BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN032P23

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790112.1|  PREDICTED: aldehyde dehydrogenase                  214   2e-63   Nicotiana sylvestris
ref|XP_009593287.1|  PREDICTED: aldehyde dehydrogenase                  209   6e-62   Nicotiana tomentosiformis
ref|XP_006363887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    202   6e-59   Solanum tuberosum [potatoes]
ref|XP_004242034.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    201   2e-58   
gb|KDO80590.1|  hypothetical protein CISIN_1g011107mg                   184   3e-54   Citrus sinensis [apfelsine]
gb|KDO80588.1|  hypothetical protein CISIN_1g011107mg                   185   4e-54   Citrus sinensis [apfelsine]
gb|AGC65583.1|  fatty aldehyde dehydrogenase                            189   6e-54   Simmondsia chinensis [goatnut]
gb|KDO80586.1|  hypothetical protein CISIN_1g011107mg                   186   2e-53   Citrus sinensis [apfelsine]
gb|KDO80587.1|  hypothetical protein CISIN_1g011107mg                   186   2e-53   Citrus sinensis [apfelsine]
gb|KDO80584.1|  hypothetical protein CISIN_1g011107mg                   186   7e-53   Citrus sinensis [apfelsine]
ref|XP_006472804.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    186   7e-53   Citrus sinensis [apfelsine]
ref|XP_006434229.1|  hypothetical protein CICLE_v10000949mg             186   7e-53   Citrus clementina [clementine]
ref|XP_006370382.1|  hypothetical protein POPTR_0001s421502g            176   7e-53   
gb|EYU31773.1|  hypothetical protein MIMGU_mgv1a018415mg                182   2e-52   Erythranthe guttata [common monkey flower]
gb|KHN21716.1|  Aldehyde dehydrogenase family 3 member H1               182   5e-52   Glycine soja [wild soybean]
ref|XP_002302229.2|  the aldehyde dehydrogenase cp-ADH from C.pla...    184   5e-52   
ref|XP_002520352.1|  Aldehyde dehydrogenase, putative                   184   6e-52   
ref|XP_011069490.1|  PREDICTED: aldehyde dehydrogenase-like             182   1e-51   Sesamum indicum [beniseed]
ref|XP_003526638.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    183   1e-51   
ref|XP_008781593.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    183   1e-51   Phoenix dactylifera
ref|XP_011003449.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    182   2e-51   Populus euphratica
ref|XP_006847205.1|  hypothetical protein AMTR_s00017p00253390          181   2e-51   
ref|XP_010999403.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    182   2e-51   Populus euphratica
gb|KJB59283.1|  hypothetical protein B456_009G247000                    177   3e-51   Gossypium raimondii
gb|AFK46379.1|  unknown                                                 176   3e-51   Medicago truncatula
gb|EYU22982.1|  hypothetical protein MIMGU_mgv1a005625mg                181   4e-51   Erythranthe guttata [common monkey flower]
ref|XP_004498346.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    181   4e-51   Cicer arietinum [garbanzo]
ref|XP_007137428.1|  hypothetical protein PHAVU_009G126400g             181   4e-51   Phaseolus vulgaris [French bean]
ref|XP_002306641.1|  the aldehyde dehydrogenase cp-ADH from C.pla...    181   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_008227590.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    182   6e-51   Prunus mume [ume]
gb|KEH40518.1|  NAD-dependent aldehyde dehydrogenase family protein     181   6e-51   Medicago truncatula
ref|XP_010243505.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    182   6e-51   
ref|XP_004498347.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    182   6e-51   
gb|KGN54555.1|  hypothetical protein Csa_4G361890                       179   7e-51   Cucumis sativus [cucumbers]
ref|XP_010243504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    182   8e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010437648.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    171   8e-51   Camelina sativa [gold-of-pleasure]
gb|KEH40517.1|  NAD-dependent aldehyde dehydrogenase family protein     180   1e-50   Medicago truncatula
ref|XP_010930724.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    181   1e-50   Elaeis guineensis
ref|XP_007213817.1|  hypothetical protein PRUPE_ppa005609mg             179   1e-50   
gb|KHN47009.1|  Aldehyde dehydrogenase family 3 member H1               180   1e-50   Glycine soja [wild soybean]
gb|EYU23873.1|  hypothetical protein MIMGU_mgv1a005640mg                178   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_003523436.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    180   2e-50   
gb|KJB59281.1|  hypothetical protein B456_009G247000                    178   2e-50   Gossypium raimondii
ref|XP_003577758.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    179   2e-50   Brachypodium distachyon [annual false brome]
gb|ACJ85852.1|  unknown                                                 179   2e-50   Medicago truncatula
ref|XP_002307060.1|  hypothetical protein POPTR_0005s07090g             179   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_004142628.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    179   3e-50   Cucumis sativus [cucumbers]
emb|CAN73659.1|  hypothetical protein VITISV_044129                     180   4e-50   Vitis vinifera
gb|EYU23872.1|  hypothetical protein MIMGU_mgv1a005640mg                179   4e-50   Erythranthe guttata [common monkey flower]
ref|XP_009414877.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    179   4e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI21614.3|  unnamed protein product                                180   4e-50   Vitis vinifera
ref|XP_002273730.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    180   4e-50   Vitis vinifera
ref|XP_010025727.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    180   4e-50   Eucalyptus grandis [rose gum]
ref|XP_008444179.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    179   5e-50   Cucumis melo [Oriental melon]
gb|KHG28299.1|  Aldehyde dehydrogenase family 3 member H1               179   6e-50   Gossypium arboreum [tree cotton]
ref|XP_004142629.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    178   7e-50   
ref|XP_010025726.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    179   7e-50   Eucalyptus grandis [rose gum]
gb|KJB59280.1|  hypothetical protein B456_009G247000                    178   7e-50   Gossypium raimondii
ref|XP_011002476.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    181   8e-50   Populus euphratica
ref|XP_004161166.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    178   8e-50   
ref|XP_010268979.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    178   9e-50   Nelumbo nucifera [Indian lotus]
gb|KGN54554.1|  hypothetical protein Csa_4G361880                       178   9e-50   Cucumis sativus [cucumbers]
ref|XP_011031097.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    179   1e-49   Populus euphratica
ref|XP_010530214.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    177   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_010444975.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    172   1e-49   
emb|CAC84903.1|  aldehyde dehydrogenase                                 178   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KCW70625.1|  hypothetical protein EUGRSUZ_F03800                     177   2e-49   Eucalyptus grandis [rose gum]
ref|XP_010063405.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    177   2e-49   Eucalyptus grandis [rose gum]
ref|XP_003602042.1|  Aldehyde dehydrogenase family 3 member H1          177   2e-49   
ref|XP_009383529.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    177   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB36701.1|  putative aldehyde dehydrogenase                        177   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AES72293.2|  NAD-dependent aldehyde dehydrogenase family protein     177   3e-49   Medicago truncatula
ref|NP_567962.1|  aldehyde dehydrogenase 3I1                            177   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KCW70623.1|  hypothetical protein EUGRSUZ_F03800                     177   3e-49   Eucalyptus grandis [rose gum]
ref|XP_006662790.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    174   3e-49   
ref|NP_001065921.1|  Os11g0186200                                       176   5e-49   
gb|AAX96338.1|  aldehyde dehydrogenase, putative                        176   6e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010437649.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    171   6e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008219617.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    174   6e-49   
ref|XP_004290887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    176   6e-49   Fragaria vesca subsp. vesca
ref|XP_010674357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    176   7e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674356.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    176   7e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG30796.1|  Aldehyde dehydrogenase family 3 member H1               176   7e-49   Gossypium arboreum [tree cotton]
ref|XP_004290886.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    175   8e-49   Fragaria vesca subsp. vesca
dbj|BAK01937.1|  predicted protein                                      175   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007222253.1|  hypothetical protein PRUPE_ppa004751mg             175   1e-48   Prunus persica
ref|XP_002449124.1|  hypothetical protein SORBIDRAFT_05g005470          175   1e-48   
gb|AFK40162.1|  unknown                                                 166   1e-48   Lotus japonicus
ref|XP_006662789.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    175   1e-48   Oryza brachyantha
ref|XP_007161479.1|  hypothetical protein PHAVU_001G072600g             175   1e-48   Phaseolus vulgaris [French bean]
ref|XP_011074837.1|  PREDICTED: aldehyde dehydrogenase                  174   1e-48   Sesamum indicum [beniseed]
ref|XP_008219616.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    174   2e-48   Prunus mume [ume]
ref|XP_010095408.1|  Aldehyde dehydrogenase family 3 member H1          174   2e-48   
ref|XP_008387507.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    175   3e-48   
ref|XP_008367720.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    175   3e-48   
ref|XP_010674968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    174   4e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004515933.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   4e-48   
ref|XP_006575169.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    174   4e-48   Glycine max [soybeans]
gb|EMS62407.1|  Aldehyde dehydrogenase family 3 member H1               173   4e-48   Triticum urartu
ref|XP_009379029.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    173   4e-48   Pyrus x bretschneideri [bai li]
ref|XP_009379028.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    173   4e-48   Pyrus x bretschneideri [bai li]
gb|KDP32847.1|  hypothetical protein JCGZ_12139                         173   4e-48   Jatropha curcas
ref|XP_002869163.1|  ALDH3I1                                            174   5e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_004515930.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   8e-48   
gb|EMT33845.1|  Aldehyde dehydrogenase family 3 member H1               173   8e-48   
gb|KJB75337.1|  hypothetical protein B456_012G037500                    171   1e-47   Gossypium raimondii
ref|XP_008365201.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    172   1e-47   Malus domestica [apple tree]
ref|XP_008378442.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    172   1e-47   
ref|XP_010432443.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    173   1e-47   Camelina sativa [gold-of-pleasure]
gb|KHN20611.1|  Aldehyde dehydrogenase family 3 member H1               174   1e-47   Glycine soja [wild soybean]
gb|KHG17901.1|  Aldehyde dehydrogenase family 3 member I1, chloro...    169   2e-47   Gossypium arboreum [tree cotton]
ref|XP_007019116.1|  Aldehyde dehydrogenase 3H1 isoform 1               172   2e-47   
gb|KJB75341.1|  hypothetical protein B456_012G037500                    172   2e-47   Gossypium raimondii
ref|XP_006412252.1|  hypothetical protein EUTSA_v10024844mg             172   2e-47   Eutrema salsugineum [saltwater cress]
ref|XP_010437650.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    172   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_007019117.1|  Aldehyde dehydrogenase 3H1 isoform 2               172   2e-47   
ref|XP_008338656.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    171   3e-47   
ref|XP_006304446.1|  hypothetical protein CARUB_v10011079mg             171   3e-47   Capsella rubella
ref|XP_009355863.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    172   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_011027504.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    171   4e-47   Populus euphratica
ref|XP_011468213.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    172   4e-47   Fragaria vesca subsp. vesca
ref|NP_001168661.1|  hypothetical protein                               171   4e-47   Zea mays [maize]
gb|KDO52216.1|  hypothetical protein CISIN_1g009109mg                   171   5e-47   Citrus sinensis [apfelsine]
sp|Q8VXQ2.1|ALDH_CRAPL  RecName: Full=Aldehyde dehydrogenase; Alt...    170   5e-47   Craterostigma plantagineum
ref|XP_006596209.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   6e-47   Glycine max [soybeans]
emb|CDX69039.1|  BnaC01g04140D                                          171   6e-47   
gb|KJB75340.1|  hypothetical protein B456_012G037500                    171   6e-47   Gossypium raimondii
ref|XP_003544699.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    170   7e-47   Glycine max [soybeans]
ref|XP_009420563.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    170   8e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006432086.1|  hypothetical protein CICLE_v10000776mg             171   8e-47   Citrus clementina [clementine]
ref|XP_002888606.1|  ALDH3H1                                            170   8e-47   
gb|KDO52215.1|  hypothetical protein CISIN_1g009109mg                   171   8e-47   Citrus sinensis [apfelsine]
gb|KJB75338.1|  hypothetical protein B456_012G037500                    171   9e-47   Gossypium raimondii
ref|XP_009145048.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   1e-46   Brassica rapa
ref|NP_001077676.1|  aldehyde dehydrogenase 3H1                         168   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003544698.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   1e-46   Glycine max [soybeans]
ref|XP_010447116.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    170   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007159875.1|  hypothetical protein PHAVU_002G275200g             170   2e-46   Phaseolus vulgaris [French bean]
ref|XP_004514084.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    160   2e-46   
gb|AAM61211.1|  aldehyde dehydrogenase, putative                        169   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30059.1|  hypothetical protein AALP_AA7G211500                    169   3e-46   Arabis alpina [alpine rockcress]
gb|AET04825.2|  NAD-dependent aldehyde dehydrogenase family protein     169   3e-46   Medicago truncatula
ref|NP_175081.1|  aldehyde dehydrogenase 3H1                            168   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444182.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    168   3e-46   Cucumis melo [Oriental melon]
ref|XP_008444183.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    168   3e-46   Cucumis melo [Oriental melon]
gb|AFW65463.1|  hypothetical protein ZEAMMB73_893012                    168   3e-46   
ref|XP_004503900.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   4e-46   Cicer arietinum [garbanzo]
emb|CDY36018.1|  BnaA08g04430D                                          168   4e-46   Brassica napus [oilseed rape]
ref|XP_009107480.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    168   4e-46   Brassica rapa
ref|XP_004503899.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   4e-46   Cicer arietinum [garbanzo]
ref|XP_003532071.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   5e-46   
emb|CDY36336.1|  BnaC08g05150D                                          168   5e-46   Brassica napus [oilseed rape]
emb|CDX75414.1|  BnaA01g02880D                                          169   5e-46   
ref|NP_001288985.1|  aldehyde dehydrogenase family 3 member I1, c...    169   5e-46   Brassica rapa
ref|XP_009115077.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   5e-46   
gb|AID60136.1|  aldehyde dehydrogenase 3                                169   5e-46   Brassica napus [oilseed rape]
ref|XP_009115014.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    169   5e-46   
gb|ACF85700.1|  unknown                                                 167   5e-46   Zea mays [maize]
gb|ACG29168.1|  aldehyde dehydrogenase, dimeric NADP-preferring         167   5e-46   Zea mays [maize]
gb|KHG30273.1|  Aldehyde dehydrogenase family 3 member H1               167   7e-46   Gossypium arboreum [tree cotton]
gb|KJB29203.1|  hypothetical protein B456_005G089100                    167   7e-46   Gossypium raimondii
gb|KJB29202.1|  hypothetical protein B456_005G089100                    167   7e-46   Gossypium raimondii
ref|XP_010461437.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   7e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010479042.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   9e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006283479.1|  hypothetical protein CARUB_v10004527mg             168   9e-46   Capsella rubella
ref|XP_010500136.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_004502483.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   1e-45   
ref|XP_004502482.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    167   1e-45   Cicer arietinum [garbanzo]
gb|ABR16899.1|  unknown                                                 168   1e-45   Picea sitchensis
ref|XP_004515931.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    161   2e-45   
ref|XP_006393739.1|  hypothetical protein EUTSA_v10011438mg             166   2e-45   Eutrema salsugineum [saltwater cress]
ref|XP_004515932.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    161   2e-45   
ref|XP_009350139.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    166   2e-45   
ref|XP_003630349.1|  Aldehyde dehydrogenase family 3 member H1          167   3e-45   
ref|NP_001148092.1|  aldehyde dehydrogenase, dimeric NADP-preferring    166   4e-45   
ref|XP_002893982.1|  ALDH3H1                                            165   4e-45   
ref|XP_007048535.1|  Aldehyde dehydrogenase 3I1 isoform 1               166   5e-45   
emb|CAE51203.1|  putative aldehyde dehydrogenase                        165   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007048537.1|  Aldehyde dehydrogenase 3I1 isoform 3               165   5e-45   
ref|XP_007048536.1|  Aldehyde dehydrogenase 3I1 isoform 2               166   5e-45   
ref|XP_010664200.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    165   6e-45   Vitis vinifera
ref|XP_010664198.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    165   6e-45   Vitis vinifera
emb|CBI19000.3|  unnamed protein product                                165   1e-44   Vitis vinifera
ref|XP_004502485.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    163   3e-44   Cicer arietinum [garbanzo]
gb|KFK24209.1|  hypothetical protein AALP_AAs42301U000200               162   4e-44   Arabis alpina [alpine rockcress]
gb|EAZ19830.1|  hypothetical protein OsJ_35414                          160   2e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82454.1|  hypothetical protein OsI_37671                          160   2e-43   Oryza sativa Indica Group [Indian rice]
gb|ABA96616.1|  aldehyde dehydrogenase family protein, expressed        160   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663868.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    160   3e-43   
gb|EPS67421.1|  aldehyde dehydrogenase                                  155   4e-43   Genlisea aurea
gb|ABR25386.1|  aldehyde dehydrogenase dimeric nadp preferring          150   6e-43   Oryza sativa Indica Group [Indian rice]
gb|KJB75339.1|  hypothetical protein B456_012G037500                    160   9e-43   Gossypium raimondii
ref|XP_010539000.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    158   2e-42   Tarenaya hassleriana [spider flower]
ref|XP_009404859.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    158   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB64495.1|  hypothetical protein B456_010G051500                    157   3e-42   Gossypium raimondii
gb|KJB64493.1|  hypothetical protein B456_010G051500                    157   4e-42   Gossypium raimondii
ref|XP_001780129.1|  variable substrate                                 156   2e-41   
gb|ABK24239.1|  unknown                                                 154   5e-41   Picea sitchensis
ref|XP_006370381.1|  hypothetical protein POPTR_0001s421502g            143   2e-40   
gb|EMT24757.1|  Aldehyde dehydrogenase family 3 member H1               150   2e-40   
ref|XP_010238657.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    152   3e-40   Brachypodium distachyon [annual false brome]
gb|EMS67813.1|  Aldehyde dehydrogenase family 3 member H1               149   4e-40   Triticum urartu
ref|XP_010547359.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    150   9e-40   Tarenaya hassleriana [spider flower]
ref|XP_002978104.1|  hypothetical protein SELMODRAFT_271300             150   1e-39   
ref|XP_002966639.1|  hypothetical protein SELMODRAFT_227647             150   1e-39   
ref|XP_010547357.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    151   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_002978037.1|  hypothetical protein SELMODRAFT_268146             150   1e-39   
ref|XP_002966702.1|  hypothetical protein SELMODRAFT_168397             150   2e-39   
ref|XP_002441918.1|  hypothetical protein SORBIDRAFT_08g004840          149   3e-39   Sorghum bicolor [broomcorn]
gb|AFW56225.1|  hypothetical protein ZEAMMB73_146423                    148   5e-39   
gb|ACL53721.1|  unknown                                                 148   1e-38   Zea mays [maize]
ref|NP_001152171.1|  aldehyde dehydrogenase, dimeric NADP-preferring    148   1e-38   Zea mays [maize]
emb|CDY66167.1|  BnaCnng49760D                                          138   1e-37   Brassica napus [oilseed rape]
ref|XP_001757163.1|  variable substrate                                 142   1e-36   
ref|XP_001764841.1|  variable substrate                                 140   5e-36   
ref|XP_003539464.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    139   2e-35   
ref|XP_004173349.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    131   3e-35   
gb|KHN21904.1|  Aldehyde dehydrogenase family 3 member F1               137   4e-35   Glycine soja [wild soybean]
ref|XP_003539064.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    138   5e-35   Glycine max [soybeans]
gb|KHN25245.1|  Aldehyde dehydrogenase family 3 member F1               136   9e-35   Glycine soja [wild soybean]
ref|XP_004486968.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    137   1e-34   Cicer arietinum [garbanzo]
ref|XP_007132014.1|  hypothetical protein PHAVU_011G059400g             135   4e-34   Phaseolus vulgaris [French bean]
gb|KCW51186.1|  hypothetical protein EUGRSUZ_J00772                     135   6e-34   Eucalyptus grandis [rose gum]
ref|XP_010034106.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    135   6e-34   
ref|XP_004977224.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    134   9e-34   Setaria italica
ref|XP_008449722.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    134   1e-33   Cucumis melo [Oriental melon]
ref|XP_004507095.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    134   1e-33   Cicer arietinum [garbanzo]
ref|WP_012163534.1|  aldehyde dehydrogenase                             133   3e-33   Acaryochloris marina
ref|XP_010673629.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    132   3e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK41010.1|  unknown                                                 130   4e-33   Lotus japonicus
gb|KGN54173.1|  hypothetical protein Csa_4G291370                       132   7e-33   Cucumis sativus [cucumbers]
ref|XP_010031796.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    132   7e-33   Eucalyptus grandis [rose gum]
ref|XP_010034275.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    131   8e-33   
gb|KCW51189.1|  hypothetical protein EUGRSUZ_J00776                     131   8e-33   Eucalyptus grandis [rose gum]
ref|XP_001655924.1|  AAEL012161-PA                                      126   1e-32   
ref|XP_004142118.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    131   1e-32   
ref|WP_010474036.1|  aldehyde dehydrogenase                             131   1e-32   Acaryochloris sp. CCMEE 5410
ref|XP_007150367.1|  hypothetical protein PHAVU_005G147600g             130   2e-32   Phaseolus vulgaris [French bean]
ref|WP_015160249.1|  NAD-dependent aldehyde dehydrogenase               130   2e-32   Chamaesiphon minutus
ref|XP_003569983.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    130   3e-32   Brachypodium distachyon [annual false brome]
gb|EAZ31491.1|  hypothetical protein OsJ_15627                          129   3e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004228361.2|  PREDICTED: aldehyde dehydrogenase family 3 m...    130   3e-32   
gb|EFA72146.1|  hypothetical protein CRD_02669                          123   4e-32   Raphidiopsis brookii D9
ref|XP_010317521.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    129   5e-32   
ref|XP_003597427.1|  Aldehyde dehydrogenase family 3 member F1          129   5e-32   
gb|KEH39462.1|  NAD-dependent aldehyde dehydrogenase family protein     129   6e-32   Medicago truncatula
ref|XP_009768441.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    129   6e-32   Nicotiana sylvestris
ref|XP_006345274.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    129   6e-32   
ref|XP_006652592.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    129   6e-32   Oryza brachyantha
ref|NP_001053442.1|  Os04g0540600                                       129   8e-32   
ref|XP_010444974.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    122   8e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010536078.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    129   8e-32   Tarenaya hassleriana [spider flower]
gb|EFV22889.1|  aldehyde dehydrogenase                                  123   1e-31   Anaerostipes caccae
gb|KFM72617.1|  Aldehyde dehydrogenase, dimeric NADP-preferring         128   1e-31   Stegodyphus mimosarum
ref|XP_010045018.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    128   1e-31   Eucalyptus grandis [rose gum]
ref|XP_010102335.1|  Aldehyde dehydrogenase family 3 member F1          128   2e-31   Morus notabilis
ref|WP_017306063.1|  hypothetical protein                               127   2e-31   Spirulina subsalsa
ref|XP_002298405.2|  hypothetical protein POPTR_0001s26630g             127   2e-31   Populus trichocarpa [western balsam poplar]
dbj|BAJ96457.1|  predicted protein                                      127   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001147083.1|  LOC100280692                                       127   2e-31   Zea mays [maize]
gb|KJE97385.1|  aldehyde dehydrogenase type III-PG                      127   3e-31   Capsaspora owczarzaki ATCC 30864
gb|AAR21278.1|  fatty aldehyde dehydrogenase 1                          127   3e-31   Zea mays [maize]
ref|XP_004343114.1|  aldehyde dehydrogenase type III-PG                 127   4e-31   Capsaspora owczarzaki ATCC 30864
ref|WP_010997816.1|  aldehyde dehydrogenase                             127   4e-31   Nostocaceae
gb|KHN73866.1|  Fatty aldehyde dehydrogenase                            127   4e-31   Toxocara canis
ref|XP_004976400.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    127   4e-31   Setaria italica
gb|KCW87154.1|  hypothetical protein EUGRSUZ_B03682                     126   4e-31   Eucalyptus grandis [rose gum]
ref|XP_010045016.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    126   6e-31   Eucalyptus grandis [rose gum]
ref|XP_010045013.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    126   6e-31   
ref|WP_015149862.1|  NAD-dependent aldehyde dehydrogenase               126   7e-31   Oscillatoria acuminata
gb|KCW87152.1|  hypothetical protein EUGRSUZ_B03680                     126   7e-31   Eucalyptus grandis [rose gum]
gb|ERL90558.1|  hypothetical protein D910_07906                         123   9e-31   Dendroctonus ponderosae
ref|WP_039727975.1|  MULTISPECIES: aldehyde dehydrogenase               125   1e-30   Lyngbya confervoides
ref|XP_011006204.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    125   1e-30   Populus euphratica
ref|WP_006519525.1|  NAD-dependent aldehyde dehydrogenase               125   1e-30   Leptolyngbya sp. PCC 7375
ref|XP_011006203.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    125   1e-30   Populus euphratica
ref|WP_011320326.1|  aldehyde dehydrogenase                             125   1e-30   Trichormus variabilis
ref|XP_003580245.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    125   1e-30   Brachypodium distachyon [annual false brome]
ref|XP_010555061.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    125   1e-30   Tarenaya hassleriana [spider flower]
ref|XP_002448250.1|  hypothetical protein SORBIDRAFT_06g023975          123   2e-30   
gb|ABK96187.1|  unknown                                                 119   2e-30   
ref|WP_023072260.1|  aldehyde dehydrogenase                             124   2e-30   
ref|WP_006527043.1|  NAD-dependent aldehyde dehydrogenase               124   2e-30   
gb|AGI96739.1|  aldehyde dehydrogenase 3-1 variant B                    124   2e-30   
gb|EFA71109.1|  Aldehyde dehydrogenase                                  124   2e-30   
ref|WP_040008058.1|  aldehyde dehydrogenase                             124   2e-30   
gb|EMT10079.1|  Aldehyde dehydrogenase family 3 member F1               123   3e-30   
gb|KJB55349.1|  hypothetical protein B456_009G072900                    124   3e-30   
gb|KJB55351.1|  hypothetical protein B456_009G072900                    124   3e-30   
ref|XP_007015039.1|  Aldehyde dehydrogenase family 3 member F1          126   3e-30   
gb|EMS57171.1|  Aldehyde dehydrogenase family 3 member F1               125   3e-30   
ref|XP_008939306.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    119   3e-30   
gb|KIE11140.1|  aldehyde dehydrogenase                                  123   3e-30   
dbj|BAJ86301.1|  predicted protein                                      124   3e-30   
ref|XP_008453718.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    124   3e-30   
ref|XP_002452841.1|  hypothetical protein SORBIDRAFT_04g033420          124   4e-30   
gb|AFW59012.1|  hypothetical protein ZEAMMB73_052021                    122   4e-30   
ref|XP_001843954.1|  conserved hypothetical protein                     124   5e-30   
ref|WP_033232195.1|  aldehyde dehydrogenase                             123   5e-30   
gb|KHG24071.1|  Aldehyde dehydrogenase family 3 member F1               124   6e-30   
ref|WP_044480861.1|  aldehyde dehydrogenase                             123   7e-30   
ref|XP_001688503.1|  AGAP005124-PA                                      123   7e-30   
ref|WP_017316439.1|  aldehyde dehydrogenase                             123   7e-30   
ref|WP_006566997.1|  aldehyde dehydrogenase                             123   8e-30   
ref|WP_022261032.1|  aldehyde dehydrogenase                             123   8e-30   
gb|EMT24433.1|  Aldehyde dehydrogenase family 3 member F1               123   9e-30   
ref|WP_006946046.1|  Aldehyde dehydrogenase                             123   9e-30   
ref|WP_015203433.1|  aldehyde dehydrogenase                             123   9e-30   
gb|ENN71300.1|  hypothetical protein YQE_12225                          123   9e-30   
ref|XP_001767194.1|  variable substrate                                 123   1e-29   
ref|XP_003547154.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    123   1e-29   
gb|KHN33348.1|  Aldehyde dehydrogenase family 3 member F1               122   1e-29   
ref|WP_017740423.1|  hypothetical protein                               122   1e-29   
ref|WP_026722884.1|  aldehyde dehydrogenase                             122   1e-29   
ref|XP_009857901.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    122   1e-29   
ref|WP_042131498.1|  aldehyde dehydrogenase                             122   1e-29   
ref|XP_004953284.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    122   1e-29   
gb|KJF22961.1|  Coniferyl aldehyde dehydrogenase                        122   1e-29   
ref|XP_005104004.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    122   2e-29   
gb|AFW59014.1|  hypothetical protein ZEAMMB73_052021                    122   2e-29   
ref|XP_003543533.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    122   2e-29   
ref|WP_015220115.1|  aldehyde dehydrogenase                             122   2e-29   
ref|WP_011777430.1|  MULTISPECIES: aldehyde dehydrogenase               122   2e-29   
ref|XP_002115478.1|  hypothetical protein TRIADDRAFT_59449              122   2e-29   
gb|KDO71077.1|  hypothetical protein CISIN_1g0386172mg                  121   2e-29   
gb|ACR38486.1|  unknown                                                 122   2e-29   
gb|EYU31156.1|  hypothetical protein MIMGU_mgv1a0038971mg               121   2e-29   
ref|NP_001047575.1|  Os02g0646500                                       122   2e-29   
gb|AAD35089.1|AF148877_1  putative aldehyde dehydrogenase OS-ALDH       122   2e-29   
ref|WP_018397546.1|  hypothetical protein                               121   2e-29   
gb|KDP22085.1|  hypothetical protein JCGZ_25916                         121   3e-29   
ref|XP_002124149.1|  PREDICTED: fatty aldehyde dehydrogenase-like       122   3e-29   
ref|WP_013191326.1|  aldehyde dehydrogenase                             121   3e-29   
ref|NP_001151141.1|  aldehyde dehydrogenase 3B1                         121   3e-29   
ref|WP_001071732.1|  aldehyde dehydrogenase                             121   3e-29   
ref|WP_015137927.1|  NAD-dependent aldehyde dehydrogenase               121   3e-29   
gb|ELU17311.1|  hypothetical protein CAPTEDRAFT_149199                  121   3e-29   
ref|WP_011891648.1|  aldehyde dehydrogenase                             121   3e-29   
ref|WP_009633558.1|  NAD-dependent aldehyde dehydrogenase               121   4e-29   
ref|WP_016878575.1|  aldehyde dehydrogenase                             121   4e-29   
ref|XP_009590099.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    121   4e-29   
ref|XP_001655925.1|  AAEL012162-PA                                      121   4e-29   
ref|XP_008485684.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    119   4e-29   
ref|XP_006425564.1|  hypothetical protein CICLE_v10025492mg             121   4e-29   
ref|WP_013470321.1|  aldehyde dehydrogenase                             121   4e-29   
ref|XP_006466887.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    121   4e-29   
gb|KHN30135.1|  Aldehyde dehydrogenase family 3 member F1               121   4e-29   
gb|ACB52028.1|  aldehyde dehydrogenase                                  120   5e-29   
gb|KIJ80446.1|  aldehyde dehydrogenase                                  120   5e-29   
ref|WP_034706724.1|  aldehyde dehydrogenase                             120   5e-29   
ref|WP_014828460.1|  aldehyde dehydrogenase                             120   5e-29   
ref|WP_009544631.1|  MULTISPECIES: aldehyde dehydrogenase               120   5e-29   
ref|WP_014813413.1|  aldehyde dehydrogenase                             120   5e-29   
ref|XP_003791290.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    121   6e-29   
ref|WP_016862719.1|  aldehyde dehydrogenase                             120   6e-29   
ref|XP_009781320.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    120   6e-29   
ref|WP_024448831.1|  aldehyde dehydrogenase                             120   6e-29   
ref|WP_021267505.1|  aldehyde dehydrogenase (NAD) family protein        120   6e-29   
ref|WP_015113746.1|  aldehyde dehydrogenase                             120   6e-29   
ref|WP_017292666.1|  hypothetical protein                               120   6e-29   
ref|XP_010338224.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    120   6e-29   
ref|WP_040863110.1|  aldehyde dehydrogenase                             120   6e-29   
ref|WP_011854189.1|  aldehyde dehydrogenase                             120   7e-29   
gb|EUA22571.1|  aldehyde dehydrogenase family protein                   114   8e-29   
ref|WP_017310244.1|  aldehyde dehydrogenase                             120   9e-29   
ref|XP_006340688.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    120   9e-29   
ref|WP_044449982.1|  aldehyde dehydrogenase                             120   9e-29   
ref|WP_016202485.1|  aldehyde dehydrogenase                             120   9e-29   
ref|WP_021277988.1|  aldehyde dehydrogenase (NAD) family protein        120   1e-28   
ref|WP_026376419.1|  aldehyde dehydrogenase                             120   1e-28   
ref|XP_009781319.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    120   1e-28   
ref|XP_004522591.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    120   1e-28   
ref|XP_011025893.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    120   1e-28   
ref|WP_006196116.1|  aldehyde dehydrogenase                             119   1e-28   
ref|WP_015181603.1|  NAD-dependent aldehyde dehydrogenase               119   1e-28   
ref|XP_007904393.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    120   1e-28   
ref|XP_004522588.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    120   1e-28   
ref|XP_001653928.1|  AAEL009664-PA                                      119   1e-28   
ref|WP_006456928.1|  aldehyde dehydrogenase                             119   1e-28   
ref|XP_010876174.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    119   1e-28   
gb|EPS59682.1|  aldehyde dehydrogenase                                  119   2e-28   
emb|CDP01945.1|  unnamed protein product                                119   2e-28   
ref|WP_015078057.1|  aldehyde dehydrogenase                             119   2e-28   
gb|KFM66996.1|  Aldehyde dehydrogenase family 3 member B1               119   2e-28   
ref|WP_006242686.1|  aldehyde dehydrogenase                             119   2e-28   
gb|ETN59470.1|  aldehyde dehydrogenase                                  120   2e-28   
ref|XP_006829153.1|  hypothetical protein AMTR_s00001p00269720          119   2e-28   
ref|XP_009070824.1|  PREDICTED: fatty aldehyde dehydrogenase-like       114   2e-28   
gb|AGI96742.1|  aldehyde dehydrogenase 3-2                              119   2e-28   
ref|WP_003930746.1|  aldehyde dehydrogenase                             119   2e-28   
ref|WP_027377443.1|  aldehyde dehydrogenase                             119   2e-28   
ref|WP_039202629.1|  aldehyde dehydrogenase                             119   2e-28   
ref|WP_043403838.1|  aldehyde dehydrogenase                             119   2e-28   
ref|WP_027404837.1|  aldehyde dehydrogenase                             119   2e-28   
ref|WP_024727595.1|  aldehyde dehydrogenase                             119   2e-28   
ref|XP_010271510.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    119   2e-28   
ref|XP_008803615.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    119   2e-28   
ref|WP_044487997.1|  aldehyde dehydrogenase                             119   2e-28   
ref|WP_039343996.1|  aldehyde dehydrogenase                             119   2e-28   
ref|XP_011167292.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    120   2e-28   
ref|WP_030133049.1|  MULTISPECIES: aldehyde dehydrogenase               119   2e-28   
ref|WP_007769303.1|  aldehyde dehydrogenase                             119   2e-28   
ref|XP_004522592.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    119   2e-28   
ref|XP_010919366.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    118   2e-28   
dbj|BAD25530.1|  putative aldehyde dehydrogenase                        119   3e-28   
ref|XP_004776638.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    116   3e-28   
ref|XP_010316396.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    119   3e-28   
ref|NP_001047578.1|  Os02g0647900                                       119   3e-28   
ref|WP_009326028.1|  aldehyde dehydrogenase                             119   3e-28   
ref|XP_006647605.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    119   3e-28   
ref|WP_030538001.1|  aldehyde dehydrogenase                             119   3e-28   
ref|WP_014210046.1|  aldehyde dehydrogenase                             119   3e-28   
ref|XP_008878747.1|  hypothetical protein H310_13140                    119   3e-28   
dbj|BAE46201.1|  aldehyde dehydrogenase                                 119   3e-28   
ref|WP_005623275.1|  aldehyde dehydrogenase                             118   3e-28   
ref|WP_007619784.1|  aldehyde dehydrogenase                             118   3e-28   
ref|WP_003924575.1|  aldehyde dehydrogenase                             118   3e-28   
ref|XP_002310836.1|  mRNA for putative aldehyde dehydrogenase fam...    118   3e-28   
ref|WP_041042503.1|  aldehyde dehydrogenase                             118   3e-28   
ref|XP_010872804.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    119   3e-28   
ref|WP_013827039.1|  aldehyde dehydrogenase                             118   3e-28   
ref|XP_010743828.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    119   4e-28   
ref|XP_006033158.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    118   4e-28   
ref|XP_010919365.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    118   4e-28   
ref|XP_003629375.1|  Aldehyde dehydrogenase family 3 member F1          118   4e-28   
gb|ETN75528.1|  aldehyde dehydrogenase family protein                   118   4e-28   
ref|WP_016866084.1|  aldehyde dehydrogenase                             118   4e-28   
ref|WP_019510568.1|  MULTISPECIES: aldehyde dehydrogenase               118   4e-28   
ref|XP_003569985.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    118   4e-28   
ref|WP_016871050.1|  aldehyde dehydrogenase                             118   4e-28   
ref|WP_012407600.1|  aldehyde dehydrogenase                             118   4e-28   
gb|KFD66296.1|  hypothetical protein M514_09475                         119   4e-28   
ref|WP_009457992.1|  aldehyde dehydrogenase                             118   4e-28   
ref|XP_008995007.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    118   4e-28   
ref|WP_036471997.1|  aldehyde dehydrogenase                             118   4e-28   
gb|ADD38780.1|  Fatty aldehyde dehydrogenase                            118   4e-28   
ref|XP_006033155.1|  PREDICTED: fatty aldehyde dehydrogenase isof...    118   4e-28   
gb|ACO12663.1|  Aldehyde dehydrogenase, dimeric NADP-preferring         118   4e-28   
ref|XP_011190642.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    118   4e-28   
ref|XP_010743827.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    118   4e-28   
gb|AFK48458.1|  unknown                                                 118   5e-28   
ref|WP_027321527.1|  aldehyde dehydrogenase                             118   5e-28   
ref|WP_015186936.1|  Aldehyde Dehydrogenase                             118   5e-28   
ref|XP_002285466.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    118   5e-28   
ref|XP_010142170.1|  PREDICTED: LOW QUALITY PROTEIN: fatty aldehy...    118   5e-28   
ref|WP_010909008.1|  aldehyde dehydrogenase                             118   5e-28   
ref|XP_011190640.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    118   5e-28   
ref|XP_001770374.1|  variable substrate                                 118   5e-28   
ref|XP_010303342.1|  PREDICTED: fatty aldehyde dehydrogenase-like       114   5e-28   
gb|AGI96741.1|  aldehyde dehydrogenase 3-1 varian D                     118   5e-28   
ref|XP_011190638.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    118   5e-28   
gb|KFO94567.1|  Fatty aldehyde dehydrogenase                            117   5e-28   
ref|WP_038470963.1|  aldehyde dehydrogenase                             117   6e-28   
ref|XP_009276469.1|  PREDICTED: fatty aldehyde dehydrogenase-like...    118   6e-28   
ref|XP_011190639.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    118   6e-28   
ref|XP_005056938.1|  PREDICTED: fatty aldehyde dehydrogenase-like       117   6e-28   
gb|KFM06810.1|  Fatty aldehyde dehydrogenase                            118   6e-28   
emb|CDW60383.1|  Aldedh domain containing protein                       118   6e-28   
ref|XP_011190641.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    118   6e-28   
gb|EEC73696.1|  hypothetical protein OsI_08280                          118   6e-28   
ref|WP_024453487.1|  aldehyde dehydrogenase                             117   7e-28   
ref|WP_039930602.1|  aldehyde dehydrogenase                             117   7e-28   
ref|WP_009203343.1|  aldehyde dehydrogenase family protein              117   7e-28   
ref|WP_022091489.1|  aldehyde dehydrogenase                             117   7e-28   
ref|WP_008391099.1|  aldehyde dehydrogenase                             117   7e-28   
ref|WP_035102624.1|  aldehyde dehydrogenase                             117   7e-28   
ref|WP_009787061.1|  aldehyde dehydrogenase                             117   7e-28   
ref|XP_007259669.1|  PREDICTED: fatty aldehyde dehydrogenase-like       116   7e-28   
ref|XP_009081631.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    114   7e-28   
ref|WP_036399473.1|  aldehyde dehydrogenase                             117   8e-28   
ref|XP_004648002.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    118   8e-28   
ref|WP_037044039.1|  aldehyde dehydrogenase                             117   8e-28   
ref|WP_005142534.1|  aldehyde dehydrogenase                             117   8e-28   
gb|EPD60703.1|  hypothetical protein HMPREF1215_00158                   117   8e-28   
gb|EFA08034.1|  hypothetical protein TcasGA2_TC005623                   118   8e-28   
ref|WP_017654159.1|  aldehyde dehydrogenase                             117   8e-28   
gb|EGG87214.1|  hypothetical protein HMPREF0987_00866                   117   8e-28   
ref|WP_012597585.1|  aldehyde dehydrogenase                             117   8e-28   
ref|WP_016951420.1|  aldehyde dehydrogenase                             117   8e-28   
ref|XP_007884663.1|  PREDICTED: aldehyde dehydrogenase family 3 m...    115   8e-28   
emb|CAA18131.1|  aldehyde dehydrogenase like protein                    117   9e-28   
emb|CDS02813.1|  hypothetical protein LRAMOSA00217                      117   9e-28   
ref|WP_041235482.1|  aldehyde dehydrogenase                             117   9e-28   
gb|AFZ51141.1|  NAD-dependent aldehyde dehydrogenase                    117   9e-28   
gb|KHF27604.1|  Aldehyde dehydrogenase                                  113   9e-28   
ref|XP_011167295.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    117   9e-28   
ref|WP_017983480.1|  hypothetical protein                               117   1e-27   
ref|XP_009307681.1|  putative aldehyde dehydrogenase family             117   1e-27   
ref|WP_011557518.1|  MULTISPECIES: aldehyde dehydrogenase               117   1e-27   
ref|WP_006011635.1|  aldehyde dehydrogenase                             117   1e-27   
emb|CAE48163.1|  putative aldehyde dehydrogenase                        117   1e-27   
ref|XP_002800374.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    117   1e-27   
ref|WP_023960866.1|  aldehyde dehydrogenase                             117   1e-27   
ref|WP_026733532.1|  aldehyde dehydrogenase                             117   1e-27   
ref|NP_195348.2|  aldehyde dehydrogenase 3F1                            117   1e-27   
ref|XP_004341966.1|  aldehyde dehydrogenase (NAD) family superfam...    117   1e-27   
ref|WP_034716576.1|  aldehyde dehydrogenase                             117   1e-27   
ref|WP_015221757.1|  aldehyde dehydrogenase                             117   1e-27   
ref|XP_011167296.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    117   1e-27   
ref|XP_011207295.1|  PREDICTED: aldehyde dehydrogenase, dimeric N...    118   1e-27   



