTGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|NP_191042.1| putative aquaporin PIP2-5 [Arabidopsis thaliana]
 sp|Q9SV31.1|PIP25_ARATH RecName: Full=Probable aquaporin PIP2-5; AltName: Full=Plasma 
membrane intrinsic protein 2-5; Short=AtPIP2;5; AltName: Full=Plasma 
membrane intrinsic protein 2d; Short=PIP2d; Contains: 
RecName: Full=Probable aquaporin PIP2-5, N-terminally processed 
[Arabidopsis thaliana]
 gb|AAK44166.1|AF370351_1 putative aquaporin/MIP protein [Arabidopsis thaliana]
 emb|CAB41102.1| aquaporin/MIP-like protein [Arabidopsis thaliana]
 gb|AAL34155.1| putative aquaporin/MIP protein [Arabidopsis thaliana]
 gb|AAM61408.1| aquaporin/MIP-like protein [Arabidopsis thaliana]
 gb|AAN31817.1| putative aquaporin/plasma membrane intrinsic protein [Arabidopsis 
thaliana]
 gb|AEE79295.1| putative aquaporin PIP2-5 [Arabidopsis thaliana]
Length=286

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVT++TVIG
Sbjct  1    MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALN-PDQCTGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            +LVRAVMYMVAQCLGAICG  LVKAFQ AY+ RYGGGANGL DGYS GTG+ AEIIGTFV
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVKAFQSAYFTRYGGGANGLSDGYSIGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_009342865.1| PREDICTED: probable aquaporin PIP2-5 isoform X2 [Pyrus x bretschneideri]
Length=285

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E    Y+A KDYQD PP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEIGGGYSA-KDYQDLPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YMVAQ LGAICG GLVKAFQ +YY +YGGGAN L DGYS GTGLGAEI+GTFV
Sbjct  119  SLVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_009133125.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
Length=285

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 158/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEGA  +AA +DYQDPPP P  D EEL +WS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYQDPPPTPFFDAEELTRWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK  +D    G  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTTAGGV-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            +LVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  TLVRALLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 162/183 (89%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAK DVEG +  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGA+CG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAMCGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 162/184 (88%), Gaps = 8/184 (4%)
 Frame = +1

Query  70   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE     E+ A KDY DPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLYVT+LTV
Sbjct  1    MAKDVEVVEGGEFQA-KDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYVTILTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ+      TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQS-----ATDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVRAV+Y+VAQCLGAICG GLVKAFQ +YY R+GGGAN L D Y+KG GLGAEIIGT
Sbjct  115  KVSLVRAVLYIVAQCLGAICGTGLVKAFQSSYYNRHGGGANTLADHYNKGVGLGAEIIGT  174

Query  604  FVLV  615
            FVLV
Sbjct  175  FVLV  178



>ref|XP_010554547.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 158/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDV     ++  KDY DPPPAPL D  ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVAEHGSFSG-KDYHDPPPAPLFDATELGKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVK-GTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            Y SQT+  +  G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   YNSQTNTTLNPGADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAVMYMVAQCLGAICG GLVKAFQ +YY RYGGGAN L  GYS G G+GAEIIGTF
Sbjct  120  VSLVRAVMYMVAQCLGAICGVGLVKAFQSSYYTRYGGGANSLASGYSVGVGVGAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 163/184 (89%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAP--KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD++   E  AP  +DY+DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  1    MAKDLD-VQEGGAPAARDYKDPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  60   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGT
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 161/184 (88%), Gaps = 3/184 (2%)
 Frame = +1

Query  70   MAKD--VEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD  V+     AA +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  1    MAKDLDVQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  60

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  61   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGT
Sbjct  120  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  179

Query  604  FVLV  615
            FVLV
Sbjct  180  FVLV  183



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 163/184 (89%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAP--KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD++   E  AP  +DY+DPPPAPL+D EELGKWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  13   MAKDLD-VQEGGAPAARDYKDPPPAPLLDMEELGKWSLYRAVIAEFVATLLFLYVSVLTV  71

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYK+QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  72   IGYKAQTDATAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLAR  130

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGT
Sbjct  131  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  190

Query  604  FVLV  615
            FVLV
Sbjct  191  FVLV  194



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 163/186 (88%), Gaps = 8/186 (4%)
 Frame = +1

Query  70   MAKDVE----GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAKD+E    GAT   A +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV++L
Sbjct  1    MAKDLEVQEGGAT---AARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSIL  57

Query  238  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  417
            TVIGYK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  58   TVIGYKAQTDASAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  116

Query  418  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  597
            ARKVSLVR V+Y+VAQCLGAICGCG VKAFQ +YY RYGGGAN L DGY+KGTGLGAEII
Sbjct  117  ARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEII  176

Query  598  GTFVLV  615
            GTFVLV
Sbjct  177  GTFVLV  182



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 162/183 (89%), Gaps = 6/183 (3%)
 Frame = +1