>ref|XP_009790112.1| PREDICTED: aldehyde dehydrogenase [Nicotiana sylvestris]
Length=477

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTVNKVED I+ INAR+KPLAAYLFT NKKLE+EFV N+SAGGLLINDT LH+A  TLPF
Sbjct  350  LTVNKVEDSIEFINAREKPLAAYLFTGNKKLEEEFVRNISAGGLLINDTTLHLATSTLPF  409

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHG+FSFEAFSHKKAVL+RSFGGD+ ARYPPYTP+K R L+AL++GN++ 
Sbjct  410  GGVGESGMGSYHGRFSFEAFSHKKAVLRRSFGGDVPARYPPYTPEKVRFLKALLNGNILG  469

Query  363  IIRALLG  383
            +IRALLG
Sbjct  470  LIRALLG  476



>ref|XP_009593287.1| PREDICTED: aldehyde dehydrogenase [Nicotiana tomentosiformis]
Length=477

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTVNKVE+ I+ INAR+KPLAAYLFT +KKLE+EFV N+SAGGLLINDT LH+A  TLPF
Sbjct  350  LTVNKVEESIQFINAREKPLAAYLFTGDKKLEEEFVRNISAGGLLINDTTLHIATSTLPF  409

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHG+FSFEAFSHKKAVL+RSFGGD+ ARYPPYTP+K R L+AL++G+++ 
Sbjct  410  GGVGESGMGSYHGRFSFEAFSHKKAVLRRSFGGDVPARYPPYTPEKVRFLKALLNGDILG  469

Query  363  IIRALLG  383
            +IRALLG
Sbjct  470  LIRALLG  476



>ref|XP_006363887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Solanum 
tuberosum]
Length=474

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNKVED I+ INAR+KPLAAYLFTSNKKLE+EFV N+SAGGLLINDT L VA+ TLPF
Sbjct  347  ITVNKVEDSIQFINAREKPLAAYLFTSNKKLEEEFVMNISAGGLLINDTTLQVALSTLPF  406

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GS HGKFSF++FSHKKAVL+RSF GD+ ARYPPYT  KAR L+AL++G+++ 
Sbjct  407  GGVGESGMGSCHGKFSFDSFSHKKAVLRRSFAGDVPARYPPYTTGKARFLKALLNGDILG  466

Query  363  IIRALLG  383
            +IRAL+G
Sbjct  467  LIRALIG  473



>ref|XP_004242034.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Solanum 
lycopersicum]
Length=474

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNKVED I+ I AR+KPLAAYLFTSNKKLE+EFV N+SAGGLLINDT L VA+ TLPF
Sbjct  347  ITVNKVEDSIQFIKAREKPLAAYLFTSNKKLEEEFVMNISAGGLLINDTTLQVALSTLPF  406

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GS HGKFSF+ FSHKKAVL+RSF GD+ ARYPPYT  KAR L+AL++G++I 
Sbjct  407  GGVGESGMGSCHGKFSFDTFSHKKAVLRRSFAGDVPARYPPYTAGKARFLKALLNGDIIG  466

Query  363  IIRALLG  383
            +IRAL+G
Sbjct  467  LIRALIG  473



>gb|KDO80590.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=282

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF
Sbjct  152  LTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPF  211

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ 
Sbjct  212  GGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLG  271

Query  363  IIRALLG  383
            IIRALLG
Sbjct  272  IIRALLG  278



>gb|KDO80588.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
 gb|KDO80589.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=321

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF
Sbjct  191  LTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPF  250

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ 
Sbjct  251  GGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLG  310

Query  363  IIRALLG  383
            IIRALLG
Sbjct  311  IIRALLG  317



>gb|AGC65583.1| fatty aldehyde dehydrogenase [Simmondsia chinensis]
Length=492

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+++E+   +IN+R KPLAAYLFT+ KKL+ EFV+N+SAGGL+IND+ALH+AVHTLPF
Sbjct  355  ITVDRLEESFDLINSRTKPLAAYLFTNRKKLKHEFVSNVSAGGLVINDSALHLAVHTLPF  414

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG GSYHGKFSF+ FSHKKAVL RSF GD  ARYPPYT  K RLL+AL+SG+++ 
Sbjct  415  GGVAESGMGSYHGKFSFDVFSHKKAVLYRSFMGDAAARYPPYTQGKLRLLKALLSGSILG  474

Query  363  IIRALLG  383
            II+AL+G
Sbjct  475  IIKALMG  481



>gb|KDO80586.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=397

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF
Sbjct  267  LTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPF  326

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ 
Sbjct  327  GGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLG  386

Query  363  IIRALLG  383
            IIRALLG
Sbjct  387  IIRALLG  393



>gb|KDO80587.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=398

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF
Sbjct  268  LTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPF  327

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ 
Sbjct  328  GGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLG  387

Query  363  IIRALLG  383
            IIRALLG
Sbjct  388  IIRALLG  394



>gb|KDO80584.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=487

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF
Sbjct  357  LTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPF  416

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ 
Sbjct  417  GGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLG  476

Query  363  IIRALLG  383
            IIRALLG
Sbjct  477  IIRALLG  483



>ref|XP_006472804.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Citrus 
sinensis]
 gb|KDO80585.1| hypothetical protein CISIN_1g011107mg [Citrus sinensis]
Length=493

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF
Sbjct  363  LTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPF  422

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ 
Sbjct  423  GGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLG  482

Query  363  IIRALLG  383
            IIRALLG
Sbjct  483  IIRALLG  489



>ref|XP_006434229.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
 gb|ESR47469.1| hypothetical protein CICLE_v10000949mg [Citrus clementina]
Length=493

 Score =   186 bits (473),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   IIN+  KPLAAYLFT+NKKL+Q+FV  +SAGGL+INDTA+H+AVH+LPF
Sbjct  363  LTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPF  422

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G+YHGKFSF+ FSHKKAVL R F GD+  RYPPYT  K RLL+ L+SG+L+ 
Sbjct  423  GGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLG  482

Query  363  IIRALLG  383
            IIRALLG
Sbjct  483  IIRALLG  489



>ref|XP_006370382.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
 ref|XP_006370383.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
 gb|ERP66951.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
 gb|ERP66952.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
Length=126

 Score =   176 bits (446),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            V  V+D I +IN++ KPL AYLFT+N+KL+  FV ++S+GG++INDT LHV V +LPFGG
Sbjct  1    VENVKDSIDLINSKPKPLTAYLFTNNEKLKNNFVQSVSSGGMVINDTVLHVTVSSLPFGG  60

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  368
            VGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP+K +L+RA+M+G +  II
Sbjct  61   VGESGMGSYHGKFSFDAFSHKKAVLYRSFSGDASVRYPPYTPEKQKLIRAVMNGGIFDII  120

Query  369  RALLGL  386
             AL+G 
Sbjct  121  LALMGF  126



>gb|EYU31773.1| hypothetical protein MIMGU_mgv1a018415mg [Erythranthe guttata]
Length=386

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+ED I++I++++KPLAAYLF+++KKL++EF+T++SAGG++INDT LH+    LPF
Sbjct  259  ITVNKIEDSIRLISSKEKPLAAYLFSNDKKLKEEFITSVSAGGMVINDTNLHLVEPNLPF  318

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESGTGSYHG+FSF+AFSHKKAVL+R F GD+ ARYPPY   K   L++L SGNLI 
Sbjct  319  GGVGESGTGSYHGRFSFDAFSHKKAVLQRGFTGDIAARYPPYANWKIDFLKSLFSGNLIG  378

Query  363  IIRALLG  383
            ++RAL G
Sbjct  379  VLRALFG  385



>gb|KHN21716.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=411

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNKVE+ I +IN+  KPLAAY+FT+NKKL+++FV N+ AGGLL+NDT LH+ V TLPF
Sbjct  283  ITVNKVEESIDLINSGTKPLAAYIFTTNKKLKEQFVMNVPAGGLLVNDTVLHLVVDTLPF  342

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G  + 
Sbjct  343  GGVGESGMGAYHGKFSFDAFTHKKAVLYRSFAGDSSLRYPPYTDTKLRLMKALIGGRFLG  402

Query  363  IIRALLG  383
            IIRAL G
Sbjct  403  IIRALFG  409



>ref|XP_002302229.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE81502.2| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            L V+K+ED   +IN+  KPLAAYLFT+NKKL+++FV ++SAGG++IND A+H+A+HTLPF
Sbjct  360  LIVSKIEDSFDMINSGTKPLAAYLFTNNKKLKEQFVMSVSAGGVVINDIAMHLAIHTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESGTGSYHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++A M+ N   
Sbjct  420  GGVGESGTGSYHGKFSFDAFSHKKAVLYRSFMGDAALRYPPYTRGKLRLMKAFMTSNFWT  479

Query  363  IIRALLG  383
            I+RAL G
Sbjct  480  ILRALFG  486



>ref|XP_002520352.1| Aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF42138.1| Aldehyde dehydrogenase, putative [Ricinus communis]
Length=495

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + VNK+E+   +IN+R KPLAAYLFT+ KKL+Q+FVT +SAGGL++NDT +H+AVHTLPF
Sbjct  365  VMVNKIEESFDLINSRTKPLAAYLFTNKKKLKQQFVTCVSAGGLVVNDTTVHLAVHTLPF  424

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESGTG+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++AL+ G +  
Sbjct  425  GGVGESGTGAYHGKFSFDAFSHKKAVLYRSFTGDAAIRYPPYTKGKLRLMKALIGGGIWS  484

Query  363  IIRALLG  383
            II AL G
Sbjct  485  IISALFG  491



>ref|XP_011069490.1| PREDICTED: aldehyde dehydrogenase-like [Sesamum indicum]
Length=476

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+ED I +I A++KPLAAYLFT++KKL++EF+ ++SAGG+ IN+ ALH    TLPF
Sbjct  349  VTVNKIEDSITLIKAKEKPLAAYLFTNDKKLKEEFIRSVSAGGIAINEIALHALEPTLPF  408

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKK+VL+R F GD  ARYPPYTP K + L+A++SG++I 
Sbjct  409  GGVGESGMGSYHGKFSFDAFSHKKSVLQRGFSGDPAARYPPYTPGKLKFLQAMLSGSIIR  468

Query  363  IIRALLG  383
            I+RAL+G
Sbjct  469  ILRALIG  475



>ref|XP_003526638.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=491

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNKVE+ I +IN+  KPLAAY+FT+NKKL+++FV N+ AGGLL+NDT LH+ V TLPF
Sbjct  363  ITVNKVEESIDLINSGTKPLAAYIFTTNKKLKEQFVMNVPAGGLLVNDTVLHLVVDTLPF  422

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G  + 
Sbjct  423  GGVGESGMGAYHGKFSFDAFTHKKAVLYRSFAGDSSLRYPPYTDTKLRLMKALIGGRFLG  482

Query  363  IIRALLG  383
            IIRAL G
Sbjct  483  IIRALFG  489



>ref|XP_008781593.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Phoenix 
dactylifera]
Length=495

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+KVED   +IN++ KPLAAYLFT +KKLE++FV  +SAGG+LINDT LH+A   LPF
Sbjct  364  ITVDKVEDSFDVINSKSKPLAAYLFTKDKKLEEKFVKIVSAGGMLINDTVLHLANPYLPF  423

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSFEAFSHKKAVL R FGG+  ARYPPYTP+K +LLR L++G++I 
Sbjct  424  GGVGESGFGSYHGKFSFEAFSHKKAVLSRGFGGETSARYPPYTPQKQKLLRQLLNGSIIA  483

Query  363  IIRALLG  383
            +  AL+G
Sbjct  484  LFLALIG  490



>ref|XP_011003449.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   II +  KPLAAYLFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PF
Sbjct  360  LTVSKIEDSFDIIKSGTKPLAAYLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AF+HKKAV+ RSF GD   RYPPYT  K RL++AL++GNL  
Sbjct  420  GGVGESGMGSYHGKFSFDAFTHKKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNLWT  479

Query  363  IIRALLGL  386
            I+R LLG+
Sbjct  480  ILRTLLGM  487



>ref|XP_006847205.1| hypothetical protein AMTR_s00017p00253390 [Amborella trichopoda]
 gb|ERN08786.1| hypothetical protein AMTR_s00017p00253390 [Amborella trichopoda]
Length=416

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            ++V+K+++  ++IN+R KPLAAYLFTS+KKLE++FV ++SAGGLL+NDT LH+ + +LPF
Sbjct  286  ISVDKIDESFELINSRAKPLAAYLFTSDKKLEEKFVKSISAGGLLVNDTCLHLTISSLPF  345

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+ FSHKKAVL+RSFGGDL ARYPPYTP+K + L++L++ +++ 
Sbjct  346  GGVGDSGIGAYHGKFSFDIFSHKKAVLRRSFGGDLSARYPPYTPRKQQFLKSLLALDILG  405

Query  363  IIRALLG  383
            I+  L+G
Sbjct  406  ILLVLIG  412



>ref|XP_010999403.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=488

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   II +  KPLAAYLFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PF
Sbjct  360  LTVSKIEDSFDIIKSGTKPLAAYLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AF+HKKAV+ RSF GD   RYPPYT  K RL++AL++GNL  
Sbjct  420  GGVGESGMGSYHGKFSFDAFTHKKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNLWT  479

Query  363  IIRALLGL  386
            I+R LLG+
Sbjct  480  ILRTLLGM  487



>gb|KJB59283.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=283

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARD-KPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLP  179
            +TV+KVE    +I++   KPLAAYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LP
Sbjct  152  ITVDKVEQSFDLIHSSGGKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLP  211

Query  180  FGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLI  359
            FGGVGESG GSYHGKFSF+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++
Sbjct  212  FGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIV  271

Query  360  FIIRALLG  383
             IIRALLG
Sbjct  272  GIIRALLG  279



>gb|AFK46379.1| unknown [Medicago truncatula]
Length=280

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+++   +IN+  KPLAAY+FT+N KL+++FV  +SAGGL+I+DT +H+AVHTLPF
Sbjct  152  ITVDKLDESFDVINSAPKPLAAYIFTNNNKLKEQFVKTVSAGGLVIDDTTIHLAVHTLPF  211

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + 
Sbjct  212  GGVGESGVGAYHGKFSFDAFSHKKAVLYRSFFGDAFIRYPPYTSTKTRLMKALMGGGFLA  271

Query  363  IIRALLG  383
            IIRAL G
Sbjct  272  IIRALFG  278



>gb|EYU22982.1| hypothetical protein MIMGU_mgv1a005625mg [Erythranthe guttata]
Length=476

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED I II +++KPLAAYLF++N+KL+ +F++N+S+GG++INDT LH+A  +LPF
Sbjct  349  ITVDKIEDCIGIITSKEKPLAAYLFSNNEKLKNDFISNVSSGGMVINDTTLHLAEASLPF  408

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVLKR F GD+  RYPPYT  K   ++A++SGN++ 
Sbjct  409  GGVGESGMGSYHGKFSFDAFSHKKAVLKRGFNGDVSVRYPPYTNGKLNFVKAMLSGNILR  468

Query  363  IIRALLG  383
            IIRAL G
Sbjct  469  IIRALFG  475



>ref|XP_004498346.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+E+   +IN+  KPLAAY+FT+NK L+++FV N+SAGG++INDT +H+AVHTLPF
Sbjct  360  ITVDKLEESFDVINSGSKPLAAYIFTNNKNLKEKFVMNVSAGGVVINDTTMHLAVHTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ 
Sbjct  420  GGVGESGLGAYHGKFSFDAFSHKKAVLYRSFFGDAPIRYPPYTATKMRLLKALVGGGILN  479

Query  363  IIRALLGL  386
            I+RA+LG+
Sbjct  480  IVRAILGM  487



>ref|XP_007137428.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
 gb|ESW09422.1| hypothetical protein PHAVU_009G126400g [Phaseolus vulgaris]
Length=490

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+E+ + +IN+ +KPLAAY+FT+++K ++ FV N+SAGGLL+NDT LH+ V TLPF
Sbjct  362  ITVNKLEESLDVINSGEKPLAAYVFTTDEKFKELFVRNVSAGGLLVNDTTLHLLVDTLPF  421

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AF+HKKAVL RSF GD  ARYPPYT  K RL++AL++G ++ 
Sbjct  422  GGVGESGMGAYHGKFSFDAFTHKKAVLYRSFAGDSSARYPPYTDTKQRLMKALVAGTVLG  481

Query  363  IIRALLG  383
            IIRALLG
Sbjct  482  IIRALLG  488



>ref|XP_002306641.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
 gb|EEE93637.1| the aldehyde dehydrogenase cp-ADH from C.plantagineum family 
protein [Populus trichocarpa]
Length=488

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   II +  KPLAAYLFT+NKKL+++F+ ++SAGG++INDT LH+AVH++PF
Sbjct  360  LTVSKIEDSFDIIKSGTKPLAAYLFTNNKKLKEQFLMSVSAGGVVINDTTLHLAVHSVPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AF+HKKAV+ RSF GD   RYPPYT  K RL++AL++GN+  
Sbjct  420  GGVGESGMGSYHGKFSFDAFTHKKAVVYRSFVGDASVRYPPYTLGKLRLMKALITGNVWT  479

Query  363  IIRALLGL  386
            I+R LLG+
Sbjct  480  ILRTLLGM  487



>ref|XP_008227590.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=549

 Score =   182 bits (462),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 82/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED   +IN+R KPLA Y+FT+N++L++ FV N+S+GG+LINDT LHV++  LPF
Sbjct  420  VTVEKIEDSFDVINSRPKPLAVYVFTNNEQLKKGFVENISSGGMLINDTVLHVSISGLPF  479

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+ FSHKKAVL RSF GD   RYPPYTP+K RLL+A++SG++  
Sbjct  480  GGVGESGMGSYHGKFSFDGFSHKKAVLYRSFSGDSSLRYPPYTPEKQRLLKAVISGDIFS  539

Query  363  IIRALLG  383
            II AL+G
Sbjct  540  IILALIG  546



>gb|KEH40518.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+++   +IN+  KPLAAY+FT+N KL+++FV  +SAGGL+INDT +H+AVHTLPF
Sbjct  360  ITVDKLDESFDVINSAPKPLAAYIFTNNNKLKEQFVKTVSAGGLVINDTTIHLAVHTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + 
Sbjct  420  GGVGESGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLA  479

Query  363  IIRALLG  383
            IIRAL G
Sbjct  480  IIRALFG  486



>ref|XP_010243505.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Nelumbo nucifera]
Length=567

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+KVED   II +R KPLAAYLFTS+KKLE+EFV N+SAGG+LINDT +H+   +LPF
Sbjct  434  ITVDKVEDSFDIIKSRSKPLAAYLFTSSKKLEKEFVENISAGGMLINDTVVHLTNPSLPF  493

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RS  GD   RYPPYTP K R+LRA++ G++I 
Sbjct  494  GGVGESGIGSYHGKFSFDAFSHKKAVLYRSLYGDAPVRYPPYTPGKLRILRAILDGSIIG  553

Query  363  IIRALLG  383
             I AL+G
Sbjct  554  AILALIG  560



>ref|XP_004498347.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=526

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+E+   +IN+  KPLAAY+FT+NK L+++FV N+SAGG++INDT +H+AVHTLPF
Sbjct  398  ITVDKLEESFDVINSGSKPLAAYIFTNNKNLKEKFVMNVSAGGVVINDTTMHLAVHTLPF  457

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ 
Sbjct  458  GGVGESGLGAYHGKFSFDAFSHKKAVLYRSFFGDAPIRYPPYTATKMRLLKALVGGGILN  517

Query  363  IIRALLGL  386
            I+RA+LG+
Sbjct  518  IVRAILGM  525



>gb|KGN54555.1| hypothetical protein Csa_4G361890 [Cucumis sativus]
Length=395

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+KVED   I+N+  KPLAAYLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPF
Sbjct  267  LTVDKVEDSFDIVNSGTKPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPF  326

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ 
Sbjct  327  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILA  386

Query  363  IIRALLG  383
            +IRALLG
Sbjct  387  LIRALLG  393



>ref|XP_010243504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Nelumbo nucifera]
Length=568

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+KVED   II +R KPLAAYLFTS+KKLE+EFV N+SAGG+LINDT +H+   +LPF
Sbjct  435  ITVDKVEDSFDIIKSRSKPLAAYLFTSSKKLEKEFVENISAGGMLINDTVVHLTNPSLPF  494

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RS  GD   RYPPYTP K R+LRA++ G++I 
Sbjct  495  GGVGESGIGSYHGKFSFDAFSHKKAVLYRSLYGDAPVRYPPYTPGKLRILRAILDGSIIG  554

Query  363  IIRALLG  383
             I AL+G
Sbjct  555  AILALIG  561



>ref|XP_010437648.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=145

 Score =   171 bits (434),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLFT+NK+L+++FV ++SAGG+ INDT LHV V  LPF
Sbjct  13   VTVEKIEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPF  72

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+  
Sbjct  73   GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFA  132

Query  363  IIRALLGL  386
             I A  G 
Sbjct  133  AIWAFFGF  140



>gb|KEH40517.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=488

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+++   +IN+  KPLAAY+FT+N KL+++FV  +SAGGL+INDT +H+AVHTLPF
Sbjct  360  ITVDKLDESFDVINSAPKPLAAYIFTNNNKLKEQFVKTVSAGGLVINDTTIHLAVHTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + 
Sbjct  420  GGVGESGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLA  479

Query  363  IIRALLG  383
            IIRAL G
Sbjct  480  IIRALFG  486



>ref|XP_010930724.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Elaeis 
guineensis]
Length=495

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+KVED   +IN++ KPLAAYLFT +KKLE++FV  +SAGG+LIND ALH+A H LPF
Sbjct  364  ITVDKVEDSFDLINSKTKPLAAYLFTKDKKLEEKFVNTVSAGGMLINDIALHLANHYLPF  423

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL R F G+  ARYPPYTP+K +L+R L++G++I 
Sbjct  424  GGVGESGFGSYHGKFSFDAFSHKKAVLSRGFFGEARARYPPYTPRKQKLVRQLLNGSIIA  483

Query  363  IIRALLG  383
            +  ALLG
Sbjct  484  MFFALLG  490



>ref|XP_007213817.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
 gb|EMJ15016.1| hypothetical protein PRUPE_ppa005609mg [Prunus persica]
Length=451

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV  +ED   +IN+R KPLA Y+FT+N++L++ FV N+S+GG+LINDT LHV++  LPF
Sbjct  322  VTVETIEDSFDVINSRPKPLAVYVFTNNEQLKKGFVENISSGGMLINDTVLHVSITGLPF  381

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+ FSHKKAVL RSF GD   RYPPYTP+K RLL+A++SG++  
Sbjct  382  GGVGESGMGSYHGKFSFDGFSHKKAVLYRSFSGDSSLRYPPYTPEKQRLLKAVISGDIFS  441

Query  363  IIRALLG  383
            II AL+G
Sbjct  442  IILALIG  448



>gb|KHN47009.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=491

 Score =   180 bits (457),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+E+ I +IN+  KPLAAY+FT++ K +++FV N+SAGGLL+NDTALH+ V TLPF
Sbjct  363  ITVNKLEESIDVINSGAKPLAAYVFTTDNKFKEQFVKNVSAGGLLVNDTALHLVVDTLPF  422

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G ++ 
Sbjct  423  GGVGESGMGAYHGKFSFDAFTHKKAVLYRSFAGDSAIRYPPYTDTKLRLMKALVGGRILG  482

Query  363  IIRALLG  383
            IIRAL G
Sbjct  483  IIRALFG  489



>gb|EYU23873.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=394

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+ED    INA+ KPLAAYLFT++K L++EFV ++SAG + IN+TALH     LPF
Sbjct  267  VTVNKIEDSFGAINAKGKPLAAYLFTNDKTLKEEFVRSVSAGAIAINETALHFMEVGLPF  326

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL+R FGG++ ARYPPY P K +LL+AL+ GN+I 
Sbjct  327  GGVGESGMGSYHGKFSFDAFSHKKAVLRRGFGGEVSARYPPYAPWKLQLLKALVKGNIIE  386

Query  363  IIRALLG  383
            I+RALLG
Sbjct  387  ILRALLG  393



>ref|XP_003523436.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Glycine max]
 ref|XP_006578967.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Glycine max]
 ref|XP_006578968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X3 [Glycine max]
Length=488

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+E+ I +IN+  KPLAAY+FT++ K +++FV N+SAGGLL+NDTALH+ V TLPF
Sbjct  360  ITVNKLEESIDVINSGAKPLAAYVFTTDNKFKEQFVKNVSAGGLLVNDTALHLVVDTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AF+HKKAVL RSF GD   RYPPYT  K RL++AL+ G ++ 
Sbjct  420  GGVGESGMGAYHGKFSFDAFTHKKAVLYRSFAGDSAIRYPPYTDTKLRLMKALVGGRILG  479

Query  363  IIRALLG  383
            IIRAL G
Sbjct  480  IIRALFG  486



>gb|KJB59281.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
 gb|KJB59282.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=402

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARD-KPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLP  179
            +TV+KVE    +I++   KPLAAYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LP
Sbjct  271  ITVDKVEQSFDLIHSSGGKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLP  330

Query  180  FGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLI  359
            FGGVGESG GSYHGKFSF+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++
Sbjct  331  FGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIV  390

Query  360  FIIRALLG  383
             IIRALLG
Sbjct  391  GIIRALLG  398



>ref|XP_003577758.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=481

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+E+ I+ INA  KPLAAYLF+ NKKL+QEF+ N+S+GG+L+ND ALH+A   LPF
Sbjct  349  VTVDKIEESIEHINAGTKPLAAYLFSRNKKLQQEFIANVSSGGMLVNDVALHLANPHLPF  408

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SGTGSYHGKF+F+ FSHKKAVL R FGG+  ARYPPYTP+K R+LR L+ G+   
Sbjct  409  GGVGDSGTGSYHGKFTFDCFSHKKAVLVRGFGGEANARYPPYTPEKQRILRGLIKGSFFA  468

Query  363  IIRALLG  383
            +I ALLG
Sbjct  469  LILALLG  475



>gb|ACJ85852.1| unknown [Medicago truncatula]
Length=488

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+++   +IN+  KPLAAY+FT+N KL+++FV  +SAGGL+I+DT +H+AVHTLPF
Sbjct  360  ITVDKLDESFDVINSAPKPLAAYIFTNNNKLKEQFVKTVSAGGLVIDDTTIHLAVHTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++ALM G  + 
Sbjct  420  GGVGESGVGAYHGKFSFDAFSHKKAVLYRSFFGDASIRYPPYTSTKTRLMKALMGGGFLA  479

Query  363  IIRALLG  383
            IIRAL G
Sbjct  480  IIRALFG  486



>ref|XP_002307060.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
 gb|EEE94056.1| hypothetical protein POPTR_0005s07090g [Populus trichocarpa]
Length=488

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV  V+D I +IN++ +PL AYLFT+N+KL  +FV N+S GG++INDT LHV V +LPF
Sbjct  358  ITVENVKDSIDLINSKPEPLVAYLFTNNQKLRNDFVQNVSCGGMVINDTVLHVTVSSLPF  417

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP+  +L+RA+M+G +  
Sbjct  418  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFSGDSPVRYPPYTPENKKLMRAVMNGGIFD  477

Query  363  IIRALLG  383
            II AL+G
Sbjct  478  IILALMG  484



>ref|XP_004142628.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
 ref|XP_004161167.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+KVED   I+N+  KPLAAYLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPF
Sbjct  356  LTVDKVEDSFDIVNSGTKPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ 
Sbjct  416  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILA  475

Query  363  IIRALLG  383
            +IRALLG
Sbjct  476  LIRALLG  482



>emb|CAN73659.1| hypothetical protein VITISV_044129 [Vitis vinifera]
Length=541

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV  +E+   +IN++ KPLAAYLF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPF
Sbjct  411  LTVENLEESFDVINSKSKPLAAYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPF  470

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL R F G+  ARYPPYTP K +LL+ L SGN++ 
Sbjct  471  GGVGESGMGSYHGKFSFDAFSHKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVS  530

Query  363  IIRALLG  383
            I+ ALLG
Sbjct  531  ILLALLG  537



>gb|EYU23872.1| hypothetical protein MIMGU_mgv1a005640mg [Erythranthe guttata]
Length=476

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+ED    INA+ KPLAAYLFT++K L++EFV ++SAG + IN+TALH     LPF
Sbjct  349  VTVNKIEDSFGAINAKGKPLAAYLFTNDKTLKEEFVRSVSAGAIAINETALHFMEVGLPF  408

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL+R FGG++ ARYPPY P K +LL+AL+ GN+I 
Sbjct  409  GGVGESGMGSYHGKFSFDAFSHKKAVLRRGFGGEVSARYPPYAPWKLQLLKALVKGNIIE  468

Query  363  IIRALLG  383
            I+RALLG
Sbjct  469  ILRALLG  475



>ref|XP_009414877.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414878.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T ++VED I  IN++ KPLAAYLFT ++K+E +FV N+SAGG+L+ND ALH+A   LPF
Sbjct  363  VTFDEVEDCIDFINSKSKPLAAYLFTKDRKIEDQFVKNVSAGGILVNDVALHLANPHLPF  422

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL R FGG+  ARYPPYTP+K R+LR L++G++I 
Sbjct  423  GGVGESGIGAYHGKFSFDAFSHKKAVLSRGFGGEAPARYPPYTPQKQRILRGLINGSIIA  482

Query  363  IIRALLGL  386
            ++ A+LG 
Sbjct  483  LVLAILGF  490



>emb|CBI21614.3| unnamed protein product [Vitis vinifera]
Length=548

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV  +E+   +IN++ KPLAAYLF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPF
Sbjct  418  LTVENLEESFDVINSKSKPLAAYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPF  477

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL R F G+  ARYPPYTP K +LL+ L SGN++ 
Sbjct  478  GGVGESGMGSYHGKFSFDAFSHKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVS  537

Query  363  IIRALLG  383
            I+ ALLG
Sbjct  538  ILLALLG  544



>ref|XP_002273730.2| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Vitis 
vinifera]
Length=549

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV  +E+   +IN++ KPLAAYLF+ NK+L+++FV N+SAGG+LINDT LH+ V +LPF
Sbjct  419  LTVENLEESFDVINSKSKPLAAYLFSENKQLQKDFVNNISAGGMLINDTILHLTVSSLPF  478

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL R F G+  ARYPPYTP K +LL+ L SGN++ 
Sbjct  479  GGVGESGMGSYHGKFSFDAFSHKKAVLYRGFTGESPARYPPYTPGKLKLLKTLTSGNIVS  538

Query  363  IIRALLG  383
            I+ ALLG
Sbjct  539  ILLALLG  545



>ref|XP_010025727.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW62440.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=545

 Score =   180 bits (456),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 82/126 (65%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+ +EDG  +IN++ KPLAAYLF+ +  L+++FV N+SAGG+LIND  LH+ V TLPF
Sbjct  415  LTVDNIEDGFHMINSKPKPLAAYLFSDDNGLQKQFVQNISAGGMLINDAVLHLTVPTLPF  474

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+AFSHKK +L RSF GD   RYPPYTP+K RLL+AL+S N+I 
Sbjct  475  GGVGDSGMGAYHGKFSFDAFSHKKGILYRSFKGDASTRYPPYTPEKQRLLKALISFNIIG  534

Query  363  IIRALL  380
            II ALL
Sbjct  535  IILALL  540



>ref|XP_008444179.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
 ref|XP_008444180.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
melo]
Length=484

 Score =   179 bits (453),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED  +I+N+  KPLAAYLF++NKKL+++FV  +SAGG++INDT +H+AV TLPF
Sbjct  356  ITVDKLEDSFEIVNSGTKPLAAYLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ 
Sbjct  416  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILE  475

Query  363  IIRALLG  383
            +IRALLG
Sbjct  476  LIRALLG  482



>gb|KHG28299.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=493

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARD-KPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLP  179
            +TV+KVE    +I++   KPLAAYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LP
Sbjct  362  ITVDKVEQSFDLIHSSGGKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLP  421

Query  180  FGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLI  359
            FGGVGESG GSYHGKFSF+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++
Sbjct  422  FGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIV  481

Query  360  FIIRALLG  383
             IIRALLG
Sbjct  482  GIIRALLG  489



>ref|XP_004142629.1| PREDICTED: LOW QUALITY PROTEIN: aldehyde dehydrogenase family 
3 member H1-like [Cucumis sativus]
Length=462