Query  70   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVEGA     A KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAV+Y++AQCLGAICG GLVKAFQK+YY++YGGGAN L  GY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYMKYGGGANELSAGYNKGTGLGAEIIGTF  175

Query  607  VLV  615
            VLV
Sbjct  176  VLV  178



>emb|CDX74984.1| BnaA05g07300D [Brassica napus]
Length=310

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 159/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAK+VEGA  +A+ +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKEVEGAEGFAS-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 158/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E G     + KDYQDPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVGERGSFSAKDYQDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQTDP     D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPATNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAVMYMVAQ LGAI G  LVKAFQK+YY++YGGGAN L DGYS G GL AEIIGTF
Sbjct  120  VSLVRAVMYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 164/184 (89%), Gaps = 8/184 (4%)
 Frame = +1

Query  70   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE A   E+AA KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEHGEFAA-KDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RAV+Y++AQCLGAICG GLVKAFQK+YYV+YGGGAN L  GY+KGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGT  174

Query  604  FVLV  615
            FVLV
Sbjct  175  FVLV  178



>gb|KCW49751.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=258

 Score =   270 bits (689),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 161/185 (87%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAP---KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKD E   +       KDY+DPPPAPL+D EEL KWSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            VIGY  Q+D    G D+C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYSRQSD-TTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            R+VSLVRA++YMVAQCLGA+CGCGLVKAFQ+AYY RYGGGAN LQ GYSKGTGLGAEIIG
Sbjct  120  RRVSLVRAILYMVAQCLGAVCGCGLVKAFQRAYYKRYGGGANMLQAGYSKGTGLGAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>dbj|BAA92260.1| Plasma membrane aquaporin 2b [Raphanus sativus]
Length=283

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 158/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAK+VEGA  +A  +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKEVEGAEGFAT-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAV+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 162/184 (88%), Gaps = 8/184 (4%)
 Frame = +1

Query  70   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            M KDVE A   E++A KDY DPPPAPLID  EL  WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MGKDVEVAEHGEFSA-KDYTDPPPAPLIDMAELASWSFYRAIIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ+      TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQS-----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RAVMYMVAQCLGAICG G VKAFQK+YYV++GGGAN L DGY+KGTGL AEIIGT
Sbjct  115  KVSLIRAVMYMVAQCLGAICGVGFVKAFQKSYYVKFGGGANELADGYNKGTGLAAEIIGT  174

Query  604  FVLV  615
            FVLV
Sbjct  175  FVLV  178



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEGA E    +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGA-EGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK  +D    G D+CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DDCGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E A   + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQTDP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAV+YMVAQ LGAI G  LVKAFQK+YY++YGGGAN L DGYS G GL AEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score =   270 bits (690),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 156/183 (85%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            M KDVE A +     KDYQDPPPAPLIDPEEL KWS YRA IAEFIATLLFLYVTVLTVI
Sbjct  1    MGKDVEVAEQGEFQSKDYQDPPPAPLIDPEELTKWSLYRAAIAEFIATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GY  Q D      D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYSHQRDST---PDPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAV+YM+AQC GAICGCGLVKAFQ AYYVRY GGAN L DGY+KGTGLGAEIIGTF
Sbjct  118  VSLVRAVLYMLAQCAGAICGCGLVKAFQSAYYVRYNGGANMLSDGYNKGTGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAV+YMVAQCLGAICG GLVKAFQK YY RY GGAN L  GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_006436426.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
 gb|ESR49666.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
Length=206

 Score =   267 bits (683),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 156/184 (85%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD  G  E+ +   KDY DPPP PL D  EL KWSFYRA+IAEFIATLLFLYVTVLTV
Sbjct  1    MAKDT-GVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTDP  K  D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDP-AKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVRAVMYMVAQCLGAI G GLVKAFQK+YY RYGGGAN L DGYS G GL AEIIGT
Sbjct  119  KVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_006410897.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
 gb|ESQ52350.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
Length=285

 Score =   270 bits (690),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 158/182 (87%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEGA  + A +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFPA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L +GYS GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLAEGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   270 bits (691),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 160/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            M KD+E G     + KDY DPPP PLID EE GKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MGKDIEVGPQGGFSAKDYNDPPPTPLIDAEEFGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL RAV+Y+VAQ LGAICGCGLVK+FQ A Y  YGGGANGL DGYSKGTGL AEIIGTF
Sbjct  120  VSLPRAVLYIVAQSLGAICGCGLVKSFQSALYTNYGGGANGLADGYSKGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   270 bits (690),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAV+YMVAQCLGAICG GLVKAFQK YY RY GGAN L  GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   270 bits (689),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 159/182 (87%), Gaps = 5/182 (3%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDVE + +  + KDY DPPPAPLIDP+EL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKDVETSGQEFSNKDYHDPPPAPLIDPDELTQWSLYRAIIAEFIATLLFLYITVLTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ+D     TD CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQSD-----TDPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  115

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+MYM+AQCLGA+CG GLVKAFQ + Y RYGGGAN L  GY+KG GLGAEIIGTFV
Sbjct  116  SLVRALMYMIAQCLGAVCGVGLVKAFQSSLYNRYGGGANELAGGYNKGVGLGAEIIGTFV  175

Query  610  LV  615
            LV
Sbjct  176  LV  177



>gb|ACJ85211.1| unknown [Medicago truncatula]
Length=259

 Score =   269 bits (687),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 159/183 (87%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAV+YMVAQCLGAICG GLVKAFQK YY RY GGAN L  GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_004493972.1| PREDICTED: probable aquaporin PIP2-5-like [Cicer arietinum]
Length=287

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 157/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD++   + A P KDYQDPPPAPL D  EL +WSFYRA+IAEF+ATLLFLYVTV TVI
Sbjct  1    MAKDIQTEPQTALPNKDYQDPPPAPLFDTSELSQWSFYRALIAEFVATLLFLYVTVATVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GY SQTDP   GT  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNSQTDPAHNGT-ACDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YMV QCLGAICG GLVK FQK+YY RY GGAN L +GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAILYMVVQCLGAICGVGLVKGFQKSYYNRYKGGANMLSNGYSKGTGLGAEIIGTF  179

Query  607  VLV  615
             LV
Sbjct  180  FLV  182



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 162/185 (88%), Gaps = 5/185 (3%)
 Frame = +1

Query  70   MAKDVEGATEYAAP---KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKD++   E  AP   +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLD-VQEGGAPAPSRDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            VIGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLA
Sbjct  60   VIGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLA  118

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIG
Sbjct  119  RKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIG  178

Query  601  TFVLV  615
            TFVLV
Sbjct  179  TFVLV  183



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 161/183 (88%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAK DVEG +  A  KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSLYRALIAEFIATLLFLYITVLTVI  58

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>ref|XP_006428787.1| hypothetical protein CICLE_v10012633mg [Citrus clementina]
 gb|ESR42027.1| hypothetical protein CICLE_v10012633mg [Citrus clementina]
Length=235

 Score =   268 bits (685),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 165/184 (90%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+E  G  E+ A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEIGGQGEFHA-KDYHDPPPAPLIDAEELTQWSFYRATIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            K+SLVRAVMYMVAQCLGAICGCGLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KLSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 161/185 (87%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAP---KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKD E   +       KDY+DPPPAPL+D EEL KWSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            VIGY  Q+D    G D+C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYSRQSD-TTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            R+VSLVRA++YMVAQCLGA+CGCGLVKAFQ+AYY RYGGGAN LQ GYSKGTGLGAEIIG
Sbjct  120  RRVSLVRAILYMVAQCLGAVCGCGLVKAFQRAYYKRYGGGANMLQAGYSKGTGLGAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>ref|XP_006481455.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   270 bits (689),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 165/184 (90%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+E  G  E+ A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEIGGQGEFHA-KDYHDPPPAPLIDAEELTQWSFYRATIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVRAVMYMVAQCLGAICGCGLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 158/185 (85%), Gaps = 3/185 (2%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD E  G       KDYQDPPP+PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDFETGGGEVRDVAKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLYITVLTV  60

Query  244  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            IGYK Q+DP V G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RK+SL+RA+MYMVAQCLGAICG G VKAFQ AYY +YGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKLSLIRAIMYMVAQCLGAICGVGFVKAFQSAYYNKYGGGANELSVGYSKGTGLAAEIIG  180

Query  601  TFVLV  615
            TFVLV
Sbjct  181  TFVLV  185



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 160/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAK +E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATL FLY+TVLTVIG
Sbjct  1    MAKAIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLFFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK+QTD   KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDL-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA+ YM AQCLGAICGCGLVKAFQ +YY +YGGGAN L +GYS GTGL AEIIGTFV
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 160/187 (86%), Gaps = 6/187 (3%)
 Frame = +1

Query  70   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAKD+E     A E++A KDY DPPPAPLID  EL +WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYTDPPPAPLIDAAELTQWSLYRAVIAEFIATLLFLYITVA  59

Query  238  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  414
            TVIGYK QTD    G D  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDATASGPDAACGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  415  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  594
            LARKVSLVRA++Y++AQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AEI
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEI  179

Query  595  IGTFVLV  615
            IGTFVLV
Sbjct  180  IGTFVLV  186



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 157/185 (85%), Gaps = 3/185 (2%)
 Frame = +1

Query  70   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            M KDVE A E      KDY DPPPA LID EE+ KWS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEGGEFTAKDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLYITVATV  60

Query  244  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            IGYK Q+DPNV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA++YM+AQCLGAICG GLVK FQ+AYY RYGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKVSLVRALLYMIAQCLGAICGVGLVKGFQRAYYDRYGGGANELSSGYSKGTGLAAEIIG  180