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED  +I+N+  KPLAAYLF++NKKL+++FV  +SAGG++INDT +H+AV TLPF
Sbjct  334  ITVDKLEDSFEIVNSGTKPLAAYLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPF  393

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ 
Sbjct  394  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILE  453

Query  363  IIRALLG  383
            +IRA+LG
Sbjct  454  LIRAILG  460



>ref|XP_010025726.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW62439.1| hypothetical protein EUGRSUZ_H05081 [Eucalyptus grandis]
Length=550

 Score =   179 bits (455),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 82/126 (65%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+ +EDG  +IN++ KPLAAYLF+ +  L+++FV N+SAGG+LIND  LH+ V TLPF
Sbjct  420  LTVDNIEDGFHMINSKPKPLAAYLFSDDNGLQKQFVQNISAGGMLINDAVLHLTVPTLPF  479

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+AFSHKK +L RSF GD   RYPPYTP+K RLL+AL+S N+I 
Sbjct  480  GGVGDSGMGAYHGKFSFDAFSHKKGILYRSFKGDASTRYPPYTPEKQRLLKALISFNIIG  539

Query  363  IIRALL  380
            II ALL
Sbjct  540  IILALL  545



>gb|KJB59280.1| hypothetical protein B456_009G247000 [Gossypium raimondii]
Length=493

 Score =   178 bits (452),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARD-KPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLP  179
            +TV+KVE    +I++   KPLAAYLFT+NKKL+++FV  +SAGGL++NDTA+H+A+H+LP
Sbjct  362  ITVDKVEQSFDLIHSSGGKPLAAYLFTNNKKLKRKFVETVSAGGLVVNDTAVHLAIHSLP  421

Query  180  FGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLI  359
            FGGVGESG GSYHGKFSF+AFSHKKAVL R F GD   RYPPYTP K  LL+AL+SG+++
Sbjct  422  FGGVGESGMGSYHGKFSFDAFSHKKAVLYRGFAGDAFLRYPPYTPGKLTLLQALLSGSIV  481

Query  360  FIIRALLG  383
             IIRALLG
Sbjct  482  GIIRALLG  489



>ref|XP_011002476.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=756

 Score =   181 bits (458),  Expect = 8e-50, Method: Composition-based stats.
 Identities = 81/127 (64%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV  V+D I +IN++ KPL AYLFT+N+KL+  FV ++S+GG++INDT LHV V +LPF
Sbjct  626  ITVENVKDSIDLINSKPKPLTAYLFTNNEKLKNNFVQSVSSGGMVINDTVLHVTVSSLPF  685

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP+K +L+RA+M+G +  
Sbjct  686  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFSGDTSVRYPPYTPEKQKLVRAVMNGGIFD  745

Query  363  IIRALLG  383
            II A +G
Sbjct  746  IILAFMG  752



>ref|XP_004161166.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis 
sativus]
Length=484

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED  +I+N+  KPLAAYLF++NKKL+++FV  +SAGG++INDT +H+AV TLPF
Sbjct  356  ITVDKLEDSFEIVNSGTKPLAAYLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ 
Sbjct  416  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILE  475

Query  363  IIRALLG  383
            +IRA+LG
Sbjct  476  LIRAILG  482



>ref|XP_010268979.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Nelumbo 
nucifera]
Length=489

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+KVED + IIN+R KPLAAYLFTS+KKLE+EFV  +SAGG+LINDT LH+   +LPF
Sbjct  359  ITVDKVEDSLNIINSRSKPLAAYLFTSSKKLEKEFVEKISAGGMLINDTVLHLTNPSLPF  418

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKA+L R F GD+  RYPPYTP+K RLL AL+  +   
Sbjct  419  GGVGESGFGSYHGKFSFDAFSHKKAILYRPFIGDVTVRYPPYTPRKIRLLDALLHHS-TG  477

Query  363  IIRALLGL  386
            +I AL+GL
Sbjct  478  VIPALIGL  485



>gb|KGN54554.1| hypothetical protein Csa_4G361880 [Cucumis sativus]
Length=484

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED  +I+N+  KPLAAYLF++NKKL+++FV  +SAGG++INDT +H+AV TLPF
Sbjct  356  ITVDKLEDSFEIVNSGTKPLAAYLFSNNKKLKEQFVACISAGGVVINDTTIHLAVSTLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD+  RYPPYT  K R L+AL+ G ++ 
Sbjct  416  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSFVGDVPMRYPPYTDGKLRFLKALLGGGILE  475

Query  363  IIRALLG  383
            +IRA+LG
Sbjct  476  LIRAILG  482



>ref|XP_011031097.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Populus 
euphratica]
Length=553

 Score =   179 bits (453),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 80/127 (63%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV   +D I +IN++ +PL AYLFT+N+KL  +FV N+S GG++INDT LHV V +LPF
Sbjct  423  ITVENAKDSIDLINSKPEPLVAYLFTNNQKLRNDFVQNVSCGGMVINDTVLHVTVSSLPF  482

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP+  +L+RA+M+G ++ 
Sbjct  483  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFSGDSPVRYPPYTPENKKLMRAVMNGGILD  542

Query  363  IIRALLG  383
            II AL+G
Sbjct  543  IILALMG  549



>ref|XP_010530214.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
 ref|XP_010530215.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Tarenaya 
hassleriana]
Length=482

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT++K+E+  +++N+R KPLAAYLFT++KKL++ F  N+SAGG+++ND A+H+A+HTLPF
Sbjct  354  LTLDKLEECFEVVNSRSKPLAAYLFTNDKKLKERFAMNVSAGGVVVNDIAVHLALHTLPF  413

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPY+  K RLL+AL++ NL+ 
Sbjct  414  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFLGDASMRYPPYSRGKLRLLKALVNSNLMD  473

Query  363  IIRALLGL  386
            +++A+ GL
Sbjct  474  LLKAIFGL  481



>ref|XP_010444975.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like, 
partial [Camelina sativa]
Length=256

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLFT+NK+L+++FV ++SAGG+ INDT LHV V  LPF
Sbjct  124  VTVEKIEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPF  183

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+  
Sbjct  184  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFA  243

Query  363  IIRALLGL  386
             I A  G 
Sbjct  244  AIWAFFGF  251



>emb|CAC84903.1| aldehyde dehydrogenase [Arabidopsis thaliana]
Length=550

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLFT+NK+LE++FV ++SAGG+ INDT LHV V  LPF
Sbjct  419  ITVQKIEDGFQVIRSKSKPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPF  478

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+  
Sbjct  479  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNMFA  538

Query  363  IIRALLGL  386
             I A  G 
Sbjct  539  AILAFFGF  546



>gb|KCW70625.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=479

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+E+   IIN+  KPLAAY+FT++KKL++ FV N+SAGGL++NDT +H+AVH LPF
Sbjct  351  LTVDKLEESFDIINSGAKPLAAYIFTNDKKLKEHFVNNVSAGGLVVNDTTVHLAVHALPF  410

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ RSF GD   RYPPYT  K RL++AL+ G+++ 
Sbjct  411  GGVGESGIGAYHGKFSFDAFSHKKAVVYRSFMGDAAIRYPPYTNGKLRLMKALLGGSILG  470

Query  363  IIRALLG  383
            I+RAL G
Sbjct  471  ILRALFG  477



>ref|XP_010063405.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Eucalyptus 
grandis]
 gb|KCW70624.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=488

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+E+   IIN+  KPLAAY+FT++KKL++ FV N+SAGGL++NDT +H+AVH LPF
Sbjct  360  LTVDKLEESFDIINSGAKPLAAYIFTNDKKLKEHFVNNVSAGGLVVNDTTVHLAVHALPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ RSF GD   RYPPYT  K RL++AL+ G+++ 
Sbjct  420  GGVGESGIGAYHGKFSFDAFSHKKAVVYRSFMGDAAIRYPPYTNGKLRLMKALLGGSILG  479

Query  363  IIRALLG  383
            I+RAL G
Sbjct  480  ILRALFG  486



>ref|XP_003602042.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=495

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+E+   +INA  KPLAAYLFT++ K +++FV N+SAGGLLINDT LH+ VHTLPF
Sbjct  367  ITVNKLEESFDVINAGTKPLAAYLFTNDNKFKEQFVKNVSAGGLLINDTVLHLVVHTLPF  426

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+AF+H+KAVL R F GD   RYPPYT  K +L++AL++G++  
Sbjct  427  GGVGDSGMGAYHGKFSFDAFTHRKAVLYRGFTGDASIRYPPYTDTKQKLMKALVAGDVTG  486

Query  363  IIRALLG  383
            ++RAL G
Sbjct  487  VVRALFG  493



>ref|XP_009383529.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=493

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T N+VED +  IN++ KPLAAYLFT +K+LE+ FV  +SAGG+LINDTALH+A   LPF
Sbjct  363  ITFNEVEDCLDFINSKAKPLAAYLFTKDKRLEERFVKTVSAGGMLINDTALHLANPHLPF  422

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF++FSHKKAVL R FGG+  ARYPPYTP+K ++LR L++G++I 
Sbjct  423  GGVGESGIGAYHGKFSFDSFSHKKAVLSRGFGGEAPARYPPYTPQKQKILRGLINGSIIA  482

Query  363  IIRALLG  383
            ++ A+LG
Sbjct  483  LLLAILG  489



>emb|CAB36701.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 emb|CAB80141.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=533

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLFT+NK+LE++FV ++SAGG+ INDT LHV V  LPF
Sbjct  402  ITVQKIEDGFQVIRSKPKPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPF  461

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+  
Sbjct  462  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFA  521

Query  363  IIRALLGL  386
             I A  G 
Sbjct  522  AILAFFGF  529



>gb|AES72293.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=490

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+E+   +INA  KPLAAYLFT++ K +++FV N+SAGGLLINDT LH+ VHTLPF
Sbjct  362  ITVNKLEESFDVINAGTKPLAAYLFTNDNKFKEQFVKNVSAGGLLINDTVLHLVVHTLPF  421

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+AF+H+KAVL R F GD   RYPPYT  K +L++AL++G++  
Sbjct  422  GGVGDSGMGAYHGKFSFDAFTHRKAVLYRGFTGDASIRYPPYTDTKQKLMKALVAGDVTG  481

Query  363  IIRALLG  383
            ++RAL G
Sbjct  482  VVRALFG  488



>ref|NP_567962.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
 sp|Q8W033.2|AL3I1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member I1, chloroplastic; 
Short=AtALDH3; Short=Ath-ALDH3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK96824.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM10094.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE86347.1| aldehyde dehydrogenase 3I1 [Arabidopsis thaliana]
Length=550

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLFT+NK+LE++FV ++SAGG+ INDT LHV V  LPF
Sbjct  419  ITVQKIEDGFQVIRSKPKPLAAYLFTNNKELEKQFVQDVSAGGITINDTVLHVTVKDLPF  478

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+  
Sbjct  479  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFA  538

Query  363  IIRALLGL  386
             I A  G 
Sbjct  539  AILAFFGF  546



>gb|KCW70623.1| hypothetical protein EUGRSUZ_F03800 [Eucalyptus grandis]
Length=514

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+E+   IIN+  KPLAAY+FT++KKL++ FV N+SAGGL++NDT +H+AVH LPF
Sbjct  386  LTVDKLEESFDIINSGAKPLAAYIFTNDKKLKEHFVNNVSAGGLVVNDTTVHLAVHALPF  445

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ RSF GD   RYPPYT  K RL++AL+ G+++ 
Sbjct  446  GGVGESGIGAYHGKFSFDAFSHKKAVVYRSFMGDAAIRYPPYTNGKLRLMKALLGGSILG  505

Query  363  IIRALLG  383
            I+RAL G
Sbjct  506  ILRALFG  512



>ref|XP_006662790.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Oryza brachyantha]
Length=400

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED I+ IN++ KPLAAYLFT +KKL++ FV+N+ AGG+L+ND ALH+A   LPF
Sbjct  267  VTVDKIEDSIEFINSKTKPLAAYLFTKDKKLQEAFVSNVPAGGMLVNDVALHLANPHLPF  326

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG GSYHGKFSF+ F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+ I 
Sbjct  327  GGVGDSGIGSYHGKFSFDCFTHKKAVLIRGFGGEAAARYPPYTTEKQKILRGLINGSFIA  386

Query  363  IIRALLG  383
            +I ALLG
Sbjct  387  LILALLG  393



>ref|NP_001065921.1| Os11g0186200 [Oryza sativa Japonica Group]
 gb|AAY23278.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
 gb|ABA91775.2| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27766.1| Os11g0186200 [Oryza sativa Japonica Group]
 dbj|BAG96824.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96923.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67818.1| hypothetical protein OsI_35395 [Oryza sativa Indica Group]
 gb|EEE51777.1| hypothetical protein OsJ_33226 [Oryza sativa Japonica Group]
Length=482

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED I+ IN+R KPLAAYLFT +KKL++EFV+N+ AGG+L+ND ALH+A   LPF
Sbjct  350  VTVDKIEDSIQFINSRTKPLAAYLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPF  409

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG GSYHGKFSF+ F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+   
Sbjct  410  GGVGDSGIGSYHGKFSFDCFTHKKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFA  469

Query  363  IIRALLG  383
            +I ALLG
Sbjct  470  LILALLG  476



>gb|AAX96338.1| aldehyde dehydrogenase, putative [Oryza sativa Japonica Group]
Length=494

 Score =   176 bits (446),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED I+ IN+R KPLAAYLFT +KKL++EFV+N+ AGG+L+ND ALH+A   LPF
Sbjct  362  VTVDKIEDSIQFINSRTKPLAAYLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPF  421

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG GSYHGKFSF+ F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+   
Sbjct  422  GGVGDSGIGSYHGKFSFDCFTHKKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFA  481

Query  363  IIRALLG  383
            +I ALLG
Sbjct  482  LILALLG  488



>ref|XP_010437649.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like, 
partial [Camelina sativa]
Length=308

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLFT+NK+L+++FV ++SAGG+ INDT LHV V  LPF
Sbjct  176  VTVEKIEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPF  235

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+  
Sbjct  236  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFA  295

Query  363  IIRALLGL  386
             I A  G 
Sbjct  296  AIWAFFGF  303



>ref|XP_008219617.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Prunus mume]
Length=413

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV++VE+   +IN+  KPLAAYLFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPF
Sbjct  283  LTVDRVEESFDLINSGTKPLAAYLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPF  342

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ 
Sbjct  343  GGVGESGMGAYHGKFSFDAFSHKKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILS  402

Query  363  IIRALLG  383
            IIRAL G
Sbjct  403  IIRALFG  409



>ref|XP_004290887.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=486

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED   +I +  KPLAAYLFT+N+KL+  FV N+SAGGLLINDT LH+AV TLPF
Sbjct  356  ITVDKIEDSFDLITSGTKPLAAYLFTNNQKLKDHFVGNVSAGGLLINDTTLHLAVPTLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSFEAFSHKKAV+ R F GD   RYPPYT  K  L++AL+ G+L+ 
Sbjct  416  GGVGESGMGAYHGKFSFEAFSHKKAVVYRGFFGDAAVRYPPYTKGKLTLMKALVGGSLLG  475

Query  363  IIRALLG  383
            IIRAL G
Sbjct  476  IIRALFG  482



>ref|XP_010674357.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=549

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED  ++I ++ KPLAAYLFT+N+KL+ EF+ ++SAGG+LINDT LH+ V TLPF
Sbjct  419  VTVEKIEDSFEVIKSKPKPLAAYLFTNNEKLKTEFIKDISAGGMLINDTILHLTVSTLPF  478

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G YHGKFSFEAFSHKKAV+ RSF GD   RYPPYT KK  LL+ALMSG++  
Sbjct  479  GGVGESGMGYYHGKFSFEAFSHKKAVMYRSFEGDSSIRYPPYTSKKLNLLKALMSGSIFR  538

Query  363  II  368
            II
Sbjct  539  II  540



>ref|XP_010674356.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=550

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED  ++I ++ KPLAAYLFT+N+KL+ EF+ ++SAGG+LINDT LH+ V TLPF
Sbjct  420  VTVEKIEDSFEVIKSKPKPLAAYLFTNNEKLKTEFIKDISAGGMLINDTILHLTVSTLPF  479

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G YHGKFSFEAFSHKKAV+ RSF GD   RYPPYT KK  LL+ALMSG++  
Sbjct  480  GGVGESGMGYYHGKFSFEAFSHKKAVMYRSFEGDSSIRYPPYTSKKLNLLKALMSGSIFR  539

Query  363  II  368
            II
Sbjct  540  II  541



>gb|KHG30796.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T++KVED   +IN+  KPLAAY+FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPF
Sbjct  360  ITIDKVEDSFDLINSGTKPLAAYMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+ FSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G+++ 
Sbjct  420  GGVGDSGMGAYHGKFSFDTFSHKKAVLYRSFAGDAPLRYPPYTNGKLRLLKALLGGSILG  479

Query  363  IIRALLG  383
            IIRAL+G
Sbjct  480  IIRALMG  486



>ref|XP_004290886.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=489

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED   +I +  KPLAAYLFT+N+KL+  FV N+SAGGLLINDT LH+AV TLPF
Sbjct  359  ITVDKIEDSFDLITSGTKPLAAYLFTNNQKLKDHFVGNVSAGGLLINDTTLHLAVPTLPF  418

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSFEAFSHKKAV+ R F GD   RYPPYT  K  L++AL+ G+L+ 
Sbjct  419  GGVGESGMGAYHGKFSFEAFSHKKAVVYRGFFGDAAVRYPPYTKGKLTLMKALVGGSLLG  478

Query  363  IIRALLG  383
            IIRAL G
Sbjct  479  IIRALFG  485



>dbj|BAK01937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+E+GI  INA  KPLAAYLFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPF
Sbjct  357  ITVDKIEEGITHINAGAKPLAAYLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPF  416

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SGTGSYHGKFSF+ F+H+KAVL R FGG+  ARYPPYT +K R+LR L+ G+   
Sbjct  417  GGVGDSGTGSYHGKFSFDCFTHRKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFA  476

Query  363  IIRALLG  383
            +I ALLG
Sbjct  477  LILALLG  483



>ref|XP_007222253.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
 gb|EMJ23452.1| hypothetical protein PRUPE_ppa004751mg [Prunus persica]
Length=493

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV++VE+   +IN+  KPLAAYLFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPF
Sbjct  363  LTVDRVEESFDLINSGTKPLAAYLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPF  422

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ 
Sbjct  423  GGVGESGMGAYHGKFSFDAFSHKKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILS  482

Query  363  IIRALLG  383
            IIRAL G
Sbjct  483  IIRALFG  489



>ref|XP_002449124.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
 gb|EES08112.1| hypothetical protein SORBIDRAFT_05g005470 [Sorghum bicolor]
Length=478

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+E+   +INA+ KPLAAYLFT NKKL++EFV N+ AGG+L+NDTALH+A   LPF
Sbjct  346  VTVEKIEESFNLINAKPKPLAAYLFTKNKKLQEEFVANVPAGGMLVNDTALHLANPYLPF  405

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G YHGKF F+ FSHKKAVL R FGG+  ARYPPYT +K ++LR L++G+ I 
Sbjct  406  GGVGDSGMGCYHGKFGFDCFSHKKAVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIA  465

Query  363  IIRALLG  383
            +I ALLG
Sbjct  466  LILALLG  472



>gb|AFK40162.1| unknown [Lotus japonicus]
Length=141

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            L V+K+E+   +IN   KPLAAY+FTSNKKL+++FV  +SAGGL++NDT +H+AVHTLPF
Sbjct  13   LVVDKLEESFDVINTWPKPLAAYIFTSNKKLKEQFVMTVSAGGLVVNDTTVHLAVHTLPF  72

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKF F+AFSHKK+VL R F GD   RYPPYT  K RLL+AL+ G +I 
Sbjct  73   GGVGESGLGAYHGKFPFDAFSHKKSVLYRGFFGDAAIRYPPYTNTKMRLLKALIGGGIIG  132

Query  363  IIRALLG  383
            +IRAL G
Sbjct  133  VIRALFG  139



>ref|XP_006662789.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Oryza brachyantha]
Length=482

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED I+ IN++ KPLAAYLFT +KKL++ FV+N+ AGG+L+ND ALH+A   LPF
Sbjct  349  VTVDKIEDSIEFINSKTKPLAAYLFTKDKKLQEAFVSNVPAGGMLVNDVALHLANPHLPF  408

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG GSYHGKFSF+ F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+ I 
Sbjct  409  GGVGDSGIGSYHGKFSFDCFTHKKAVLIRGFGGEAAARYPPYTTEKQKILRGLINGSFIA  468

Query  363  IIRALLG  383
            +I ALLG
Sbjct  469  LILALLG  475



>ref|XP_007161479.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
 gb|ESW33473.1| hypothetical protein PHAVU_001G072600g [Phaseolus vulgaris]
Length=493

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+E+  ++IN+  KPLAAY+FT+NKKL++ FV N+SAGGL++NDT LH+AVHTLPF
Sbjct  365  LTVDKLEESFQVINSGPKPLAAYIFTNNKKLKELFVMNISAGGLVVNDTTLHLAVHTLPF  424

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RLL+AL+ G ++ 
Sbjct  425  GGVGESGVGAYHGKFSFDAFSHKKAVLYRSFIGDASVRYPPYTTTKQRLLKALIGGGILG  484

Query  363  IIRALLG  383
            IIRAL G
Sbjct  485  IIRALFG  491



>ref|XP_011074837.1| PREDICTED: aldehyde dehydrogenase [Sesamum indicum]
Length=476

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+++   +INA+ KPLAAYLFT+++KL+ EF+ ++SAGG+ IND ALH A   LPF
Sbjct  349  VTVNKIKESFDVINAKGKPLAAYLFTNDQKLKAEFIGSVSAGGITINDVALHFAEAGLPF  408

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+ FSHKKAVL+R FGGD+ ARYPPY P K + L+AL+ G+++ 
Sbjct  409  GGVGESGMGAYHGKFSFDTFSHKKAVLQRGFGGDVAARYPPYAPWKLQFLKALLRGSILG  468

Query  363  IIRALLG  383
            ++RALLG
Sbjct  469  VLRALLG  475



>ref|XP_008219616.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Prunus mume]
Length=491

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV++VE+   +IN+  KPLAAYLFT+NKKL++ FV  +SAGGL++NDT +H+AV +LPF
Sbjct  361  LTVDRVEESFDLINSGTKPLAAYLFTNNKKLKEHFVRTVSAGGLVVNDTTIHLAVPSLPF  420

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K RLL+AL+ G ++ 
Sbjct  421  GGVGESGMGAYHGKFSFDAFSHKKAVVYRGFAGDASVRYPPYTKGKLRLLKALIGGGILS  480

Query  363  IIRALLG  383
            IIRAL G
Sbjct  481  IIRALFG  487



>ref|XP_010095408.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
 gb|EXB60100.1| Aldehyde dehydrogenase family 3 member H1 [Morus notabilis]
Length=497

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV KVE+   IIN+  KPLAAYLFTSN+KL+++FV  +SAGG+++NDT +H+AV TLPF
Sbjct  369  ITVEKVEESYDIINSGPKPLAAYLFTSNEKLKKQFVMTISAGGVVVNDTTIHLAVVTLPF  428

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSFEAFSHKKAV+ RSF  D   RYPPYT  K  LL+AL+ G+++ 
Sbjct  429  GGVGESGMGAYHGKFSFEAFSHKKAVVYRSFVADAAVRYPPYTKGKLSLLKALVGGSILG  488

Query  363  IIRALLG  383
            IIRAL G
Sbjct  489  IIRALFG  495



>ref|XP_008387507.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Malus domestica]
Length=550

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED   +IN++ KPLA Y FT+N++L++ FV N+S+GG+LINDT LHV++  LPF
Sbjct  421  VTVEKIEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPF  480

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+ FSHKKAVL R F GD   RYPPYTP+K RL RA+++G++  
Sbjct  481  GGVGESGMGSYHGKFSFDGFSHKKAVLYRGFAGDSDLRYPPYTPEKQRLFRAVINGDIFT  540

Query  363  IIRALLG  383
            II AL+G
Sbjct  541  IILALIG  547



>ref|XP_008367720.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=560

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED   +IN++ KPLA Y FT+N++L++ FV N+S+GG+LINDT LHV++  LPF
Sbjct  431  VTVEKIEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPF  490

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+ FSHKKAVL R F GD   RYPPYTP+K RL RA+++G++  
Sbjct  491  GGVGESGMGSYHGKFSFDGFSHKKAVLYRGFAGDSDLRYPPYTPEKQRLFRAVINGDIFT  550

Query  363  IIRALLG  383
            II AL+G
Sbjct  551  IILALIG  557



>ref|XP_010674968.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+E+   II +R KPLAAYLFT+ K L+ +FV  +SAGGL+IND+A+H+AVHTLPF
Sbjct  349  ITVEKLEESYDIITSRTKPLAAYLFTNRKNLKDQFVRTVSAGGLVINDSAIHLAVHTLPF  408