Query  601  TFVLV  615
            TFVLV
Sbjct  181  TFVLV  185



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 157/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD+E A  +   KDY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLY+TV TVIG
Sbjct  1    MAKDIEAAAAHEG-KDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVATVIG  59

Query  250  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            YK QTD    G D  CGGVG+LGIAWAFGGMIFILVYCTAG+SGGHINPAVTFGLFLARK
Sbjct  60   YKHQTDAAASGPDAACGGVGVLGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRA++Y+VAQCLGAICG GLVK FQ A+YVRYGGGAN L  GYSKGTGL AEIIGTF
Sbjct  120  VSLVRALLYIVAQCLGAICGVGLVKGFQSAFYVRYGGGANELSAGYSKGTGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score =   270 bits (689),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 158/185 (85%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA++YM+AQC GAICG GL K FQK+YY RYGGG N + DGY+KGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSYYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   270 bits (689),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 158/185 (85%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA++YM+AQC GAICG GL K FQK+YY RYGGG N + DGY+KGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSYYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>ref|XP_010555818.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   270 bits (689),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 158/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDV     ++  KDY DPPPAP+ D  ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVAEQGSFSG-KDYHDPPPAPVFDTAELGKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVK-GTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            YKSQTD  +  G D+CGGVGILGIAWAFGGMIFILVYCT GISGGHINPAVTFGL LARK
Sbjct  60   YKSQTDATLNAGADQCGGVGILGIAWAFGGMIFILVYCTGGISGGHINPAVTFGLLLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAVMY+VAQCLGAICG GLVKAFQ +YY RYGGGAN L DGYS G G+GAEIIGTF
Sbjct  120  VSLVRAVMYIVAQCLGAICGVGLVKAFQSSYYSRYGGGANSLADGYSVGVGVGAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>emb|CDX10333.1| aquaporin [Coffea arabica]
Length=288

 Score =   270 bits (689),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 162/184 (88%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+ G  E+ +   KDY DPPPAPLID EEL KWSF+RAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDM-GVAEHGSFTTKDYHDPPPAPLIDLEELTKWSFFRAIIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ D   +G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQIDVAHQG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL RA+ YMVAQC+GAICG GLVKAFQ++YYV YGGGAN LQDGYS GTGL AEIIGT
Sbjct  119  KVSLTRALAYMVAQCVGAICGVGLVKAFQRSYYVTYGGGANQLQDGYSTGTGLAAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>gb|KDO44717.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=256

 Score =   268 bits (686),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 156/184 (85%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD  G  E+ +   KDY DPPP PL D  EL KWSFYRA+IAEFIATLLFLYVTVLTV
Sbjct  51   MAKD-TGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTV  109

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTDP  K  D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  110  IGYKSQTDP-AKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  168

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVRAVMYMVAQCLGAI G GLVKAFQK+YY RYGGGAN L DGYS G GL AEIIGT
Sbjct  169  KVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGT  228

Query  604  FVLV  615
            FVLV
Sbjct  229  FVLV  232



>ref|XP_010505294.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   269 bits (688),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAK VEGA  Y A +DY+DPPP P  D +EL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKGVEGAEGYQA-RDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 161/183 (88%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E A   + + KDY DPPPAPL D +EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ D +    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGS---ADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAVMYMVAQCLGAICG GLVKAFQK+YY +YGGGAN L DG+S GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSTGTGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 161/183 (88%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GY  QTD    G + CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNHQTDLKENG-EICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+Y+ +YGGGAN L  GYS GTGLGAEIIGTF
Sbjct  120  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLAAGYSTGTGLGAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_010516024.1| PREDICTED: probable aquaporin PIP2-5 [Camelina sativa]
Length=286

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAVMYMVAQCLGAICG  LVK+FQ  YY RYGGGANGL DGYS GTG+ AEIIGTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVKSFQSGYYNRYGGGANGLSDGYSVGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>gb|ACV70050.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=224

 Score =   267 bits (682),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 155/169 (92%), Gaps = 4/169 (2%)
 Frame = +1

Query  112  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQT-DPNVKGTD  288
            KDY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+TVLTVIGYKSQT DP     D
Sbjct  1    KDYDDPPPAPLVDAEELTQWSFYRAIIAEFIATLLFLYITVLTVIGYKSQTADPT---AD  57

Query  289  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQC  468
            +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM+AQC
Sbjct  58   QCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMIAQC  117

Query  469  LGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            LGAICGCGLVKAFQ+AYY R+GGGAN L  GYSKGTGL AEIIGTFVLV
Sbjct  118  LGAICGCGLVKAFQRAYYSRFGGGANELALGYSKGTGLAAEIIGTFVLV  166



>ref|XP_011077012.1| PREDICTED: probable aquaporin PIP2-5 [Sesamum indicum]
Length=281

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 157/182 (86%), Gaps = 6/182 (3%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M K+V     Y A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKEVAEHGSYGA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ+       D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQS-----AADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  114