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G+YHGKFSFEAFSHKKAVL RSF GD   RYPPYT  K +LL+AL+ G+++ 
Sbjct  409  GGVEESGMGAYHGKFSFEAFSHKKAVLYRSFIGDASVRYPPYTHGKMKLLKALIGGSILG  468

Query  363  IIRALLG  383
            I++AL+G
Sbjct  469  ILQALVG  475



>ref|XP_004515933.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X4 [Cicer arietinum]
 ref|XP_004515934.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X5 [Cicer arietinum]
Length=214

 Score =   167 bits (422),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + VNK+E+   +IN+R +PLAAYLFT + K +++FV  +SAGGLLINDT+LH+ V+TLPF
Sbjct  86   IQVNKLEESFNVINSRTRPLAAYLFTKDNKFKEQFVKKVSAGGLLINDTSLHLVVYTLPF  145

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF AF+H+KAVL R F GD   RYPPYT +K + ++AL++G++  
Sbjct  146  GGVGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYPPYTDRKQKCMKALVAGDVPG  205

Query  363  IIRALLGL  386
            I+ ALLG 
Sbjct  206  IVCALLGW  213



>ref|XP_006575169.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine 
max]
Length=496

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+E+   +IN+  KPLAAY+FT+NKKL+++FV  +SAGGL++NDT LH+AVHTLPF
Sbjct  369  LTVDKLEESFDVINSGPKPLAAYIFTNNKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPF  428

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSFEAFSHKKAVL R F GD   RYPPYT  K RLL+A++ G +  
Sbjct  429  GGVGESGVGAYHGKFSFEAFSHKKAVLYRKFIGDAPVRYPPYTNTKMRLLKAIIGGGIHG  488

Query  363  IIRALLG  383
            I+RAL G
Sbjct  489  IVRALFG  495



>gb|EMS62407.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=450

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+E+ I  INA  KPLAAYLFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPF
Sbjct  318  ITVDKIEESITHINAGAKPLAAYLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPF  377

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SGTGSYHGKFSF+ F+H+KAVL R FGG+  ARYPPYT +K R+LR L+ G+   
Sbjct  378  GGVGDSGTGSYHGKFSFDCFTHRKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFA  437

Query  363  IIRALLGL  386
            +I ALLG 
Sbjct  438  LILALLGF  445



>ref|XP_009379029.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009379042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Pyrus x bretschneideri]
Length=486

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED   +IN+  KPLAAYLFT+ KKL++ FV  +SAGGLLINDT +H+AV +LPF
Sbjct  356  VTVDKLEDSFDLINSGAKPLAAYLFTNKKKLKEHFVNTVSAGGLLINDTTVHLAVPSLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ 
Sbjct  416  GGVGESGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILS  475

Query  363  IIRALLG  383
            IIRAL G
Sbjct  476  IIRALFG  482



>ref|XP_009379028.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009379041.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=491

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ED   +IN+  KPLAAYLFT+ KKL++ FV  +SAGGLLINDT +H+AV +LPF
Sbjct  361  VTVDKLEDSFDLINSGAKPLAAYLFTNKKKLKEHFVNTVSAGGLLINDTTVHLAVPSLPF  420

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ 
Sbjct  421  GGVGESGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILS  480

Query  363  IIRALLG  383
            IIRAL G
Sbjct  481  IIRALFG  487



>gb|KDP32847.1| hypothetical protein JCGZ_12139 [Jatropha curcas]
Length=493

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + V+K+E+   +IN+  KPLAAYLFT+NKKL+Q+FV ++SAGG+++NDTA+H+AV TLPF
Sbjct  363  VMVDKIEESFDLINSGTKPLAAYLFTNNKKLKQQFVISVSAGGVVVNDTAVHLAVPTLPF  422

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESGTG+YHGKFSF+ FSHKKAVL R F GD   RYPPY+  K RLL+ L+ G +  
Sbjct  423  GGVGESGTGAYHGKFSFDTFSHKKAVLYRGFAGDAPVRYPPYSSGKIRLLKVLLGGGIWD  482

Query  363  IIRALLG  383
            IIRAL G
Sbjct  483  IIRALFG  489



>ref|XP_002869163.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45422.1| ALDH3I1 [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
             TV K+EDG ++I ++ KPLAAYLFT++ +L+++FV N+SAGG+ INDT LHV V  +PF
Sbjct  417  FTVQKIEDGFQVIRSKPKPLAAYLFTNSAELQKQFVQNVSAGGMTINDTVLHVTVKDMPF  476

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+  
Sbjct  477  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALISSNIFA  536

Query  363  IIRALLGL  386
             I A  GL
Sbjct  537  AILAFFGL  544



>ref|XP_004515930.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=270

 Score =   167 bits (424),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + VNK+E+   +IN+R +PLAAYLFT + K +++FV  +SAGGLLINDT+LH+ V+TLPF
Sbjct  142  IQVNKLEESFNVINSRTRPLAAYLFTKDNKFKEQFVKKVSAGGLLINDTSLHLVVYTLPF  201

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF AF+H+KAVL R F GD   RYPPYT +K + ++AL++G++  
Sbjct  202  GGVGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYPPYTDRKQKCMKALVAGDVPG  261

Query  363  IIRALLG  383
            I+ ALLG
Sbjct  262  IVCALLG  268



>gb|EMT33845.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=517

 Score =   173 bits (438),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+E+ I  INA  KPLAAYLFT +KKL+Q+FV+N+SAGG+L+ND ALH+    LPF
Sbjct  385  ITVDKIEESIAHINAGAKPLAAYLFTKDKKLQQDFVSNVSAGGMLVNDVALHLTNPHLPF  444

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SGTGSYHGKFSF+ F+H+KAVL R FGG+  ARYPPYT +K R+LR L+ G+   
Sbjct  445  GGVGDSGTGSYHGKFSFDCFTHRKAVLIRGFGGEANARYPPYTAEKQRILRGLIKGSFFA  504

Query  363  IIRALLG  383
            +I ALLG
Sbjct  505  LILALLG  511



>gb|KJB75337.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=443

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV ++ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPF
Sbjct  313  ITVERLEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPF  372

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ 
Sbjct  373  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLN  432

Query  363  IIRALLG  383
            I+ ALLG
Sbjct  433  IMLALLG  439



>ref|XP_008365201.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Malus domestica]
Length=486

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   +IN+  KPLAAYLFT+ KKL++ FV  +SAGGL+INDT +H+AV ++PF
Sbjct  356  LTVDKLEDSFDLINSGAKPLAAYLFTNKKKLKEHFVNTVSAGGLVINDTTVHLAVPSVPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ 
Sbjct  416  GGVGESGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILS  475

Query  363  IIRALLG  383
            IIRAL G
Sbjct  476  IIRALFG  482



>ref|XP_008378442.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
 ref|XP_008365200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Malus domestica]
Length=491

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   +IN+  KPLAAYLFT+ KKL++ FV  +SAGGL+INDT +H+AV ++PF
Sbjct  361  LTVDKLEDSFDLINSGAKPLAAYLFTNKKKLKEHFVNTVSAGGLVINDTTVHLAVPSVPF  420

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K R+L+ALM G ++ 
Sbjct  421  GGVGESGMGAYHGKFSFDAFSHKKAVVYRGFVGDASIRYPPYTKGKLRILKALMGGGILS  480

Query  363  IIRALLG  383
            IIRAL G
Sbjct  481  IIRALFG  487



>ref|XP_010432443.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
[Camelina sativa]
Length=547

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLF++NK+L+++FV  +SAGG+ INDT LHV V  LPF
Sbjct  415  VTVEKIEDGFQVIRSKPKPLAAYLFSNNKELQEQFVQGVSAGGISINDTVLHVTVKDLPF  474

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+  
Sbjct  475  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTPKKKMVLKALLSSNIFA  534

Query  363  IIRALLGL  386
             I A  G 
Sbjct  535  AILAFFGF  542



>gb|KHN20611.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=614

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+E+   +IN+  KPLAAY+FT+NKKL+++FV  +SAGGL++NDT LH+AVHTLPF
Sbjct  487  LTVDKLEESFDVINSGPKPLAAYIFTNNKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPF  546

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSFEAFSHKKAVL R F GD   RYPPYT  K RLL+A++ G +  
Sbjct  547  GGVGESGVGAYHGKFSFEAFSHKKAVLYRKFIGDAPVRYPPYTNTKMRLLKAIIGGGIHG  606

Query  363  IIRALLG  383
            I+RAL G
Sbjct  607  IVRALFG  613



>gb|KHG17901.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Gossypium 
arboreum]
 gb|KHG21723.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Gossypium 
arboreum]
Length=366

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV ++ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPF
Sbjct  236  ITVERLEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNIYAGGMAINDTILQVTVPTLPF  295

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ 
Sbjct  296  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLN  355

Query  363  IIRALLG  383
            I+ ALLG
Sbjct  356  IMLALLG  362



>ref|XP_007019116.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
 gb|EOY16341.1| Aldehyde dehydrogenase 3H1 isoform 1 [Theobroma cacao]
Length=489

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +3

Query  3    LTVNKVEDGIKIINAR-DKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLP  179
            + V+KVED   +IN+   KPLAAYLFT+ +KL+++FV  +SAGGL++NDT +H+A HTLP
Sbjct  360  IMVDKVEDSFDVINSSGTKPLAAYLFTNKEKLKEKFVATVSAGGLVVNDTTVHLAEHTLP  419

Query  180  FGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLI  359
            FGGVG+SG G+YHGKFSF+AFSHKKAVL R F  D   RYPPYT +K RLL+AL+ G+L+
Sbjct  420  FGGVGDSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPPYTRRKLRLLQALLGGSLL  479

Query  360  FIIRALLG  383
             IIRALLG
Sbjct  480  SIIRALLG  487



>gb|KJB75341.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
 gb|KJB75342.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=488

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV ++ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPF
Sbjct  358  ITVERLEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPF  417

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ 
Sbjct  418  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLN  477

Query  363  IIRALLG  383
            I+ ALLG
Sbjct  478  IMLALLG  484



>ref|XP_006412252.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
 dbj|BAJ33838.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53705.1| hypothetical protein EUTSA_v10024844mg [Eutrema salsugineum]
Length=547

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLFT NK+L+++FV +++AGG+ INDT LHV V  LPF
Sbjct  416  ITVQKIEDGFQVIRSKAKPLAAYLFTDNKELQKKFVQDVAAGGIGINDTVLHVTVKDLPF  475

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTPKK  +L+AL+S N+  
Sbjct  476  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFAGDSDLRYPPYTPKKKMVLKALLSSNIFA  535

Query  363  IIRALLGL  386
             I A  G 
Sbjct  536  AILAFFGF  543



>ref|XP_010437650.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLFT+NK+L+++FV ++SAGG+ INDT LHV V  LPF
Sbjct  417  VTVEKIEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQSVSAGGISINDTVLHVTVKDLPF  476

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+  
Sbjct  477  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFA  536

Query  363  IIRALLGL  386
             I A  G 
Sbjct  537  AIWAFFGF  544



>ref|XP_007019117.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
 gb|EOY16342.1| Aldehyde dehydrogenase 3H1 isoform 2 [Theobroma cacao]
Length=515

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +3

Query  3    LTVNKVEDGIKIINAR-DKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLP  179
            + V+KVED   +IN+   KPLAAYLFT+ +KL+++FV  +SAGGL++NDT +H+A HTLP
Sbjct  386  IMVDKVEDSFDVINSSGTKPLAAYLFTNKEKLKEKFVATVSAGGLVVNDTTVHLAEHTLP  445

Query  180  FGGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLI  359
            FGGVG+SG G+YHGKFSF+AFSHKKAVL R F  D   RYPPYT +K RLL+AL+ G+L+
Sbjct  446  FGGVGDSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPPYTRRKLRLLQALLGGSLL  505

Query  360  FIIRALLG  383
             IIRALLG
Sbjct  506  SIIRALLG  513



>ref|XP_008338656.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Malus 
domestica]
Length=496

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV K+ED   +IN+  KPLAAYLFT+ KKL++ FV  +SAGGL++NDT +H+AV +LPF
Sbjct  366  LTVEKMEDSFDLINSGTKPLAAYLFTNKKKLKEHFVNTVSAGGLVVNDTTIHLAVPSLPF  425

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAV+ R F GD   RYPPYT  K R+L+AL+SG +  
Sbjct  426  GGVGESGMGAYHGKFSFDAFSHKKAVVYRGFFGDASIRYPPYTKGKLRILKALISGGISS  485

Query  363  IIRALLG  383
            IIRAL G
Sbjct  486  IIRALFG  492



>ref|XP_006304446.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
 gb|EOA37344.1| hypothetical protein CARUB_v10011079mg [Capsella rubella]
Length=484

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVN +E+   +I +R KPLAAYLFT NKKL+++F   +SAGG+++ND A+H+A+HTLPF
Sbjct  356  ITVNNLEESFDVIRSRPKPLAAYLFTHNKKLKEKFAMTVSAGGIVVNDIAVHLALHTLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  
Sbjct  416  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFD  475

Query  363  IIRALLGL  386
            I + LLGL
Sbjct  476  IFKVLLGL  483



>ref|XP_009355863.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Pyrus x bretschneideri]
Length=560

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED   +IN++ KPLA Y FT+N++L++ FV N+S+GG+LINDT LHV++  LPF
Sbjct  431  VTVEKIEDSFSVINSKPKPLAVYAFTNNEQLKKGFVDNVSSGGMLINDTVLHVSISGLPF  490

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+ FSHKKAVL R FGGD   RYPPYTP+K RL +A+++ +++ 
Sbjct  491  GGVGESGMGSYHGKFSFDGFSHKKAVLYRGFGGDSDLRYPPYTPEKQRLFKAVINRDILT  550

Query  363  IIRALLG  383
            II +L+G
Sbjct  551  IILSLIG  557



>ref|XP_011027504.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Populus 
euphratica]
Length=488

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            L V+K+ED   +IN+  KPLAAYLFT+NKKL+++FV ++SAGG++IND A+H+A+HTLPF
Sbjct  360  LIVSKIEDSFDMINSGTKPLAAYLFTNNKKLKEQFVVSVSAGGVVINDIAMHLAIHTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESGTGSYHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K RL++A M+ N   
Sbjct  420  GGVGESGTGSYHGKFSFDAFSHKKAVLYRSFMGDAALRYPPYTRGKLRLMKAFMTSNFWN  479

Query  363  IIRALLG  383
            I+RALLG
Sbjct  480  ILRALLG  486



>ref|XP_011468213.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Fragaria 
vesca subsp. vesca]
Length=545

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+E    +I +R KPLA Y+FT+N++L++ FV N+S+GG+LINDT LHVAV  LPF
Sbjct  418  VTVDKIEGSFDVIKSRPKPLAVYVFTNNEQLKKSFVENISSGGMLINDTVLHVAVAGLPF  477

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+ FSHKK+V+ RS  GD   RYPPYTP+K +L +A +SGN+  
Sbjct  478  GGVGESGMGSYHGKFSFDGFSHKKSVMYRSLSGDSTLRYPPYTPEKEKLFKAALSGNIFR  537

Query  363  IIRALLG  383
            II AL+G
Sbjct  538  IILALIG  544



>ref|NP_001168661.1| hypothetical protein [Zea mays]
 gb|ACN29088.1| unknown [Zea mays]
 tpg|DAA38941.1| TPA: hypothetical protein ZEAMMB73_547503 [Zea mays]
Length=478

 Score =   171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+E+   +INAR KPLAAYLFT NKKL++EFV ++ AGG+L+NDT LH+A   +PF
Sbjct  346  VTVEKIEESFDLINARPKPLAAYLFTKNKKLQEEFVADVPAGGMLVNDTVLHLANPYMPF  405

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G YHGKF F+ FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I 
Sbjct  406  GGVGDSGMGCYHGKFGFDCFSHKKGVLVRGFGGEANARYPPYTTEKQKILRGLINGSFIA  465

Query  363  IIRALLG  383
            +I ALLG
Sbjct  466  LILALLG  472



>gb|KDO52216.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=507

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED   +I ++ KPLAAY F+ ++++++EFV N+SAGG++ NDT +H  V +LPF
Sbjct  377  VTVEKIEDSFDVIKSKPKPLAAYFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPF  436

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYT +K +LLRAL +GN+  
Sbjct  437  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFG  496

Query  363  IIRALLG  383
            ++ AL+G
Sbjct  497  LLLALIG  503



>sp|Q8VXQ2.1|ALDH_CRAPL RecName: Full=Aldehyde dehydrogenase; AltName: Full=Cp-ALDH [Craterostigma 
plantagineum]
 emb|CAC84900.1| aldehyde dehydrogenase [Craterostigma plantagineum]
Length=479

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+E+  KII ++ KPLAAYLFT++KK  +EFV+N+SAGG+ IND ALH     LPF
Sbjct  350  ITVGKIEECYKIIASKPKPLAAYLFTNDKKRTEEFVSNVSAGGITINDIALHFLEPRLPF  409

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKK+VLKRSFGG++ ARYPPY P K   + A++ G++  
Sbjct  410  GGVGESGMGSYHGKFSFDAFSHKKSVLKRSFGGEVAARYPPYAPWKLHFMEAILQGDIFG  469

Query  363  IIRALLG  383
            +++A LG
Sbjct  470  LLKAWLG  476



>ref|XP_006596209.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Glycine max]
Length=422

 Score =   169 bits (428),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+E+   +IN+  KPLAAY+FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPF
Sbjct  295  LTVDKIEESFDVINSGSKPLAAYIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPF  354

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKF+FEAFSHKKAVL R F GD   RYPPYT  K RLL+AL+ G ++ 
Sbjct  355  GGVGESGVGAYHGKFTFEAFSHKKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILG  414

Query  363  IIRALLG  383
            IIRAL G
Sbjct  415  IIRALFG  421



>emb|CDX69039.1| BnaC01g04140D [Brassica napus]
Length=549

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+EDG ++I ++ KPLAAYLFT NK+L+ +FV N+SAGG+ IN+T LHV +  LPF
Sbjct  418  ITVSKIEDGFQVIRSKPKPLAAYLFTDNKELQNQFVQNVSAGGMGINETVLHVTLKDLPF  477

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++  
Sbjct  478  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFG  537

Query  363  IIRALLGL  386
             I A  G 
Sbjct  538  AILAFFGF  545



>gb|KJB75340.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   171 bits (433),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 79/128 (62%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV ++ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPF
Sbjct  417  ITVERLEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPF  476

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ 
Sbjct  477  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLN  536

Query  363  IIRALLGL  386
            I+ ALLG 
Sbjct  537  IMLALLGF  544



>ref|XP_003544699.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX2 
[Glycine max]
Length=487

 Score =   170 bits (431),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+E+   +IN+  KPLAAY+FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPF
Sbjct  360  LTVDKIEESFDVINSGSKPLAAYIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKF+FEAFSHKKAVL R F GD   RYPPYT  K RLL+AL+ G ++ 
Sbjct  420  GGVGESGVGAYHGKFTFEAFSHKKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILG  479

Query  363  IIRALLG  383
            IIRAL G
Sbjct  480  IIRALFG  486



>ref|XP_009420563.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=484

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+++ +G  +IN++ KPLAAYLFT ++KLE++FV ++SAGG++INDT L V    LPF
Sbjct  354  VTVDELREGFGLINSKGKPLAAYLFTKDRKLEEKFVKSVSAGGMVINDTILQVTNPRLPF  413

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL R FGGD+  RYPPYT  K ++LR L++GN+I 
Sbjct  414  GGVGESGMGSYHGKFSFDAFSHKKAVLSRGFGGDVSMRYPPYTAHKQKILRGLITGNIIA  473

Query  363  IIRALLG  383
            +  AL+G
Sbjct  474  VFLALIG  480



>ref|XP_006432086.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
 ref|XP_006464930.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR45326.1| hypothetical protein CICLE_v10000776mg [Citrus clementina]
Length=543

 Score =   171 bits (433),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 76/127 (60%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED   +I ++ KPLAAY F+ ++++++EFV N+SAGG++ NDT +H  V +LPF
Sbjct  413  VTVEKIEDSFDVIKSKPKPLAAYFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPF  472

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYT +K +LLRAL +GN+  
Sbjct  473  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFG  532

Query  363  IIRALLG  383
            ++ AL+G
Sbjct  533  LLLALIG  539



>ref|XP_002888606.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64865.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=484

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+N +E+   +I +R KPLAAYLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPF
Sbjct  356  LTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  
Sbjct  416  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFD  475

Query  363  IIRALLGL  386
            I + LLGL
Sbjct  476  IFKVLLGL  483



>gb|KDO52215.1| hypothetical protein CISIN_1g009109mg [Citrus sinensis]
Length=543

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED   +I ++ KPLAAY F+ ++++++EFV N+SAGG++ NDT +H  V +LPF
Sbjct  413  VTVEKIEDSFDVIKSKPKPLAAYFFSDDEQMKKEFVQNISAGGIVFNDTIVHTTVSSLPF  472

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYT +K +LLRAL +GN+  
Sbjct  473  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFNGDSTTRYPPYTAEKQKLLRALFNGNIFG  532

Query  363  IIRALLGL  386
            ++ AL+G 
Sbjct  533  LLLALIGW  540



>gb|KJB75338.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=544

 Score =   171 bits (432),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 79/128 (62%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV ++ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPF
Sbjct  414  ITVERLEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPF  473

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+SG L+ 
Sbjct  474  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLSGKLLN  533

Query  363  IIRALLGL  386
            I+ ALLG 
Sbjct  534  IMLALLGF  541



>ref|XP_009145048.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brassica 
rapa]
Length=482

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+N +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+AV TLPF
Sbjct  354  ITLNNLEECFDVIRSRPKPLAAYLFTQNQKLKERFALTVSAGGIVVNDIAVHLAVPTLPF  413

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ N++ 
Sbjct  414  GGVGESGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPPYSTGKLRLLKALVNSNILE  473

Query  363  IIRALLGL  386
            I R +LGL
Sbjct  474  IFRVILGL  481



>ref|NP_001077676.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32027.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=421

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+N +E+   +I +R KPLAAYLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPF
Sbjct  293  LTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPF  352

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  
Sbjct  353  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFD  412

Query  363  IIRALLGL  386
            + + LLGL
Sbjct  413  LFKVLLGL  420



>ref|XP_003544698.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoformX1 
[Glycine max]
 gb|KHN20143.1| Aldehyde dehydrogenase family 3 member H1 [Glycine soja]
Length=496

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+E+   +IN+  KPLAAY+FT+ KKL+++FV  +SAGGL++NDT LH+AVHTLPF
Sbjct  369  LTVDKIEESFDVINSGSKPLAAYIFTNTKKLKEQFVMTISAGGLVVNDTTLHLAVHTLPF  428

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKF+FEAFSHKKAVL R F GD   RYPPYT  K RLL+AL+ G ++ 
Sbjct  429  GGVGESGVGAYHGKFTFEAFSHKKAVLYRRFIGDAPVRYPPYTNTKMRLLKALIGGGILG  488

Query  363  IIRALLG  383
            IIRAL G
Sbjct  489  IIRALFG  495



>ref|XP_010447116.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Camelina sativa]
Length=549

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLFT+NK+L+++FV  +SAGG+ INDT LHV +  LPF
Sbjct  417  VTVEKIEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQGVSAGGISINDTVLHVTLKDLPF  476

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+  
Sbjct  477  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTQKKKMVLKALLSSNIFA  536

Query  363  IIRALLGL  386
             I A  G 
Sbjct  537  AIWAFFGF  544



>ref|XP_007159875.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
 gb|ESW31869.1| hypothetical protein PHAVU_002G275200g [Phaseolus vulgaris]
Length=566

 Score =   170 bits (430),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+ +ED   II +R KPLAAYLFT+N++L++++V  +S+GG+LIND  +HVA   LPF
Sbjct  438  ITVDNIEDCYSIIKSRPKPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPF  497

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G YHGKFSF++FSH+K VL RSF GD   RYPPYTP+K +LL+A+++GN++ 
Sbjct  498  GGVEESGMGCYHGKFSFDSFSHRKPVLYRSFDGDSSIRYPPYTPQKEKLLKAIITGNIVQ  557

Query  363  IIRALLG  383
            I  ALLG
Sbjct  558  IFLALLG  564



>ref|XP_004514084.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cicer 
arietinum]
Length=138

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            VNK+E+   +IN+R KP AAYLFT + K +++FV  +S GGLLIND ALH+ V+ LPFGG
Sbjct  12   VNKLEESFNVINSRTKPRAAYLFTKDNKFKEQFVKKVSVGGLLINDIALHLVVYNLPFGG  71

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  368
            VG+SG G+YHGKFSF AF+H+KAVL R F GD   RYPPYT +K + ++AL++G++  I+
Sbjct  72   VGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYPPYTDRKQKCMKALVAGDVPGIV  131

Query  369  RALLGL  386
             ALLG 
Sbjct  132  CALLGW  137



>gb|AAM61211.1| aldehyde dehydrogenase, putative [Arabidopsis thaliana]
Length=484

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+N +E+   +I +R KPLAAYLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPF
Sbjct  356  LTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFTATVSAGGIVVNDIAVHLALHTLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  
Sbjct  416  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFD  475

Query  363  IIRALLGL  386
            + + LLGL
Sbjct  476  LFKVLLGL  483



>gb|KFK30059.1| hypothetical protein AALP_AA7G211500 [Arabis alpina]
Length=560

 Score =   169 bits (429),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 78/128 (61%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDGI++I ++ KPLAAYLFT NK+L+Q+FV +++AGG+ +NDT LHV V  LPF
Sbjct  429  VTVQKIEDGIQVIRSKPKPLAAYLFTDNKELQQQFVQDVAAGGIGVNDTILHVTVKDLPF  488

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS++ FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+  
Sbjct  489  GGVGESGIGAYHGKFSYDTFSHKKGVLYRSFVGDSDIRYPPYTTKKKTVLKALLSSNIFR  548

Query  363  IIRALLGL  386
             I A  G 
Sbjct  549  AILAFFGF  556



>gb|AET04825.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=543

 Score =   169 bits (429),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+ +ED   II +R KPLAAYLFT+N++L++++V  +S+GG+LIND  +HVA   LPF
Sbjct  413  ITVDSIEDSFSIIQSRPKPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPF  472

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G YHGKFSF++FSHKK+VL ++F  D   RYPPYTP+K  +LRA+  GN+  
Sbjct  473  GGVGESGMGCYHGKFSFDSFSHKKSVLYKTFDSDPSIRYPPYTPEKENILRAIFGGNIFQ  532

Query  363  IIRALLG  383
            II ALLG
Sbjct  533  IILALLG  539



>ref|NP_175081.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 ref|NP_849770.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 sp|Q70DU8.2|AL3H1_ARATH RecName: Full=Aldehyde dehydrogenase family 3 member H1; Short=AtALDH4; 
Short=Ath-ALDH4 [Arabidopsis thaliana]
 gb|AAG50550.1|AC074228_5 aldehyde dehydrogenase, putative [Arabidopsis thaliana]
 gb|AAL59944.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE32025.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
 gb|AEE32026.1| aldehyde dehydrogenase 3H1 [Arabidopsis thaliana]
Length=484

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+N +E+   +I +R KPLAAYLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPF
Sbjct  356  LTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  
Sbjct  416  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFD  475

Query  363  IIRALLGL  386
            + + LLGL
Sbjct  476  LFKVLLGL  483



>ref|XP_008444182.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Cucumis melo]
Length=488

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+KVED   I+N+  KPLAAYLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPF
Sbjct  360  LTVDKVEDSFDIVNSGTKPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ 
Sbjct  420  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILG  479

Query  363  IIRALLG  383
            +IRALLG
Sbjct  480  LIRALLG  486



>ref|XP_008444183.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Cucumis melo]
Length=484

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+KVED   I+N+  KPLAAYLFT+NKKL++ FV  +SAGG+ IN+TALH+ + TLPF
Sbjct  356  LTVDKVEDSFDIVNSGTKPLAAYLFTNNKKLKERFVACISAGGVAINETALHLTISTLPF  415

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RSF GD   RYPPYT  K R+L+AL+ G ++ 
Sbjct  416  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSFAGDAPMRYPPYTKGKLRILKALLGGGILG  475

Query  363  IIRALLG  383
            +IRALLG
Sbjct  476  LIRALLG  482



>gb|AFW65463.1| hypothetical protein ZEAMMB73_893012 [Zea mays]
Length=456

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+E+   +INA+ KPLAAYLFT N+KL++EFV ++ AGG+L+NDTALH+    +PF
Sbjct  324  VTVEKIEESFDLINAKPKPLAAYLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPF  383

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G YHGKF F+ FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I 
Sbjct  384  GGVGDSGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIA  443

Query  363  IIRALLG  383
            +I ALLG
Sbjct  444  LILALLG  450



>ref|XP_004503900.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=534

 Score =   169 bits (427),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+ +ED   II +R KPLAAYLFT+N++L++E+V  +S+GG+LIND  +HVA   LPF
Sbjct  405  ITVDNIEDSFSIIKSRPKPLAAYLFTNNEQLKKEYVDKISSGGMLINDAVIHVATRGLPF  464

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G YHGKF+F++FSHKK+VL +SF  D   RYPPYTP+K +LLRA++ GN+  
Sbjct  465  GGVEESGMGCYHGKFTFDSFSHKKSVLYKSFDADPSIRYPPYTPQKEKLLRAILGGNIFD  524

Query  363  IIRALLG  383
            II AL G
Sbjct  525  IILALFG  531



>emb|CDY36018.1| BnaA08g04430D [Brassica napus]
Length=482

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+N +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+++ TLPF
Sbjct  354  LTLNNLEECFDVIRSRPKPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPF  413

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ 
Sbjct  414  GGVGESGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVE  473

Query  363  IIRALLGL  386
            + + LLGL
Sbjct  474  VFKVLLGL  481



>ref|XP_009107480.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Brassica 
rapa]
Length=482

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+N +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+++ TLPF
Sbjct  354  LTLNNLEECFDVIRSRPKPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPF  413

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ 
Sbjct  414  GGVGESGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVE  473

Query  363  IIRALLGL  386
            + + LLGL
Sbjct  474  VFKVLLGL  481



>ref|XP_004503899.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=542

 Score =   169 bits (427),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+ +ED   II +R KPLAAYLFT+N++L++E+V  +S+GG+LIND  +HVA   LPF
Sbjct  413  ITVDNIEDSFSIIKSRPKPLAAYLFTNNEQLKKEYVDKISSGGMLINDAVIHVATRGLPF  472

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G YHGKF+F++FSHKK+VL +SF  D   RYPPYTP+K +LLRA++ GN+  
Sbjct  473  GGVEESGMGCYHGKFTFDSFSHKKSVLYKSFDADPSIRYPPYTPQKEKLLRAILGGNIFD  532

Query  363  IIRALLG  383
            II AL G
Sbjct  533  IILALFG  539



>ref|XP_003532071.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Glycine max]
 gb|KHN16935.1| Aldehyde dehydrogenase family 3 member I1, chloroplastic [Glycine 
soja]
Length=541

 Score =   169 bits (427),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+ +ED   II ++ KPLAAYLFT+N++L++++V  +S+GG+LIND  +HVA   LPF
Sbjct  413  VTVDNIEDCYSIIKSKPKPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPF  472

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGV ESG G YHGKFSF++FSH+K+VL RSF  D   RYPPYTP+K +LL+AL+SGN++ 
Sbjct  473  GGVEESGMGCYHGKFSFDSFSHRKSVLYRSFDADSTIRYPPYTPQKEKLLKALISGNIVQ  532

Query  363  IIRALLG  383
            II +LLG
Sbjct  533  IILSLLG  539



>emb|CDY36336.1| BnaC08g05150D [Brassica napus]
Length=482

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+N +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+++ TLPF
Sbjct  354  LTLNNLEECFDVIRSRPKPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLSLPTLPF  413

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ NL+ 
Sbjct  414  GGVGESGMGSYHGKFSFDAFSHKKAVLYKSFIGDAAIRYPPYSRGKLRLLKALVNSNLVE  473

Query  363  IIRALLGL  386
            + + LLGL
Sbjct  474  VFKVLLGL  481



>emb|CDX75414.1| BnaA01g02880D [Brassica napus]
Length=556

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+EDG ++I ++ KPLAAYLFT NK L+  FV N+SAGG+ IN+T LHV +  LPF
Sbjct  425  ITVSKIEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPF  484

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++  
Sbjct  485  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFG  544

Query  363  IIRALLGL  386
             I A  G 
Sbjct  545  AILAFFGF  552



>ref|NP_001288985.1| aldehyde dehydrogenase family 3 member I1, chloroplastic [Brassica 
rapa]
 gb|ABC41273.1| putative aldehyde dehydrogenase [Brassica rapa]
Length=555

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+EDG ++I ++ KPLAAYLFT NK L+  FV N+SAGG+ IN+T LHV +  LPF
Sbjct  424  ITVSKIEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPF  483

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++  
Sbjct  484  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFG  543

Query  363  IIRALLGL  386
             I A  G 
Sbjct  544  AILAFFGF  551



>ref|XP_009115077.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Brassica rapa]
Length=554

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+EDG ++I ++ KPLAAYLFT NK L+  FV N+SAGG+ IN+T LHV +  LPF
Sbjct  423  ITVSKIEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPF  482

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++  
Sbjct  483  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFG  542

Query  363  IIRALLGL  386
             I A  G 
Sbjct  543  AILAFFGF  550



>gb|AID60136.1| aldehyde dehydrogenase 3 [Brassica napus]
Length=554

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+EDG ++I ++ KPLAAYLFT NK L+  FV N+SAGG+ IN+T LHV +  LPF
Sbjct  423  ITVSKIEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPF  482

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++  
Sbjct  483  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFG  542

Query  363  IIRALLGL  386
             I A  G 
Sbjct  543  AILAFFGF  550



>ref|XP_009115014.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Brassica rapa]
Length=556

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+EDG ++I ++ KPLAAYLFT NK L+  FV N+SAGG+ IN+T LHV +  LPF
Sbjct  425  ITVSKIEDGFQVIRSKPKPLAAYLFTDNKVLQNRFVENVSAGGMGINETVLHVTLKDLPF  484

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYTP+K R+L+AL+S ++  
Sbjct  485  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFDGDSDLRYPPYTPEKKRVLKALLSSDIFG  544

Query  363  IIRALLGL  386
             I A  G 
Sbjct  545  AILAFFGF  552



>gb|ACF85700.1| unknown [Zea mays]
 gb|AFW65462.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+E+   +INA+ KPLAAYLFT N+KL++EFV ++ AGG+L+NDTALH+    +PF
Sbjct  346  VTVEKIEESFDLINAKPKPLAAYLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPF  405

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G YHGKF F+ FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I 
Sbjct  406  GGVGDSGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIA  465

Query  363  IIRALLG  383
            +I ALLG
Sbjct  466  LILALLG  472



>gb|ACG29168.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=478

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+E+   +INA+ KPLAAYLFT N+KL++EFV ++ AGG+L+NDTALH+    +PF
Sbjct  346  VTVEKIEESFDLINAKPKPLAAYLFTKNRKLQEEFVASVPAGGMLVNDTALHLTNPYMPF  405

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G YHGKF F+ FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I 
Sbjct  406  GGVGDSGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIA  465

Query  363  IIRALLG  383
            +I ALLG
Sbjct  466  LILALLG  472



>gb|KHG30273.1| Aldehyde dehydrogenase family 3 member H1 [Gossypium arboreum]
Length=490

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            V+KVED   +IN+  KPLAAYLFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPFGG
Sbjct  362  VDKVEDSFDVINSGTKPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGG  421

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  368
            VG+SG G+YHGKFSF+AFSHKKAVL R F  D   RYPPYT  K  LLRAL  G+++ II
Sbjct  422  VGDSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGII  481

Query  369  RALLG  383
            RALLG
Sbjct  482  RALLG  486



>gb|KJB29203.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=457

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            V+KVED   +IN+  KPLAAYLFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPFGG
Sbjct  329  VDKVEDSFDVINSGTKPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGG  388

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  368
            VG+SG G+YHGKFSF+AFSHKKAVL R F  D   RYPPYT  K  LLRAL  G+++ II
Sbjct  389  VGDSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGII  448

Query  369  RALLG  383
            RALLG
Sbjct  449  RALLG  453



>gb|KJB29202.1| hypothetical protein B456_005G089100 [Gossypium raimondii]
Length=490

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            V+KVED   +IN+  KPLAAYLFT+ KKL+++FV  +SAGGL+INDT +H+A  TLPFGG
Sbjct  362  VDKVEDSFDVINSGTKPLAAYLFTNKKKLKEKFVATVSAGGLVINDTTVHLAEPTLPFGG  421

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  368
            VG+SG G+YHGKFSF+AFSHKKAVL R F  D   RYPPYT  K  LLRAL  G+++ II
Sbjct  422  VGDSGMGAYHGKFSFDAFSHKKAVLYRGFACDAFVRYPPYTRGKLGLLRALFDGSILGII  481

Query  369  RALLG  383
            RALLG
Sbjct  482  RALLG  486



>ref|XP_010461437.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+N +E+   +I++R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+A+HTLPF
Sbjct  357  ITLNNLEESFDVIHSRPKPLAAYLFTHNQKLKERFAMTVSAGGIVVNDIAVHLALHTLPF  416

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  
Sbjct  417  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFN  476

Query  363  IIRALLGL  386
            I + LLGL
Sbjct  477  IFKVLLGL  484



>ref|XP_010479042.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 [Camelina 
sativa]
Length=485

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+N +E+   +I++R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+A+HTLPF
Sbjct  357  ITLNNLEESFDVIHSRPKPLAAYLFTHNQKLKERFAMTVSAGGIVVNDIAVHLALHTLPF  416

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  
Sbjct  417  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFN  476

Query  363  IIRALLGL  386
            I + LLGL
Sbjct  477  IFKVLLGL  484



>ref|XP_006283479.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
 gb|EOA16377.1| hypothetical protein CARUB_v10004527mg [Capsella rubella]
Length=546

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG ++I ++ KPLAAYLFT+NK+L+++FV  +SAGG+ INDT LHV    LPF
Sbjct  414  VTVAKIEDGFQVIRSKPKPLAAYLFTNNKELQEQFVQGVSAGGISINDTVLHVTQKDLPF  473

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFS+E FSHKK VL RSF GD   RYPPYT KK  +L+AL+S N+  
Sbjct  474  GGVGESGIGAYHGKFSYETFSHKKGVLYRSFSGDADLRYPPYTTKKKMVLKALISSNIFA  533

Query  363  IIRALLGL  386
             I A  G 
Sbjct  534  AILAFFGF  541



>ref|XP_010500136.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Camelina 
sativa]
Length=486

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+N +E+   +I++R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+A+HTLPF
Sbjct  358  ITLNNLEESFDVIHSRPKPLAAYLFTHNQKLKERFAMKVSAGGIVVNDIAVHLALHTLPF  417

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  
Sbjct  418  GGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDAPVRYPPYSRGKLRLLKALVDSNIFN  477

Query  363  IIRALLGL  386
            I + LLGL
Sbjct  478  IFKVLLGL  485



>ref|XP_004502483.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=493

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+E+   +IN+  KPLAAYLFT++ K +++FV  +SAGGLLINDT LH+ V TLPF
Sbjct  365  ITVNKLEESFDVINSGTKPLAAYLFTNDNKFKEQFVKKVSAGGLLINDTVLHLVVCTLPF  424

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+AF+H+KAVL R F GD   RYPPYT  K + ++AL++G++  
Sbjct  425  GGVGDSGMGAYHGKFSFDAFTHRKAVLYRGFTGDSSLRYPPYTDTKQKCMKALVAGDVPG  484

Query  363  IIRALLG  383
            I+RAL G
Sbjct  485  IVRALFG  491



>ref|XP_004502482.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X1 [Cicer arietinum]
Length=488

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+E+   +IN+  KPLAAYLFT++ K +++FV  +SAGGLLINDT LH+ V TLPF
Sbjct  360  ITVNKLEESFDVINSGTKPLAAYLFTNDNKFKEQFVKKVSAGGLLINDTVLHLVVCTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+AF+H+KAVL R F GD   RYPPYT  K + ++AL++G++  
Sbjct  420  GGVGDSGMGAYHGKFSFDAFTHRKAVLYRGFTGDSSLRYPPYTDTKQKCMKALVAGDVPG  479

Query  363  IIRALLG  383
            I+RAL G
Sbjct  480  IVRALFG  486



>gb|ABR16899.1| unknown [Picea sitchensis]
Length=556

 Score =   168 bits (425),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 73/127 (57%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+E+ ++++++  KPLAAYLFT NK  E++ V ++SAGG+++NDTALH+  H LPF
Sbjct  427  ITVQKMEEALEVVSSLPKPLAAYLFTKNKMFERQVVASISAGGMVVNDTALHLVNHHLPF  486

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSFE FSH+KAVL R F GDL ARYPPYT +K +++R L++G+ + 
Sbjct  487  GGVGESGMGAYHGKFSFENFSHRKAVLYRGFMGDLMARYPPYTRRKQKIVRCLLNGDFLG  546

Query  363  IIRALLG  383
            ++ AL+G
Sbjct  547  LLYALIG  553



>ref|XP_004515931.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Cicer arietinum]
Length=266

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + VNK+E+   +IN+R +PLAAYLFT + K +++FV  +SAGGLLINDT+LH+ V+TLPF
Sbjct  142  IQVNKLEESFNVINSRTRPLAAYLFTKDNKFKEQFVKKVSAGGLLINDTSLHLVVYTLPF  201

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNL  356
            GGVG+SG G+YHGKFSF AF+H+KAVL R F GD   RYPPYT +K + ++AL++G++
Sbjct  202  GGVGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYPPYTDRKQKCMKALVAGDV  259



>ref|XP_006393739.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
 gb|ESQ31025.1| hypothetical protein EUTSA_v10011438mg [Eutrema salsugineum]
Length=483

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+N +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+A+ TLPF
Sbjct  355  LTLNNLEECFDVIRSRPKPLAAYLFTQNQKLKERFAMTVSAGGIVVNDIAVHLALPTLPF  414

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL +SF GD   RYPPY+  K RLL+AL++ N++ 
Sbjct  415  GGVGESGMGSYHGKFSFDAFSHKKAVLYKSFFGDSAIRYPPYSRGKLRLLKALVNSNIVE  474

Query  363  IIRALLGL  386
              + LLGL
Sbjct  475  FFKVLLGL  482



>ref|XP_004515932.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X3 [Cicer arietinum]
Length=262

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + VNK+E+   +IN+R +PLAAYLFT + K +++FV  +SAGGLLINDT+LH+ V+TLPF
Sbjct  142  IQVNKLEESFNVINSRTRPLAAYLFTKDNKFKEQFVKKVSAGGLLINDTSLHLVVYTLPF  201

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNL  356
            GGVG+SG G+YHGKFSF AF+H+KAVL R F GD   RYPPYT +K + ++AL++G++
Sbjct  202  GGVGDSGMGAYHGKFSFHAFTHRKAVLYRGFTGDSSLRYPPYTDRKQKCMKALVAGDV  259



>ref|XP_009350139.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=450

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED   +I+++ KPLA   FT+N++ ++ FV N+S+GG+LINDT LHV++  LPF
Sbjct  321  VTVEKIEDSFSVIHSKPKPLAVCAFTNNEQPKKGFVDNVSSGGMLINDTVLHVSISGLPF  380

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+ FSHKKAVL R FGGD   RYPPYTP+K RL +A+++ N++ 
Sbjct  381  GGVGESGMGSYHGKFSFDGFSHKKAVLYRGFGGDSDLRYPPYTPEKQRLFKAVINRNILT  440

Query  363  IIRALLG  383
            II +L+G
Sbjct  441  IILSLIG  447



>ref|XP_003630349.1| Aldehyde dehydrogenase family 3 member H1 [Medicago truncatula]
Length=550

 Score =   167 bits (422),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 74/125 (59%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            V+ +ED   II +R KPLAAYLFT+N++L++++V  +S+GG+LIND  +HVA   LPFGG
Sbjct  422  VDSIEDSFSIIQSRPKPLAAYLFTNNEQLKKDYVDKISSGGMLINDAVIHVATRGLPFGG  481

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  368
            VGESG G YHGKFSF++FSHKK+VL ++F  D   RYPPYTP+K  +LRA+  GN+  II
Sbjct  482  VGESGMGCYHGKFSFDSFSHKKSVLYKTFDSDPSIRYPPYTPEKENILRAIFGGNIFQII  541

Query  369  RALLG  383
             ALLG
Sbjct  542  LALLG  546



>ref|NP_001148092.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG29697.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=481

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+E+   +INA+ KPLAAYLFT N+KL++EFV ++ AGG+L+ND ALH+    +PF
Sbjct  349  VTVEKIEESFDLINAKPKPLAAYLFTKNRKLQEEFVASVPAGGMLVNDIALHLTNPYMPF  408

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G YHGKF F+ FSHKK VL R FGG+  ARYPPYT +K ++LR L++G+ I 
Sbjct  409  GGVGDSGMGCYHGKFGFDCFSHKKGVLIRGFGGEANARYPPYTTEKQKILRGLINGSFIA  468

Query  363  IIRALLG  383
            +I ALLG
Sbjct  469  LILALLG  475



>ref|XP_002893982.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70241.1| ALDH3H1 [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +3

Query  24   DGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESG  203
            +   +I +R KPLAAYLFT NKKL++ F T +SAGG+++ND A+H+A+HTLPFGGVGESG
Sbjct  371  ESFDMIRSRPKPLAAYLFTHNKKLKERFATTVSAGGIVVNDIAVHLALHTLPFGGVGESG  430

Query  204  TGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLG  383
             G+YHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  I +ALLG
Sbjct  431  MGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFDIFKALLG  490

Query  384  L  386
            L
Sbjct  491  L  491



>ref|XP_007048535.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
 gb|EOX92692.1| Aldehyde dehydrogenase 3I1 isoform 1 [Theobroma cacao]
Length=547

 Score =   166 bits (420),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    TVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFG  185
            TV K+ED   +IN + K LAAYLF+ ++++E++FV N+SAGG+ INDT L + V TLPFG
Sbjct  418  TVEKLEDAFDMINRKPKALAAYLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFG  477

Query  186  GVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFI  365
            GVGESG GSYHGKFSF+AFSH KAVL RSF G+   RYPPYTP K + ++AL+SG++  I
Sbjct  478  GVGESGMGSYHGKFSFDAFSHNKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNI  537

Query  366  IRALLG  383
            + ALLG
Sbjct  538  MLALLG  543



>emb|CAE51203.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
Length=480

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+N +E+   +I +R KPLAAYLFT NKKL++ F   +SAGG+++ND A+H+A+HTLPF
Sbjct  352  LTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPF  411

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSF+A SHKKAVL RS  GD   RYPPY+  K RLL+AL+  N+  
Sbjct  412  GGVGESGMGAYHGKFSFDASSHKKAVLYRSLFGDSAVRYPPYSRGKLRLLKALVDSNIFD  471

Query  363  IIRALLGL  386
            + + LLGL
Sbjct  472  LFKVLLGL  479



>ref|XP_007048537.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
 gb|EOX92694.1| Aldehyde dehydrogenase 3I1 isoform 3 [Theobroma cacao]
Length=487

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    TVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFG  185
            TV K+ED   +IN + K LAAYLF+ ++++E++FV N+SAGG+ INDT L + V TLPFG
Sbjct  358  TVEKLEDAFDMINRKPKALAAYLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFG  417

Query  186  GVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFI  365
            GVGESG GSYHGKFSF+AFSH KAVL RSF G+   RYPPYTP K + ++AL+SG++  I
Sbjct  418  GVGESGMGSYHGKFSFDAFSHNKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNI  477

Query  366  IRALLG  383
            + ALLG
Sbjct  478  MLALLG  483



>ref|XP_007048536.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
 gb|EOX92693.1| Aldehyde dehydrogenase 3I1 isoform 2 [Theobroma cacao]
Length=542

 Score =   166 bits (420),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  6    TVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFG  185
            TV K+ED   +IN + K LAAYLF+ ++++E++FV N+SAGG+ INDT L + V TLPFG
Sbjct  413  TVEKLEDAFDMINRKPKALAAYLFSDDEQIERKFVQNVSAGGIAINDTILQLTVPTLPFG  472

Query  186  GVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFI  365
            GVGESG GSYHGKFSF+AFSH KAVL RSF G+   RYPPYTP K + ++AL+SG++  I
Sbjct  473  GVGESGMGSYHGKFSFDAFSHNKAVLYRSFAGESPTRYPPYTPGKQKQMKALISGDVFNI  532

Query  366  IRALLG  383
            + ALLG
Sbjct  533  MLALLG  538



>ref|XP_010664200.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X2 [Vitis vinifera]
Length=488

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   +I +R KPLAAYLFT+NKKL+++FV  +SAGGL+INDT LH A  TLPF
Sbjct  360  LTVDKLEDSFDMITSRGKPLAAYLFTNNKKLKEKFVKTVSAGGLVINDTVLHFAEKTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFS+EAFSH+K+VL R F GD  ARYPPY+ +K +LL+AL+SG+++ 
Sbjct  420  GGVGESGMGSYHGKFSYEAFSHRKSVLYRGFAGDASARYPPYSDRKLKLLKALLSGSVVG  479

Query  363  IIRALLG  383
            +I AL+G
Sbjct  480  VILALIG  486



>ref|XP_010664198.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
 ref|XP_010664199.1| PREDICTED: aldehyde dehydrogenase family 3 member H1 isoform 
X1 [Vitis vinifera]
Length=516

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   +I +R KPLAAYLFT+NKKL+++FV  +SAGGL+INDT LH A  TLPF
Sbjct  388  LTVDKLEDSFDMITSRGKPLAAYLFTNNKKLKEKFVKTVSAGGLVINDTVLHFAEKTLPF  447

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFS+EAFSH+K+VL R F GD  ARYPPY+ +K +LL+AL+SG+++ 
Sbjct  448  GGVGESGMGSYHGKFSYEAFSHRKSVLYRGFAGDASARYPPYSDRKLKLLKALLSGSVVG  507