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAVMYMVAQCLGAICG GLVKAFQ+++Y RYGGGANGL DGYS G GL AEIIGTFV
Sbjct  115  SLVRAVMYMVAQCLGAICGVGLVKAFQRSHYKRYGGGANGLSDGYSVGVGLAAEIIGTFV  174

Query  610  LV  615
            LV
Sbjct  175  LV  176



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 161/183 (88%), Gaps = 4/183 (2%)
 Frame = +1

Query  70   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAK D EG +  A  KDY DPPPAPLID +EL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDAEGGSFSA--KDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY +YGGGAN L DGYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNKYGGGANELSDGYSTGVGLGAEIIGTF  177

Query  607  VLV  615
            VLV
Sbjct  178  VLV  180



>gb|KCW51592.1| hypothetical protein EUGRSUZ_J01087 [Eucalyptus grandis]
Length=383

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +1

Query  112  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  291
            KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+TVLTVIGYKSQTD    GTD 
Sbjct  113  KDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITVLTVIGYKSQTDDKKPGTDA  172

Query  292  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  471
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYMVAQCL
Sbjct  173  CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMVAQCL  232

Query  472  GAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            GAICG GLVK FQK+YY +YGGGAN L +GY    GLGAEIIGTFVLV
Sbjct  233  GAICGVGLVKLFQKSYYEQYGGGANMLAEGYKTRVGLGAEIIGTFVLV  280



>ref|XP_009413716.1| PREDICTED: probable aquaporin PIP2-3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 157/185 (85%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD E  G  EY   KDY DPPPAPLID EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDTEVAGRGEYGG-KDYTDPPPAPLIDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  244  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            IGYK Q+DPNV   D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  60   IGYKHQSDPNVNPADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA++YMVAQCLGAICG GLVK FQ+AY+VRYGGGAN L  GYSKGTGL AEIIG
Sbjct  120  RKVSLVRALLYMVAQCLGAICGVGLVKGFQEAYFVRYGGGANELSAGYSKGTGLAAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 167/182 (92%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E   E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD N  G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDVNKNG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGANGL +GYSKGTGLGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANGLANGYSKGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|EPS68613.1| hypothetical protein M569_06155, partial [Genlisea aurea]
Length=280

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 160/184 (87%), Gaps = 7/184 (4%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            M KD+E   + EY   KDY DPPPAPLIDPEEL KWS YRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MTKDLEVGRSGEYGHAKDYHDPPPAPLIDPEELVKWSLYRAVIAEFIATLLFLYITVLTV  60

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQ       TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQF-----ATDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVRA +Y+VAQCLGAICGCGLVK+FQ+A+YV +GGGANGL  GYS+GTGL AEIIGT
Sbjct  116  KVSLVRAFLYIVAQCLGAICGCGLVKSFQRAFYVEHGGGANGLSVGYSRGTGLAAEIIGT  175

Query  604  FVLV  615
            FVLV
Sbjct  176  FVLV  179



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 160/184 (87%), Gaps = 3/184 (2%)
 Frame = +1

Query  70   MAKDVEG--ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVEG  A E    +DY DPPPA L+D EEL +WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEGGVAGEGFPARDYTDPPPAALVDAEELTRWSFYRAVIAEFIATLLFLYITVLTV  60

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTD    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL L R
Sbjct  61   IGYKSQTDTKAGG-DDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLGR  119

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KV+LVRA++YMVAQCLGAICG GLVKAFQ +YY RYGGGAN L DGYSKGTGL AEIIGT
Sbjct  120  KVTLVRALLYMVAQCLGAICGVGLVKAFQSSYYDRYGGGANSLADGYSKGTGLAAEIIGT  179

Query  604  FVLV  615
            FVLV
Sbjct  180  FVLV  183



>gb|KFK34721.1| hypothetical protein AALP_AA5G183600 [Arabis alpina]
Length=286

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M K+V G     + KDY DPPP P+ D  ELGKWSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGENRSFSGKDYHDPPPEPIFDATELGKWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLN-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            +L+RAVMYMVAQCLGAICG  LVKAFQ +YY RYGGGANGL  GY+ GTG+ AEIIGTFV
Sbjct  120  TLLRAVMYMVAQCLGAICGVALVKAFQSSYYTRYGGGANGLAHGYTIGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 167/182 (92%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KD+E   E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTD N  G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDVNKNG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGANGL +GYSKGTGLGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANGLANGYSKGTGLGAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|EYU34445.1| hypothetical protein MIMGU_mgv1a011350mg [Erythranthe guttata]
Length=284

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 161/185 (87%), Gaps = 9/185 (5%)
 Frame = +1

Query  70   MAKDVEG---ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKD+EG   A EY A KDY DPPPAPLID EEL KWS YRA+IAEF ATLLFLY+TVLT
Sbjct  1    MAKDIEGGAAAHEYGA-KDYHDPPPAPLIDSEELTKWSLYRAVIAEFTATLLFLYITVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            VIGYKSQ+       D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKSQS-----AADGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  114