Query  363  IIRALLG  383
            +I AL+G
Sbjct  508  VILALIG  514



>emb|CBI19000.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ED   +I +R KPLAAYLFT+NKKL+++FV  +SAGGL+INDT LH A  TLPF
Sbjct  422  LTVDKLEDSFDMITSRGKPLAAYLFTNNKKLKEKFVKTVSAGGLVINDTVLHFAEKTLPF  481

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFS+EAFSH+K+VL R F GD  ARYPPY+ +K +LL+AL+SG+++ 
Sbjct  482  GGVGESGMGSYHGKFSYEAFSHRKSVLYRGFAGDASARYPPYSDRKLKLLKALLSGSVVG  541

Query  363  IIRALLG  383
            +I AL+G
Sbjct  542  VILALIG  548



>ref|XP_004502485.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cicer 
arietinum]
Length=486

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TVNK+E+   +IN+  KPLAAYLFT++ K +++FV  +SAGGL+IND+ LH    TLPF
Sbjct  360  ITVNKLEESFDVINSGTKPLAAYLFTNDNKFKEQFVKKVSAGGLVINDSVLHFVACTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+AF+H+KAVL R F GD   RYPPYT KK + ++AL++G++  
Sbjct  420  GGVGDSGMGAYHGKFSFDAFTHRKAVLYRGFTGDSSLRYPPYTDKKQKCMKALVAGDVPG  479

Query  363  IIRALLG  383
            ++RAL G
Sbjct  480  LVRALFG  486



>gb|KFK24209.1| hypothetical protein AALP_AAs42301U000200 [Arabis alpina]
Length=483

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTVN +E+   +I +R KPLAAYLFT N+KL++ F   +SAGG+++ND A+H+A+ TLPF
Sbjct  355  LTVNNLEESFDVIRSRPKPLAAYLFTQNEKLKERFANTVSAGGIVVNDIAVHLALPTLPF  414

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL +SF GD   RY PY+  K RLL+AL++ NL+ 
Sbjct  415  GGVGESGMGSYHGKFSFDAFSHKKAVLYKSFLGDSTVRYAPYSRGKLRLLKALVNSNLLE  474

Query  363  IIRALLG  383
            + + L G
Sbjct  475  VFKVLFG  481



>gb|EAZ19830.1| hypothetical protein OsJ_35414 [Oryza sativa Japonica Group]
Length=464

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ +   +IN+  K LAAYLFT + KL++++   +SAGG+L+NDTA+H+    LPF
Sbjct  333  ITVDKIHESFALINSMTKALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPF  392

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHG+FSFEAFSHKKAVL R F G+  ARYPPY+P K ++LR ++ GNL  
Sbjct  393  GGVGESGMGAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGA  452

Query  363  IIRALLG  383
            +I+A+LG
Sbjct  453  MIKAILG  459



>gb|EAY82454.1| hypothetical protein OsI_37671 [Oryza sativa Indica Group]
Length=464

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ +   +IN+  K LAAYLFT + KL++++   +SAGG+L+NDTA+H+    LPF
Sbjct  333  ITVDKIHESFALINSMTKALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPF  392

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHG+FSFEAFSHKKAVL R F G+  ARYPPY+P K ++LR ++ GNL  
Sbjct  393  GGVGESGMGAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGA  452

Query  363  IIRALLG  383
            +I+A+LG
Sbjct  453  MIKAILG  459



>gb|ABA96616.1| aldehyde dehydrogenase family protein, expressed [Oryza sativa 
Japonica Group]
Length=484

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ +   +IN+  K LAAYLFT + KL++++   +SAGG+L+NDTA+H+    LPF
Sbjct  353  ITVDKIHESFALINSMTKALAAYLFTKDSKLQEQYEAAISAGGMLVNDTAVHLTNQYLPF  412

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHG+FSFEAFSHKKAVL R F G+  ARYPPY+P K ++LR ++ GNL  
Sbjct  413  GGVGESGMGAYHGRFSFEAFSHKKAVLVRRFAGEAAARYPPYSPAKLKILRGVLKGNLGA  472

Query  363  IIRALLG  383
            +I+A+LG
Sbjct  473  MIKAILG  479



>ref|XP_006663868.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like, partial 
[Oryza brachyantha]
Length=479

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ + + +IN+  KPLAAYLFT + KL++++V  +SAGG+L+NDTA+H+    LPF
Sbjct  348  ITVDKIHESLALINSMTKPLAAYLFTKDSKLQEQYVAAISAGGMLVNDTAVHLTNQYLPF  407

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHG FSFEAFSHKKAVL R F  +  ARYPPY+  K ++LR ++ GNL  
Sbjct  408  GGVGESGMGAYHGSFSFEAFSHKKAVLVRGFACEAAARYPPYSMAKLKILRGVLKGNLGA  467

Query  363  IIRALLG  383
            +I+A+LG
Sbjct  468  MIQAILG  474



>gb|EPS67421.1| aldehyde dehydrogenase, partial [Genlisea aurea]
Length=250

 Score =   155 bits (391),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV ++E+ + +I+A++K LAAYLFT++ KL+ EFV  +SAG + IN+T LH    +LPF
Sbjct  124  LTVERIEESLDVIDAKEKALAAYLFTNSPKLKSEFVRKVSAGAVCINETNLHFMEPSLPF  183

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHGKFSFEAFSH+KAVL+R   GD+ ARYPPY+ +K  LL+ L+ G L+ 
Sbjct  184  GGVGESGMGAYHGKFSFEAFSHRKAVLERVLFGDVPARYPPYSRRKMDLLKNLLQGRLVA  243

Query  363  IIRALLG  383
              +ALLG
Sbjct  244  ATQALLG  250



>gb|ABR25386.1| aldehyde dehydrogenase dimeric nadp preferring [Oryza sativa 
Indica Group]
Length=115

 Score =   150 bits (379),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +3

Query  57   PLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSFE  236
            PLAAYLFT +KKL++EFV+N+ AGG+L+ND ALH+A   LPFGGVG+SG GSYHGKFSF+
Sbjct  1    PLAAYLFTKDKKLQEEFVSNVPAGGMLVNDVALHLANPHLPFGGVGDSGIGSYHGKFSFD  60

Query  237  AFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  386
             F+HKKAVL R FGG+  ARYPPYT +K ++LR L++G+   +I ALLG 
Sbjct  61   CFTHKKAVLIRGFGGEATARYPPYTIEKQKILRGLINGSFFALILALLGF  110



>gb|KJB75339.1| hypothetical protein B456_012G037500 [Gossypium raimondii]
Length=547

 Score =   160 bits (404),  Expect = 9e-43, Method: Composition-based stats.
 Identities = 72/115 (63%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV ++ED   +IN + KPLAAYLF+ +++++++FV N+ AGG+ INDT L V V TLPF
Sbjct  414  ITVERLEDSFAMINRKPKPLAAYLFSDDEQIKRKFVQNICAGGMAINDTILQVTVPTLPF  473

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMS  347
            GGVGESG GSYHGKFSF+AFSHKKAVL RSF GD   RYPPYTP K + ++AL+S
Sbjct  474  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSFAGDSPTRYPPYTPGKKKQIKALLS  528



>ref|XP_010539000.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Tarenaya 
hassleriana]
Length=482

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+  +ED   +IN+  KPLAAYLFT++KKL+++F   +SAGG+++ND A+H+A+HTLPF
Sbjct  354  LTLENLEDSFDVINSGSKPLAAYLFTNDKKLKEKFARIVSAGGVVVNDIAVHLALHTLPF  413

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGN  353
            GGVGESG GSYHGKFSF+AFSHKKAVL RS  GD   RYPPY+  K RLL+AL++ N
Sbjct  414  GGVGESGMGSYHGKFSFDAFSHKKAVLYRSLLGDASMRYPPYSRWKLRLLKALVNRN  470



>ref|XP_009404859.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Musa 
acuminata subsp. malaccensis]
Length=487

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+ +E    +IN++ KPLAAYLFT + KLE++FV  +SAGG+LIND  L      LPF
Sbjct  354  ITVDDLEQSFDVINSKPKPLAAYLFTKDHKLEKKFVKTVSAGGMLINDAILQFTNPHLPF  413

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHG+FSF+AFSHKKAVL R F G++  RYPPYTP K ++LR L++GN++ 
Sbjct  414  GGVGESGMGSYHGRFSFDAFSHKKAVLSRGFYGEIPMRYPPYTPLKQKVLRGLIAGNILP  473

Query  363  IIRALL  380
            ++ AL+
Sbjct  474  LLHALV  479



>gb|KJB64495.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=442

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T++KVED   +I +  KPLAAY+FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPF
Sbjct  312  ITIDKVEDSFDLITSGAKPLAAYMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPF  371

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+ FSHKKAVL RSF GD   RYPPYT  K  LL+AL+ G+++ 
Sbjct  372  GGVGDSGMGAYHGKFSFDTFSHKKAVLYRSFAGDAPLRYPPYTDGKLGLLKALLGGSILG  431

Query  363  IIRALLG  383
            IIRAL+G
Sbjct  432  IIRALMG  438



>gb|KJB64493.1| hypothetical protein B456_010G051500 [Gossypium raimondii]
Length=490

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T++KVED   +I +  KPLAAY+FT+NKKL+++FV  +SAGGL+INDT +H+A  TLPF
Sbjct  360  ITIDKVEDSFDLITSGAKPLAAYMFTNNKKLKEKFVEKVSAGGLVINDTTVHLAEPTLPF  419

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G+YHGKFSF+ FSHKKAVL RSF GD   RYPPYT  K  LL+AL+ G+++ 
Sbjct  420  GGVGDSGMGAYHGKFSFDTFSHKKAVLYRSFAGDAPLRYPPYTDGKLGLLKALLGGSILG  479

Query  363  IIRALLG  383
            IIRAL+G
Sbjct  480  IIRALMG  486



>ref|XP_001780129.1| variable substrate [Physcomitrella patens]
 gb|EDQ55048.1| variable substrate [Physcomitrella patens]
Length=500

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + V   ++ I IINAR KPLAAY+FT+NK +E+  V N+S+GG+++NDT +H     LPF
Sbjct  371  IKVQGEQEAIDIINARPKPLAAYVFTTNKAVEERMVKNVSSGGMVVNDTVMHFVNPGLPF  430

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSHKKAVL R+  GD  ARYPP+T KK   LR ++ G+ I 
Sbjct  431  GGVGESGMGSYHGKFSFDAFSHKKAVLYRTSLGDFPARYPPFTTKKQNFLRCVLDGDYIG  490

Query  363  IIRALLGL  386
             I +L GL
Sbjct  491  AILSLTGL  498



>gb|ABK24239.1| unknown [Picea sitchensis]
Length=478

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+E+ ++++++  KPLAAY+FT NKK E++ V ++SAGG+L+NDTALHV  H LPF
Sbjct  348  ITVQKMEEALEVVSSFSKPLAAYVFTKNKKFERQVVASVSAGGMLVNDTALHVTNHHLPF  407

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSFEAFSHKKAVL R F GDL ARYPPYT +K +++R L+SG+ + 
Sbjct  408  GGVGESGVGSYHGKFSFEAFSHKKAVLYRGFMGDLMARYPPYTTRKQKIVRCLLSGDFLG  467

Query  363  IIRALLG  383
            ++ A+LG
Sbjct  468  LLYAILG  474



>ref|XP_006370381.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
 gb|ERP66950.1| hypothetical protein POPTR_0001s421502g, partial [Populus trichocarpa]
Length=99

 Score =   143 bits (360),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 81/99 (82%), Gaps = 0/99 (0%)
 Frame = +3

Query  90   KLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGESGTGSYHGKFSFEAFSHKKAVLKR  269
            KL+  FV ++S+GG++INDT LHV V +LPFGGVGESG GSYHGKFSF+AFSHKKAVL R
Sbjct  1    KLKNNFVQSVSSGGMVINDTVLHVTVSSLPFGGVGESGMGSYHGKFSFDAFSHKKAVLYR  60

Query  270  SFGGDLGARYPPYTPKKARLLRALMSGNLIFIIRALLGL  386
            SF GD   RYPPYTP+K +L+RA+M+G +  II AL+G 
Sbjct  61   SFSGDASVRYPPYTPEKQKLIRAVMNGGIFDIILALMGF  99



>gb|EMT24757.1| Aldehyde dehydrogenase family 3 member H1 [Aegilops tauschii]
Length=334

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LTV+K+ +   +IN+  KPLAAYLFT + +L+ +F   +SAGG+L NDT++H+    LPF
Sbjct  203  LTVDKIHESFGLINSMAKPLAAYLFTRDSELQNQFEGAISAGGMLFNDTSIHLTNPYLPF  262

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESGTG+YHGKFSF+AFSH+KAV+ R F G+  ARYPPY+  K ++L+ ++ G L  
Sbjct  263  GGVGESGTGAYHGKFSFDAFSHRKAVMNRGFAGEARARYPPYSAPKLKILKGVLEGKLGD  322

Query  363  IIRALLGL  386
            +I+A+LG 
Sbjct  323  MIQAILGF  330



>ref|XP_010238657.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Brachypodium 
distachyon]
Length=479

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ +   +IN+  KPLAAYLF+ N KL+ +F  ++SAGG+L+NDT++H+    LPF
Sbjct  348  ITVDKINECFGLINSMSKPLAAYLFSRNSKLQDKFERSISAGGMLLNDTSIHLTNPYLPF  407

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESGTG+YHGKFSF+AFSHKKAVL R F G+  ARYPPY+  K ++++ ++ G L  
Sbjct  408  GGVGESGTGAYHGKFSFDAFSHKKAVLNRGFFGEAKARYPPYSEPKLKIMKGVLEGKLGD  467

Query  363  IIRALLG  383
            +I+A LG
Sbjct  468  MIQAFLG  474



>gb|EMS67813.1| Aldehyde dehydrogenase family 3 member H1 [Triticum urartu]
Length=334

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ +   +IN+  KPLAAYLFT + +L+ +F   +SAGG+L NDT++H+    LPF
Sbjct  203  ITVDKIHESFGLINSMAKPLAAYLFTRDSELQNQFEGAISAGGMLFNDTSIHLTNPYLPF  262

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESGTGSYHGKFSF+AFSH+KAV+ R F G+  ARYPPY+  + ++L+ ++ G L  
Sbjct  263  GGVGESGTGSYHGKFSFDAFSHRKAVMNRGFAGEARARYPPYSAPRLKILKGVLEGKLGD  322

Query  363  IIRALLGL  386
            +I+A+LG 
Sbjct  323  MIQAILGF  330



>ref|XP_010547359.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=438

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG +II ++ KPLAAYLFT+N+ L+++FV N+SAGG+ IND  LHV V  LPF
Sbjct  313  ITVQKIEDGFEIIRSKPKPLAAYLFTNNELLKKKFVENISAGGMGINDAVLHVTVDGLPF  372

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G YHGKFSFE FSHKK VL RSF  D   RYPPYTPKK ++L AL+SGNL  
Sbjct  373  GGVGESGMGGYHGKFSFETFSHKKGVLYRSFSWDSDLRYPPYTPKKQKVLTALLSGNLFD  432

Query  363  IIRAL  377
             I AL
Sbjct  433  AILAL  437



>ref|XP_002978104.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
 gb|EFJ20761.1| hypothetical protein SELMODRAFT_271300 [Selaginella moellendorffii]
Length=479

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            ++V  +++ I I+N+R KPLA YLFT   K++++ +   SAGG+++ND  LH    TLPF
Sbjct  350  ISVRSIDEAIDIVNSRPKPLALYLFTKKDKVKEKVIAETSAGGMVVNDCCLHFLTTTLPF  409

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSH KA+L R F  D+ ARYPPY+  K   +R L+  + + 
Sbjct  410  GGVGESGMGSYHGKFSFDAFSHHKAILTRPFWMDIMARYPPYSAHKKTFIRCLLEADFVG  469

Query  363  IIRALLGL  386
            +I  LLGL
Sbjct  470  VILCLLGL  477



>ref|XP_002966639.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
 gb|EFJ32666.1| hypothetical protein SELMODRAFT_227647 [Selaginella moellendorffii]
Length=479

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            ++V  +++ I I+N+R KPLA YLFT   K++++ +   SAGG+++ND  LH    TLPF
Sbjct  350  ISVRSIDEAIDIVNSRPKPLALYLFTKKDKVKEKVIAETSAGGMVVNDCCLHFLTTTLPF  409

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHGKFSF+AFSH KA+L R F  D+ ARYPPY+  K   +R L+  + + 
Sbjct  410  GGVGESGMGSYHGKFSFDAFSHHKAILTRPFWMDIMARYPPYSAHKKTFIRCLLEADFVG  469

Query  363  IIRALLGL  386
            +I  LLGL
Sbjct  470  VILCLLGL  477



>ref|XP_010547357.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010547358.1| PREDICTED: aldehyde dehydrogenase family 3 member I1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=540

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDG +II ++ KPLAAYLFT+N+ L+++FV N+SAGG+ IND  LHV V  LPF
Sbjct  415  ITVQKIEDGFEIIRSKPKPLAAYLFTNNELLKKKFVENISAGGMGINDAVLHVTVDGLPF  474

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G YHGKFSFE FSHKK VL RSF  D   RYPPYTPKK ++L AL+SGNL  
Sbjct  475  GGVGESGMGGYHGKFSFETFSHKKGVLYRSFSWDSDLRYPPYTPKKQKVLTALLSGNLFD  534

Query  363  IIRAL  377
             I AL
Sbjct  535  AILAL  539



>ref|XP_002978037.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
 gb|EFJ20694.1| hypothetical protein SELMODRAFT_268146 [Selaginella moellendorffii]
Length=480

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + V+ +E  +  +N R KPLA YLFT +K LE++ V+  SAGG+++NDT LH    T+PF
Sbjct  350  IPVDSMESAMSFVNTRPKPLALYLFTRDKALEKKVVSETSAGGMVVNDTVLHFVTETMPF  409

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG SG G+YHGKFSF+AFSH+KAVL R F GD+ +RYPPYT  K   ++  + GN + 
Sbjct  410  GGVGHSGMGAYHGKFSFDAFSHRKAVLYRGFWGDMASRYPPYTIAKQTFVKNFLQGNYLE  469

Query  363  IIRALL  380
             I+ALL
Sbjct  470  AIKALL  475



>ref|XP_002966702.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
 gb|EFJ32729.1| hypothetical protein SELMODRAFT_168397 [Selaginella moellendorffii]
Length=480

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 89/126 (71%), Gaps = 0/126 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + V+ +E  +  +N R KPLA YLFT +K LE++ V+  SAGG+++NDT LH    T+PF
Sbjct  350  IPVDSMESAMSFVNTRPKPLALYLFTRDKALEKKVVSETSAGGMVVNDTVLHFVTETMPF  409

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG SG G+YHGKFSF+AFSH+KAVL R F  D+ +RYPPYT  K   +R  + GN + 
Sbjct  410  GGVGHSGMGAYHGKFSFDAFSHRKAVLYRGFWADMASRYPPYTIAKQNFVRNFLQGNYLE  469

Query  363  IIRALL  380
             I+ALL
Sbjct  470  AIKALL  475



>ref|XP_002441918.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
 gb|EES15756.1| hypothetical protein SORBIDRAFT_08g004840 [Sorghum bicolor]
Length=487

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 98/128 (77%), Gaps = 1/128 (1%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ +   +IN+  KPLAAYLFT++ +L+Q+F  N+S+GG++ NDTA+H+    LPF
Sbjct  352  ITVDKISESFAVINSVSKPLAAYLFTNDSRLKQQFERNISSGGMIFNDTAIHLTNPHLPF  411

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKR-SFGGDLGARYPPYTPKKARLLRALMSGNLI  359
            GGVGESG G+YHG FSF+AF+H+KAVL R SF G+  ARYPPYTP K  +LR ++ GN +
Sbjct  412  GGVGESGMGAYHGAFSFDAFTHRKAVLDRSSFLGEARARYPPYTPAKLGILRGVLKGNPL  471

Query  360  FIIRALLG  383
             ++ A +G
Sbjct  472  AMVLAAVG  479



>gb|AFW56225.1| hypothetical protein ZEAMMB73_146423 [Zea mays]
Length=420

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ +   +IN+  KPLAAYLF+++ +L+Q+F   +SAGG++ NDT +H+    LPF
Sbjct  286  ITVDKIGESFAVINSMPKPLAAYLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPF  345

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHG FSF+AFSH+KAVL RSF G+  ARYPPYTP K  +LR +++G+ + 
Sbjct  346  GGVGESGMGAYHGAFSFDAFSHRKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLA  405

Query  363  IIRALLGL  386
             ++A  G 
Sbjct  406  TVQAAAGC  413



>gb|ACL53721.1| unknown [Zea mays]
 gb|AFW56224.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ +   +IN+  KPLAAYLF+++ +L+Q+F   +SAGG++ NDT +H+    LPF
Sbjct  357  ITVDKIGESFAVINSMPKPLAAYLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPF  416

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHG FSF+AFSH+KAVL RSF G+  ARYPPYTP K  +LR +++G+ + 
Sbjct  417  GGVGESGMGAYHGAFSFDAFSHRKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLA  476

Query  363  IIRALLGL  386
             ++A  G 
Sbjct  477  TVQAAAGC  484



>ref|NP_001152171.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
 gb|ACG46203.1| aldehyde dehydrogenase, dimeric NADP-preferring [Zea mays]
Length=491

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ +   +IN+  KPLAAYLF+++ +L+Q+F   +SAGG++ NDT +H+    LPF
Sbjct  357  ITVDKIGESFAVINSMPKPLAAYLFSNDGQLKQQFERTVSAGGIMFNDTGIHLTNPNLPF  416

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G+YHG FSF+AFSH+KAVL RSF G+  ARYPPYTP K  +LR +++G+ + 
Sbjct  417  GGVGESGMGAYHGAFSFDAFSHRKAVLDRSFLGEARARYPPYTPAKLAILRGVLNGSPLA  476

Query  363  IIRALLGL  386
             ++A  G 
Sbjct  477  TVQAAAGC  484



>emb|CDY66167.1| BnaCnng49760D [Brassica napus]
Length=160

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT+N +++   +I++R KPLAAYLFT + KL++ F   +SAG +++NDTA+H  + TLPF
Sbjct  52   LTLNNLKECFHVIHSRPKPLAAYLFTKDHKLKERFAKTVSAGSIVVNDTAVHFTLPTLPF  111

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKK  320
            GGVGESG GSYHGKFSF+AFSHKK+VL +SF GD   RYPPY+ KK
Sbjct  112  GGVGESGIGSYHGKFSFDAFSHKKSVLFKSFLGDSAIRYPPYSRKK  157



>ref|XP_001757163.1| variable substrate [Physcomitrella patens]
 gb|EDQ78022.1| variable substrate [Physcomitrella patens]
Length=479

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV  V+  + IIN + KPL  Y+F++NK L   F    S+GG+++ND  L   +  LPF
Sbjct  350  ITVRNVDHALNIINDKPKPLEVYVFSNNKDLFNRFRDETSSGGIVMNDCVLQFIIPELPF  409

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESGTG+YHGK +F+AFSH+KAVL ++ GGD+ ARYPP+T +K  L++AL++G +I 
Sbjct  410  GGVGESGTGAYHGKATFDAFSHRKAVLVKNMGGDVFARYPPFTVRKQSLIKALLTGTIID  469

Query  363  IIRALLG  383
            II A LG
Sbjct  470  IILAALG  476



>ref|XP_001764841.1| variable substrate [Physcomitrella patens]
 gb|EDQ70283.1| variable substrate [Physcomitrella patens]
Length=492

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + V  V++ I II+ R KPL AY+FT NK++E+  V ++S+GG+++NDT +H     LPF
Sbjct  363  IKVKGVQEAIDIISDRPKPLVAYVFTKNKEVEKRIVASISSGGMVVNDTIVHFLNPGLPF  422

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG  SYHGKFSF+AFSHKKAVL R+  GD+ AR+PP+T  K    RA+M G+ + 
Sbjct  423  GGVGESGMSSYHGKFSFDAFSHKKAVLYRNNLGDVPARFPPFTTMKQNFRRAIMDGHYLS  482

Query  363  IIRALLGL  386
             + +L GL
Sbjct  483  AVISLTGL  490



>ref|XP_003539464.1| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Glycine 
max]
Length=494

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED IK IN+R KPLA Y+FT N+ L++  ++  S+G + IND  L  AV T+PF
Sbjct  355  ITVEKIEDSIKFINSRPKPLALYVFTKNQTLQRRMISETSSGSVTINDAILQYAVDTVPF  414

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  338
            GGVGESG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  415  GGVGESGFGMYHGKFSFDTFSHQKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  466



>ref|XP_004173349.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cucumis 
sativus]
Length=143

 Score =   131 bits (330),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            ++K+ED I  IN+R KPLA Y FT +K  ++  V+  ++G L  ND  +  AV TLPFGG
Sbjct  15   MDKIEDSIDFINSRPKPLAIYAFTKDKAFQRRLVSETTSGSLTFNDAIIQYAVDTLPFGG  74