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRAV+Y++AQCLGAICGCGLVKAFQK+YYV +GGGAN L  GYSKGTGL AEIIG
Sbjct  115  RKVSLVRAVLYIIAQCLGAICGCGLVKAFQKSYYVEHGGGANELALGYSKGTGLAAEIIG  174

Query  601  TFVLV  615
            TFVLV
Sbjct  175  TFVLV  179



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEG   + + +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGPEGFQS-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGY+ GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYNTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_009103935.1| PREDICTED: probable aquaporin PIP2-5 [Brassica rapa]
Length=286

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDV G     + KDYQDPPP PL D  ELG+WSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKDVAGEKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVG+LGIAWAFGG+IFILVYCT GISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPALN-PDQCAGVGVLGIAWAFGGLIFILVYCTVGISGGHINPAVTFGLFLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            +LVRAVMYMVAQCLGAICG  LVK+FQ +YY RYGGGANGL  GYS GTG+ AEIIGTFV
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVKSFQSSYYTRYGGGANGLTHGYSIGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 159/185 (86%), Gaps = 5/185 (3%)
 Frame = +1

Query  70   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            +IGYK QTD  V GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDTTVGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN + DGY+ GT LGAEIIG
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIG  178

Query  601  TFVLV  615
            TFVLV
Sbjct  179  TFVLV  183



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 159/185 (86%), Gaps = 5/185 (3%)
 Frame = +1

Query  70   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            +IGYK QTD  V GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDTTVGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN + DGY+ GT LGAEIIG
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIG  178

Query  601  TFVLV  615
            TFVLV
Sbjct  179  TFVLV  183



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 159/187 (85%), Gaps = 6/187 (3%)
 Frame = +1

Query  70   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            MAKD+E     A E++A KDY DPPPAPLID EEL KWS YRA IAEF+ATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYSDPPPAPLIDAEELTKWSLYRAAIAEFVATLLFLYITVA  59

Query  238  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  414
            TVIGYK QTD    G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  415  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  594
            LARKVSLVRAV+Y++AQCLGAICG GLVK FQ AY+VRYGGGAN L  GYSKGTGL AEI
Sbjct  120  LARKVSLVRAVLYIIAQCLGAICGVGLVKGFQSAYFVRYGGGANELSAGYSKGTGLAAEI  179

Query  595  IGTFVLV  615
            IGTFVLV
Sbjct  180  IGTFVLV  186



>ref|XP_009413714.1| PREDICTED: aquaporin PIP2-4-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 157/185 (85%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD E  G  EY   KDY DPPPAPLID EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDTEVAGRGEYGG-KDYTDPPPAPLIDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  244  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            IGYK Q+DPNV   D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  60   IGYKHQSDPNVNPADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA++YMVAQCLGAICG GLVK FQ+AY+VRYGGGAN L  GYSKGTGL AEIIG
Sbjct  120  RKVSLVRALLYMVAQCLGAICGVGLVKGFQEAYFVRYGGGANELSAGYSKGTGLAAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 158/185 (85%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA++YM+AQC GAICG GL K FQK++Y RYGGG N + DGY+KGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 161/186 (87%), Gaps = 6/186 (3%)
 Frame = +1

Query  70   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  237
            M KDVE     A EY+A KDY DPPPAPLID +EL  WSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVESHVEPAEEYSA-KDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLYVTVL  59

Query  238  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  417
            TVIGYKSQ DP   G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL
Sbjct  60   TVIGYKSQIDP-AHGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFL  118

Query  418  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  597
             RKVSL+RAV+YMVAQCLGAICG GLVKAFQK+YY +YGGGAN L  GY+KG GLGAEII
Sbjct  119  GRKVSLIRAVLYMVAQCLGAICGVGLVKAFQKSYYHKYGGGANELAPGYNKGVGLGAEII  178

Query  598  GTFVLV  615
            GTFVLV
Sbjct  179  GTFVLV  184



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 158/185 (85%), Gaps = 4/185 (2%)
 Frame = +1

Query  70   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSLVRA++YM+AQC GAICG GL K FQK++Y RYGGG N + DGY+KGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  601  TFVLV  615
            TFVLV
Sbjct  180  TFVLV  184



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 159/185 (86%), Gaps = 3/185 (2%)
 Frame = +1

Query  70   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+E A +    + KDY DPPPAP++D EEL KWS YRA+IAEF+ATLLFLY+TV TV
Sbjct  1    MAKDIEAAPQGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVATV  60

Query  244  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            IGYK Q+DP V  TD  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLA  120

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSL+RA++Y++AQCLGAICG GLVK FQ +YYVRYGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  601  TFVLV  615
            TFVLV
Sbjct  181  TFVLV  185



>emb|CDX73446.1| BnaC08g25570D [Brassica napus]
Length=286

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGEKGSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALN-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            +L+RAVMYMVAQCLGAICG  LVK+FQ +YY RYGGGANGL +GYS GTG+ AEIIGTFV
Sbjct  120  TLLRAVMYMVAQCLGAICGVALVKSFQSSYYTRYGGGANGLSNGYSVGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_009593453.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana tomentosiformis]
Length=283

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 156/182 (86%), Gaps = 4/182 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAK+V     +   KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNVNSEGSFTT-KDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ+      +D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQS---ATTSDPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RA+MYMVAQCLGAICG GLVKAFQ AYY RY GGAN L DGYS G GL AEIIGTFV
Sbjct  117  SLIRALMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSHGVGLSAEIIGTFV  176

Query  610  LV  615
            LV
Sbjct  177  LV  178



>ref|XP_009116159.1| PREDICTED: probable aquaporin PIP2-5 [Brassica rapa]
 emb|CDX78265.1| BnaA09g34600D [Brassica napus]
Length=286

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGEKGSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALN-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            +L+RAVMYMVAQCLGAICG  LVK+FQ +YY RYGGGANGL +GYS GTG+ AEIIGTFV
Sbjct  120  TLLRAVMYMVAQCLGAICGVALVKSFQSSYYTRYGGGANGLSNGYSVGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 159/185 (86%), Gaps = 5/185 (3%)
 Frame = +1

Query  70   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  240
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  241  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            +IGYK QTD  V GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDTTVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN + DGY+ GT LGAEIIG
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIG  178

Query  601  TFVLV  615
            TFVLV
Sbjct  179  TFVLV  183



>emb|CDY46759.1| BnaA03g17030D [Brassica napus]
Length=285

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKD EGA  +A  +DYQDPPPAP  D EEL +WS YRA+IAEF+ATLLFLYVTVLTV+G
Sbjct  1    MAKDAEGAEGFAT-RDYQDPPPAPFFDAEELTRWSLYRAVIAEFVATLLFLYVTVLTVMG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK  +D    G  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTAAGGV-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            +LVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  TLVRALLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 159/185 (86%), Gaps = 3/185 (2%)
 Frame = +1

Query  70   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+E A +    + KDY DPPPAP++D EEL KWS YRA+IAEF+ATLLFLY+TV TV
Sbjct  1    MAKDIEAAPQGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVATV  60

Query  244  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  420
            IGYK Q+DP V  TD  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLA  120

Query  421  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  600
            RKVSL+RA++Y++AQCLGAICG GLVK FQ +YYVRYGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  601  TFVLV  615
            TFVLV
Sbjct  181  TFVLV  185



>ref|XP_010505293.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
 ref|XP_010509372.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
Length=285

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEG   + + +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGPEGFQS-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGY+ GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 160/184 (87%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKDVE     EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSL+RA++Y+VAQC GAICG GL K FQKAYY R GGGAN + DGY+KGT LGAEIIGT
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRCGGGANSVADGYNKGTALGAEIIGT  178

Query  604  FVLV  615
            F LV
Sbjct  179  FALV  182



>ref|XP_009772697.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana sylvestris]
Length=283

 Score =   267 bits (683),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAK+V     +   KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNVGSEGSFTT-KDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQ+      TD C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQS---ATATDPCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAVMYMVAQCLGAICG GLVKAFQ AYY RY GGAN L D YS G GL AEIIGTFV
Sbjct  117  SLIRAVMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDDYSHGVGLSAEIIGTFV  176

Query  610  LV  615
            LV
Sbjct  177  LV  178



>ref|XP_010427203.1| PREDICTED: probable aquaporin PIP2-5 [Camelina sativa]
Length=286

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAVMYMVAQCLGAICG  LVK+FQ  YY RYGGGANGL +GYS GTG+ AEIIGTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVKSFQSGYYNRYGGGANGLSNGYSIGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>ref|XP_010507447.1| PREDICTED: probable aquaporin PIP2-5 [Camelina sativa]
Length=322

 Score =   268 bits (686),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SLVRAVMYMVAQCLGAICG  LVK+FQ  YY RYGGGANGL DGYS GTG+ AEIIGTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVKSFQSGYYNRYGGGANGLSDGYSIGTGVAAEIIGTFV  179

Query  610  LV  615
            LV
Sbjct  180  LV  181



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 158/183 (86%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 158/183 (86%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 160/182 (88%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            M KDVE ATE++A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDVEAATEFSA-KDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK Q+D +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKHQSDVDANG-DVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RA++YMVAQCLGAICG G VKAFQ AYY RYGGGAN +  G++KG GL AEIIGTFV
Sbjct  119  SLIRALVYMVAQCLGAICGVGFVKAFQSAYYDRYGGGANVMAAGHTKGVGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 157/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKD+E A   + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDSAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQTDP     D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPATNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSLVRAV+YMVAQ LGAI G  LVKAFQK+YY +YGGGAN L DGYS G GL AEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYXKYGGGANSLSDGYSTGVGLAAEIIGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>gb|ACV70053.1| aquaporin PIP2;2 [Quercus macrocarpa]
Length=225