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  368
            VGESG G YHGKFSF+ FSH+KA++KRS   D   RYPP+   K +LLR   + N   ++
Sbjct  75   VGESGIGRYHGKFSFDTFSHEKAIVKRSLLIDFWFRYPPWNNHKLQLLRHAYNFNYFQLV  134

Query  369  RALLGL  386
              +LGL
Sbjct  135  LTVLGL  140



>gb|KHN21904.1| Aldehyde dehydrogenase family 3 member F1 [Glycine soja]
Length=446

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED IK INAR KPLA Y+FT N  L++  ++  S+G + IND  L  A  T+PF
Sbjct  307  ITVEKIEDSIKFINARPKPLALYVFTKNHTLQRRMISETSSGSVTINDAVLQYAADTIPF  366

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  338
            GGVGESG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  367  GGVGESGFGMYHGKFSFDTFSHQKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  418



>ref|XP_003539064.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Glycine 
max]
Length=494

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED IK INAR KPLA Y+FT N  L++  ++  S+G + IND  L  A  T+PF
Sbjct  355  ITVEKIEDSIKFINARPKPLALYVFTKNHTLQRRMISETSSGSVTINDAVLQYAADTIPF  414

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  338
            GGVGESG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  415  GGVGESGFGMYHGKFSFDTFSHQKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  466



>gb|KHN25245.1| Aldehyde dehydrogenase family 3 member F1 [Glycine soja]
Length=396

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            V K+ED IK IN+R KPLA Y+FT N+ L++  ++  S+G + IND  L  AV T+PFGG
Sbjct  259  VEKIEDSIKFINSRPKPLALYVFTKNQTLQRRMISETSSGSVTINDAILQYAVDTVPFGG  318

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  338
            VGESG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  319  VGESGFGMYHGKFSFDTFSHQKAIVRRSFLTDFWYRYPPWTLNKLQLLEV  368



>ref|XP_004486968.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cicer 
arietinum]
Length=494

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+ K+EDGIK I ++ KPLA Y+FT +K L++  V+  S+G ++ ND  +  AV TLPF
Sbjct  355  ITLEKIEDGIKFIKSKPKPLAIYVFTKSKTLQRRMVSETSSGSIVFNDAIIQYAVDTLPF  414

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G YHGKFSF+ FSH KAV +RSF  D   R+PP+T +K +LL    + + I 
Sbjct  415  GGVGESGLGRYHGKFSFDTFSHHKAVARRSFYTDFWFRFPPWTLEKFQLLEEAYNLDYIG  474

Query  363  IIRALLGL  386
            I  A+LGL
Sbjct  475  IPLAILGL  482



>ref|XP_007132014.1| hypothetical protein PHAVU_011G059400g [Phaseolus vulgaris]
 gb|ESW04008.1| hypothetical protein PHAVU_011G059400g [Phaseolus vulgaris]
Length=492

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED IK I++R KPLA Y+F+ NK LE+  V+  S+G L  ND  +  A  TLPF
Sbjct  353  ITVEKIEDSIKFISSRPKPLALYVFSRNKTLERRMVSETSSGSLTFNDAIVQYAADTLPF  412

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  338
            GGVGESG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+T  K +LL  
Sbjct  413  GGVGESGFGMYHGKFSFDTFSHQKAIVRRSFLTDFWFRYPPWTLNKLQLLEV  464



>gb|KCW51186.1| hypothetical protein EUGRSUZ_J00772 [Eucalyptus grandis]
Length=495

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+NK+ED I+ IN+R KPLA Y+FT ++ L +  V+  S+G ++ ND  +   V TLPF
Sbjct  358  VTLNKIEDSIEFINSRPKPLAIYVFTKDEPLRRSMVSKTSSGSIVFNDAIVQCLVDTLPF  417

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GG+GESG G YHGKFSF+ FSH+KAV++RSF  D+  R+PP+   K +L R+    + + 
Sbjct  418  GGIGESGMGRYHGKFSFDTFSHQKAVMRRSFLVDVWFRFPPWNDHKLQLFRSSYHYDYLG  477

Query  363  IIRALLGL  386
            I+  +LGL
Sbjct  478  IVLTVLGL  485



>ref|XP_010034106.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=503

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+NK+ED I+ IN+R KPLA Y+FT ++ L +  V+  S+G ++ ND  +   V TLPF
Sbjct  366  VTLNKIEDSIEFINSRPKPLAIYVFTKDEPLRRSMVSKTSSGSIVFNDAIVQCLVDTLPF  425

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GG+GESG G YHGKFSF+ FSH+KAV++RSF  D+  R+PP+   K +L R+    + + 
Sbjct  426  GGIGESGMGRYHGKFSFDTFSHQKAVMRRSFLVDVWFRFPPWNDHKLQLFRSSYHYDYLG  485

Query  363  IIRALLGL  386
            I+  +LGL
Sbjct  486  IVLTVLGL  493



>ref|XP_004977224.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 
X2 [Setaria italica]
Length=482

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV+K+ +   +IN+  KPLAAYLF+ + KL+ +F  N+SAGG++ NDT++H+    LPF
Sbjct  351  ITVDKIHESFALINSMSKPLAAYLFSKDSKLKHQFERNVSAGGMVFNDTSIHLTNQHLPF  410

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG GSYHG FSF+AF+HKKAVL RSF G+  ARYPPYTP K ++L+ ++ GN + 
Sbjct  411  GGVGESGVGSYHGTFSFDAFAHKKAVLDRSFLGEAKARYPPYTPGKLKILKGVLKGNPLA  470

Query  363  IIRALLGL  386
            +++A +G 
Sbjct  471  MVQAAVGC  478



>ref|XP_008449722.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cucumis 
melo]
Length=481

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            ++K+ED I  IN+R KPLA Y FT +K  ++  V+  ++G L  ND  +  AV TLPFGG
Sbjct  353  MDKIEDSIDFINSRAKPLAIYAFTKDKAFQRRLVSETTSGSLTFNDAIIQYAVDTLPFGG  412

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  368
            VGESG G YHGKFSF+ FSH+KAV+KRSF  D   RYPP+   K  LLR   + N   ++
Sbjct  413  VGESGIGRYHGKFSFDTFSHEKAVVKRSFLIDFWFRYPPWNNHKLELLRHAYNFNYFQLV  472

Query  369  RALLGL  386
              +LGL
Sbjct  473  LTVLGL  478



>ref|XP_004507095.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Cicer 
arietinum]
Length=488

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED I+ I+ R KPLA Y+FT N+ L++  ++  S+G ++ ND  L  A  +LPF
Sbjct  351  ITVEKIEDSIEFISCRPKPLALYVFTKNQTLQKRMISETSSGSVVFNDAILQYAADSLPF  410

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  338
            GGVGESG G YHGKFSF+ FSH+KA+++RSF  D   RYPP+ P K +LL  
Sbjct  411  GGVGESGFGMYHGKFSFDTFSHQKAIVRRSFFTDFWYRYPPWKPHKFQLLEV  462



>ref|WP_012163534.1| aldehyde dehydrogenase [Acaryochloris marina]
 gb|ABW28106.1| aldehyde dehydrogenase family protein [Acaryochloris marina MBIC11017]
Length=462

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT N +++ I  +NAR KPLA Y F+ N+  +Q+ +T+ S+GG  IN+T LHV V TLPF
Sbjct  347  LTYNTLDEAIAQVNARPKPLALYFFSKNEDKQQQVLTSTSSGGACINETVLHVGVGTLPF  406

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSG  350
            GGVG SG GSYHGK SF+ FSH+K+VLKR+F  DLG RY PYT K    ++ +++G
Sbjct  407  GGVGPSGMGSYHGKASFDTFSHQKSVLKRAFWLDLGWRYAPYTVKGLNQVKRIVTG  462



>ref|XP_010673629.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Beta 
vulgaris subsp. vulgaris]
Length=483

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 83/128 (65%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+  +E  I+ IN+R KPL  Y FT+N K  +   +  S+G +L NDT +  A  T+PF
Sbjct  346  ITLENIEGSIEFINSRSKPLVIYCFTNNNKFMKRVSSETSSGAVLFNDTIVQYAADTIPF  405

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G YHGKF+F+AFSH+K ++KR    D   R+PP+T KK  LLRA  S N   
Sbjct  406  GGVGESGFGRYHGKFTFDAFSHEKPIVKRDLFPDFWFRFPPWTSKKLELLRAAFSYNYFL  465

Query  363  IIRALLGL  386
            I+  +LGL
Sbjct  466  IVLIVLGL  473



>gb|AFK41010.1| unknown [Lotus japonicus]
Length=293

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T++K+ED +  IN+  KPLA Y+FT NK L+   ++  S+G L+ ND+ L  A  TLPF
Sbjct  155  ITLDKIEDSVNFINSMPKPLALYVFTKNKTLQNRMISETSSGSLMFNDSMLQYAADTLPF  214

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRA  338
            GGVGESG G YHGKFSF+ FSH K +++RS+  D   RYPP+T  K +LL  
Sbjct  215  GGVGESGFGMYHGKFSFDTFSHHKGIVRRSYLTDFWYRYPPWTLNKFQLLEV  266



>gb|KGN54173.1| hypothetical protein Csa_4G291370 [Cucumis sativus]
Length=481

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            ++K+ED I  IN+R KPLA Y FT +K  ++  V+  ++G L  ND  +  AV TLPFGG
Sbjct  353  MDKIEDSIDFINSRPKPLAIYAFTKDKAFQRRLVSETTSGSLTFNDAIIQYAVDTLPFGG  412

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  368
            VGESG G YHGKFSF+ FSH+KA++KRS   D   RYPP+   K +LLR   + N   ++
Sbjct  413  VGESGIGRYHGKFSFDTFSHEKAIVKRSLLIDFWFRYPPWNNHKLQLLRHAYNFNYFQLV  472

Query  369  RALLGL  386
              +LGL
Sbjct  473  LTVLGL  478



>ref|XP_010031796.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
 gb|KCW51187.1| hypothetical protein EUGRSUZ_J00773 [Eucalyptus grandis]
Length=495

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+NK+ED I+ IN+R KPLA Y+FT ++ L +  V+  S+G ++ ND  +     TLPF
Sbjct  358  VTLNKIEDSIEFINSRPKPLAIYVFTKDEPLRRSMVSKTSSGSIVFNDAIIQYLADTLPF  417

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GG+GESG G YHGKFSF+ FSH+KAV++RSF  D   R+PP+   K +L R+    + + 
Sbjct  418  GGIGESGMGRYHGKFSFDTFSHQKAVVRRSFLVDFWFRFPPWNDHKLQLFRSSYHYDYLG  477

Query  363  IIRALLGL  386
            I+  +LGL
Sbjct  478  IVLTVLGL  485



>ref|XP_010034275.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Eucalyptus 
grandis]
Length=461

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+NK+ED I+ IN+R KPLA Y+FT ++ L +  V+  S+G ++ ND  +     TLPF
Sbjct  323  VTLNKIEDSIEFINSRPKPLAIYVFTKDEPLRRSMVSKTSSGSIVFNDAIVQYLADTLPF  382

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GG+GESG G YHGKFSF+ FSH+KAV++RSF  D   R+PP+   K +L R+    + + 
Sbjct  383  GGIGESGMGRYHGKFSFDTFSHQKAVVRRSFLVDFWFRFPPWNDHKLQLFRSSYHYDYLG  442

Query  363  IIRALLGL  386
            I+  +LGL
Sbjct  443  IVLTVLGL  450



>gb|KCW51189.1| hypothetical protein EUGRSUZ_J00776 [Eucalyptus grandis]
Length=479

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T+NK+ED I+ IN+R KPLA Y+FT ++ L +  V+  S+G ++ ND  +     TLPF
Sbjct  341  VTLNKIEDSIEFINSRPKPLAIYVFTKDEPLRRSMVSKTSSGSIVFNDAIVQYLADTLPF  400

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GG+GESG G YHGKFSF+ FSH+KAV++RSF  D   R+PP+   K +L R+    + + 
Sbjct  401  GGIGESGMGRYHGKFSFDTFSHQKAVVRRSFLVDFWFRFPPWNDHKLQLFRSSYHYDYLG  460

Query  363  IIRALLGL  386
            I+  +LGL
Sbjct  461  IVLTVLGL  468



>ref|XP_001655924.1| AAEL012161-PA [Aedes aegypti]
 gb|EAT35689.1| AAEL012161-PA [Aedes aegypti]
Length=200

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 81/118 (69%), Gaps = 4/118 (3%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            + V+   D I+ IN+R+KPLA Y+F+ NK  ++E VTN ++GG+ INDT +H AV TLPF
Sbjct  47   INVDNAYDAIRFINSRNKPLALYIFSKNKTDQKELVTNTTSGGVCINDTMMHCAVETLPF  106

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSF---GGDLG-ARYPPYTPKKARLLRALM  344
            GGVG SG G+YHGK+SF+ F H+K+ L + F   G  L  +RYPPY+  K   L  L+
Sbjct  107  GGVGPSGMGAYHGKYSFDTFVHRKSCLAKDFNPIGEKLASSRYPPYSDSKLSFLTTLL  164



>ref|XP_004142118.1| PREDICTED: LOW QUALITY PROTEIN: aldehyde dehydrogenase family 
3 member F1-like [Cucumis sativus]
Length=479

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 83/126 (66%), Gaps = 0/126 (0%)
 Frame = +3

Query  9    VNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGG  188
            ++K+ED I  IN+R KPLA Y FT +K  ++  V+  ++G L  ND  +  AV TLPFGG
Sbjct  351  MDKIEDSIDFINSRPKPLAIYAFTKDKAFQRRLVSETTSGSLTFNDAIIQYAVDTLPFGG  410

Query  189  VGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIFII  368
            VGESG G YHGKFSF+ FSH+KA++KRS   D   RYPP+   K +LLR   + N   ++
Sbjct  411  VGESGIGRYHGKFSFDTFSHEKAIVKRSLLIDFWFRYPPWNNHKLQLLRHAYNFNYFQLV  470

Query  369  RALLGL  386
              +LGL
Sbjct  471  LTVLGL  476



>ref|WP_010474036.1| aldehyde dehydrogenase [Acaryochloris sp. CCMEE 5410]
Length=462

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT + +++ I  +NAR KPLA Y F+ N+  +Q+ +T+ S+GG  IN+T LHV V TLPF
Sbjct  347  LTYSTLDEAIAQVNARPKPLALYFFSKNEDKQQQVLTSTSSGGACINETVLHVGVGTLPF  406

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSG  350
            GGVG SG GSYHGK SF+ FSH+K+VLKR+F  DLG RY PYT K    ++ +++G
Sbjct  407  GGVGPSGMGSYHGKASFDTFSHQKSVLKRAFWLDLGWRYAPYTVKGLNQVKRIVTG  462



>ref|XP_007150367.1| hypothetical protein PHAVU_005G147600g [Phaseolus vulgaris]
 gb|ESW22361.1| hypothetical protein PHAVU_005G147600g [Phaseolus vulgaris]
Length=490

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED I+ IN+R KPLA Y FT NK L +  ++  S+G L+ ND  L   V TLPF
Sbjct  355  ITVEKIEDSIEFINSRPKPLAIYAFTKNKTLHKRLLSETSSGSLVFNDAILQYVVDTLPF  414

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLR  335
            GGVGE G G YHGKFSF+AFSH KAV +RS+  D   R+PP+T  K +LL 
Sbjct  415  GGVGECGFGKYHGKFSFDAFSHHKAVARRSYFTDFWYRFPPWTLNKLQLLE  465



>ref|WP_015160249.1| NAD-dependent aldehyde dehydrogenase [Chamaesiphon minutus]
 gb|AFY94107.1| NAD-dependent aldehyde dehydrogenase [Chamaesiphon minutus PCC 
6605]
Length=462

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            LT + +E+ I  +NAR KPLA Y F+ +++ ++  +   S+GG+ INDT + V V+TLPF
Sbjct  347  LTYDTLEEAIDRVNARPKPLALYFFSHDRQKQERILQATSSGGVCINDTVMQVGVNTLPF  406

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSG  350
            GGVGESG GSYHGK SF  FSH K++L+R F  DLG RY PYT +K + L+ +++G
Sbjct  407  GGVGESGIGSYHGKASFNTFSHFKSILRREFWLDLGWRYAPYTAQKLKQLKGIVTG  462



>ref|XP_003569983.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Brachypodium 
distachyon]
Length=485

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED I+ +N++ KPLA Y FT N+KL++  +   S+G +  ND  +   + +LPF
Sbjct  355  ITVRKIEDSIEFVNSKPKPLAIYAFTGNEKLKERIIKETSSGSVTFNDAIVQYGLESLPF  414

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GG+G+SG G YHGK+SFE FSHKKAVLKRSF  +   RYPP+   K  +LR +   + + 
Sbjct  415  GGIGQSGFGQYHGKYSFEMFSHKKAVLKRSFLIEFMFRYPPWDGSKLGMLRHVFRYDYVS  474

Query  363  IIRALLGL  386
            +  ALLGL
Sbjct  475  LFLALLGL  482



>gb|EAZ31491.1| hypothetical protein OsJ_15627 [Oryza sativa Japonica Group]
Length=363

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED I  + AR +PLA Y FT N  L +  V   S+G +  ND  +   + +LPF
Sbjct  234  ITVKKIEDSIAFVRARPRPLAVYAFTKNAALRRRIVEETSSGSVTFNDAVVQYGIDSLPF  293

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G YHGK+SFE FSHKKAVL R +  +L ARYPP+   K  ++R L   N + 
Sbjct  294  GGVGESGFGQYHGKYSFEMFSHKKAVLTRGYLIELTARYPPWDDSKISMMRQLYRYNYVG  353

Query  363  IIRALLGL  386
             +   LGL
Sbjct  354  FVLTFLGL  361



>ref|XP_004228361.2| PREDICTED: aldehyde dehydrogenase family 3 member F1 [Solanum 
lycopersicum]
Length=500

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T++K+ED I+ INAR KPL  Y FT N++ +++     S+G L+ NDT +  A  TLPF
Sbjct  370  ITLDKIEDSIEFINARPKPLTIYAFTKNEEFKRKITKGTSSGSLVFNDTIIQYAADTLPF  429

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G YHGKFSF+ FSH+KA+ +RSF  D+  RYPP++    +L R+    + + 
Sbjct  430  GGVGQSGFGRYHGKFSFDTFSHEKAIARRSFLTDIWFRYPPWSDHTLQLFRSAFIYDYLS  489

Query  363  IIRALLGL  386
            ++   LGL
Sbjct  490  VVLITLGL  497



>gb|EFA72146.1| hypothetical protein CRD_02669 [Raphidiopsis brookii D9]
Length=153

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = +3

Query  18   VEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPFGGVGE  197
            +++ I+IIN++ KPLA YLF+ NKKL+++ +TN S+G + INDT + VAV +LPFGGVG+
Sbjct  44   IQEAIEIINSQPKPLALYLFSENKKLQEQVLTNTSSGTVCINDTIIQVAVSSLPFGGVGD  103

Query  198  SGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRAL  341
            SG GSYHGK  F+ FSH K+VL   F  DL  RY PY  K + L + +
Sbjct  104  SGMGSYHGKVGFDTFSHHKSVLYNGFRLDLNWRYAPYLGKMSTLKKII  151



>ref|XP_010317521.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Solanum 
lycopersicum]
Length=398

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 85/128 (66%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T++K+ED I+ INAR KPL  Y FT N++ +++     S+G L+ NDT +  A  TLPF
Sbjct  268  ITLDKIEDSIEFINARPKPLTIYAFTKNEEFKRKITKRTSSGSLVFNDTIIQYATDTLPF  327

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G YHGKFSF+ FSH+KA+ KRSF  D+  RY P++    +L R+    + I 
Sbjct  328  GGVGQSGFGRYHGKFSFDTFSHEKAIAKRSFLTDIWFRYSPWSDHTLQLFRSAFIYDYIS  387

Query  363  IIRALLGL  386
            ++   LGL
Sbjct  388  VVLITLGL  395



>ref|XP_003597427.1| Aldehyde dehydrogenase family 3 member F1 [Medicago truncatula]
 gb|AES67678.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=506

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDGI+ IN++ KPLA Y FT N  L++  V+  S+G ++ ND  L     T+PF
Sbjct  367  ITVEKIEDGIEFINSKPKPLAIYAFTKNNTLQRRLVSETSSGSIVFNDAILQYIADTIPF  426

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGE G G YHGKFSF+AFSH KAV +RS+  D   R+PP+   K +LL      N   
Sbjct  427  GGVGECGFGKYHGKFSFDAFSHHKAVARRSYYTDFWFRFPPWNLNKFQLLEEAYHLNYTG  486

Query  363  IIRALLGL  386
            I+  L+GL
Sbjct  487  ILLVLIGL  494



>gb|KEH39462.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=471

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 82/128 (64%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+EDGI+ IN++ KPLA Y FT N  L++  V+  S+G ++ ND  L     T+PF
Sbjct  332  ITVEKIEDGIEFINSKPKPLAIYAFTKNNTLQRRLVSETSSGSIVFNDAILQYIADTIPF  391

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGE G G YHGKFSF+AFSH KAV +RS+  D   R+PP+   K +LL      N   
Sbjct  392  GGVGECGFGKYHGKFSFDAFSHHKAVARRSYYTDFWFRFPPWNLNKFQLLEEAYHLNYTG  451

Query  363  IIRALLGL  386
            I+  L+GL
Sbjct  452  ILLVLIGL  459



>ref|XP_009768441.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Nicotiana 
sylvestris]
Length=481

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T++K+ED I+ INAR K L  Y FT ++ L+++ ++  S+G ++ NDT +  AV TLPF
Sbjct  351  ITLDKIEDSIEFINARPKTLTIYAFTKDEALKKKIISRTSSGSVVFNDTIIQYAVDTLPF  410

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G YHGKFSF+ FSH+K V +RSF  D+  RYPP+  K  +L R+    + + 
Sbjct  411  GGVGQSGFGRYHGKFSFDTFSHEKTVARRSFLTDIWFRYPPWNNKSLQLFRSAYRYDYLS  470

Query  363  IIRALLGL  386
            ++   LGL
Sbjct  471  VVLITLGL  478



>ref|XP_006345274.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Solanum 
tuberosum]
Length=495

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +T++K+ED I+ INAR KPL  Y FT N++ +++     S+G L+ NDT +  A  TLPF
Sbjct  365  ITLDKIEDSIEFINARPKPLTIYAFTKNEEFKRKITKGTSSGSLVFNDTIIQYAADTLPF  424

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVG+SG G YHGKFSF+ FSH+KA+ +RSF  D+  RYPP++    +L ++    + + 
Sbjct  425  GGVGQSGFGRYHGKFSFDTFSHEKAIARRSFLTDIWFRYPPWSDHTLQLFKSAFIYDYLS  484

Query  363  IIRALLGL  386
            I+   LGL
Sbjct  485  IVLITLGL  492



>ref|XP_006652592.1| PREDICTED: aldehyde dehydrogenase family 3 member F1-like [Oryza 
brachyantha]
Length=497

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED I  + AR +PLA Y FT N  L +  V   S+G +  ND  +   + +LPF
Sbjct  368  ITVKKIEDSIAFVRARPRPLAVYAFTKNAALRRRIVEETSSGSVTFNDAVVQYGIDSLPF  427

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G YHGK+SFE FSHKKAVL R +  +L ARYPP+   K  ++R L   N + 
Sbjct  428  GGVGESGFGQYHGKYSFEMFSHKKAVLTRGYLIELTARYPPWDDSKISMMRQLYRYNYVG  487

Query  363  IIRALLGL  386
             +   LGL
Sbjct  488  FVLTFLGL  495



>ref|NP_001053442.1| Os04g0540600 [Oryza sativa Japonica Group]
 gb|AAQ04829.1|AF464932_1 aldehyde dehydrogenase [Oryza sativa Indica Group]
 emb|CAE02788.2| OSJNBa0011L07.12 [Oryza sativa Japonica Group]
 dbj|BAF15356.1| Os04g0540600 [Oryza sativa Japonica Group]
 emb|CAH67394.1| H0115B09.6 [Oryza sativa Indica Group]
 dbj|BAG92350.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77724.1| hypothetical protein OsI_16819 [Oryza sativa Indica Group]
Length=499

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = +3

Query  3    LTVNKVEDGIKIINARDKPLAAYLFTSNKKLEQEFVTNLSAGGLLINDTALHVAVHTLPF  182
            +TV K+ED I  + AR +PLA Y FT N  L +  V   S+G +  ND  +   + +LPF
Sbjct  370  ITVKKIEDSIAFVRARPRPLAVYAFTKNAALRRRIVEETSSGSVTFNDAVVQYGIDSLPF  429

Query  183  GGVGESGTGSYHGKFSFEAFSHKKAVLKRSFGGDLGARYPPYTPKKARLLRALMSGNLIF  362
            GGVGESG G YHGK+SFE FSHKKAVL R +  +L ARYPP+   K  ++R L   N + 
Sbjct  430  GGVGESGFGQYHGKYSFEMFSHKKAVLTRGYLIELTARYPPWDDSKISMMRQLYRYNYVG  489

Query  363  IIRALLGL  386
             +   LGL
Sbjct  490  FVLTFLGL  497



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325