 Score =   265 bits (677),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +1

Query  112  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  291
            KDY DPPPAPL DP EL K SFYRA+IAEF+ATLLFLYVTVLTVIGYKSQ DP +KG D 
Sbjct  1    KDYDDPPPAPLFDPVELTKGSFYRALIAEFVATLLFLYVTVLTVIGYKSQIDPALKG-DA  59

Query  292  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  471
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCL
Sbjct  60   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCL  119

Query  472  GAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            GAICG  LVKAFQ AYYV+YGGGAN L DGYS G GLGAEI+GTFVLV
Sbjct  120  GAICGVALVKAFQSAYYVKYGGGANSLSDGYSTGVGLGAEIVGTFVLV  167



>ref|XP_006481459.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 164/184 (89%), Gaps = 4/184 (2%)
 Frame = +1

Query  70   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  243
            MAKD+E  G  E+ A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGQGEFHA-KDYHDPPPAPLIDAEELTQWSFYRATIAEFIATLLFLYITVLTV  59

Query  244  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  423
            IGYKSQTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  424  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  603
            KVSLVRAVMYMVAQCLGAICGCGLVKAFQK+YY RYGGGAN L DGYS G GLGAEIIGT
Sbjct  119  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGT  178

Query  604  FVLV  615
            FVLV
Sbjct  179  FVLV  182



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 158/183 (86%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 161/188 (86%), Gaps = 7/188 (4%)
 Frame = +1

Query  70   MAK-DVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  234
            MAK D+E     A E++A KDY DPPPAPLID +EL KWS YRA+IAEFIATLLFLY+TV
Sbjct  1    MAKQDIEASGPEAGEFSA-KDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITV  59

Query  235  ltvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  411
             TVIGYK QTD    G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  60   ATVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  119

Query  412  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  591
            FLARKVSLVRA++Y++AQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AE
Sbjct  120  FLARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAE  179

Query  592  IIGTFVLV  615
            IIGTFVLV
Sbjct  180  IIGTFVLV  187



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 158/183 (86%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   267 bits (682),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 158/183 (86%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYNRYGGGANELATGYSKGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>gb|ACV70051.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=223

 Score =   265 bits (677),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/168 (86%), Positives = 154/168 (92%), Gaps = 4/168 (2%)
 Frame = +1

Query  115  DYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQT-DPNVKGTDE  291
            DY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+TVLTVIGYKSQT DP     D+
Sbjct  1    DYDDPPPAPLVDAEELTQWSFYRAIIAEFIATLLFLYITVLTVIGYKSQTADPT---ADQ  57

Query  292  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  471
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YM+AQCL
Sbjct  58   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMIAQCL  117

Query  472  GAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLV  615
            GAICGCGLVKAFQ+AYY R+GGGAN L  GYSKGTGL AEIIGTFVLV
Sbjct  118  GAICGCGLVKAFQRAYYSRFGGGANELALGYSKGTGLAAEIIGTFVLV  165



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   267 bits (682),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 158/183 (86%), Gaps = 5/183 (3%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  607  VLV  615
            VLV
Sbjct  177  VLV  179



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score =   266 bits (681),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 161/183 (88%), Gaps = 6/183 (3%)
 Frame = +1

Query  70   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVEGA     A KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GYKSQ++      D+CGGVGILGIAWAFGGMIF+LVY TAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYYTAGISGGHINPAVTFGLFLARK  115

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RAV+Y++AQCLGAICG GLVKAFQK+YYV++GGGAN L  GY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKFGGGANELSAGYNKGTGLGAEIIGTF  175

Query  607  VLV  615
            VLV
Sbjct  176  VLV  178



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   267 bits (682),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 158/183 (86%), Gaps = 2/183 (1%)
 Frame = +1

Query  70   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  246
            MAKDVE A   + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  247  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  426
            GY  QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYSIQTDVKAGG-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  427  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  606
            VSL+RA+MYMVAQCLGAI G GLVKAFQ AY+ RYGGGAN L DGYS G GLGAEI+GTF
Sbjct  120  VSLIRAIMYMVAQCLGAIAGVGLVKAFQSAYFDRYGGGANFLHDGYSTGVGLGAEIVGTF  179

Query  607  VLV  615
            VLV
Sbjct  180  VLV  182



>ref|XP_002881493.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57752.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   267 bits (682),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 156/182 (86%), Gaps = 2/182 (1%)
 Frame = +1

Query  70   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  249
            MAKDVEG   +   +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGPEGFQT-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  250  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  429
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDKTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  430  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  609
            SL+RAV+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGY+ GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFV  178

Query  610  LV  615
            LV
Sbjct  179  LV  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090