BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN032M18

Length=635
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004250094.1|  PREDICTED: zinc finger CCCH domain-containin...    281   2e-89   Solanum lycopersicum
ref|XP_009611378.1|  PREDICTED: zinc finger CCCH domain-containin...    280   1e-88   Nicotiana tomentosiformis
ref|XP_009611374.1|  PREDICTED: zinc finger CCCH domain-containin...    280   2e-88   Nicotiana tomentosiformis
ref|XP_009611379.1|  PREDICTED: zinc finger CCCH domain-containin...    279   2e-88   Nicotiana tomentosiformis
ref|XP_009611380.1|  PREDICTED: zinc finger CCCH domain-containin...    279   2e-88   Nicotiana tomentosiformis
ref|XP_009793876.1|  PREDICTED: zinc finger CCCH domain-containin...    278   6e-88   Nicotiana sylvestris
ref|XP_006353234.1|  PREDICTED: zinc finger CCCH domain-containin...    275   4e-87   Solanum tuberosum [potatoes]
ref|XP_008218439.1|  PREDICTED: zinc finger CCCH domain-containin...    269   1e-84   Prunus mume [ume]
ref|XP_007205202.1|  hypothetical protein PRUPE_ppa005813mg             269   2e-84   Prunus persica
ref|XP_002512627.1|  nucleic acid binding protein, putative             269   2e-84   Ricinus communis
ref|XP_004302155.1|  PREDICTED: zinc finger CCCH domain-containin...    266   2e-83   Fragaria vesca subsp. vesca
ref|XP_002278934.2|  PREDICTED: zinc finger CCCH domain-containin...    265   4e-83   Vitis vinifera
ref|XP_009626545.1|  PREDICTED: zinc finger CCCH domain-containin...    260   3e-82   Nicotiana tomentosiformis
ref|XP_009769505.1|  PREDICTED: zinc finger CCCH domain-containin...    260   3e-82   Nicotiana sylvestris
gb|KDP23293.1|  hypothetical protein JCGZ_23126                         263   4e-82   Jatropha curcas
gb|KHN29278.1|  Zinc finger CCCH domain-containing protein ZFN-like     256   1e-81   Glycine soja [wild soybean]
ref|XP_009769504.1|  PREDICTED: zinc finger CCCH domain-containin...    259   1e-81   Nicotiana sylvestris
ref|XP_009769503.1|  PREDICTED: zinc finger CCCH domain-containin...    260   1e-81   Nicotiana sylvestris
ref|XP_009626544.1|  PREDICTED: zinc finger CCCH domain-containin...    259   1e-81   
ref|XP_009769498.1|  PREDICTED: zinc finger CCCH domain-containin...    261   2e-81   Nicotiana sylvestris
ref|XP_006480414.1|  PREDICTED: zinc finger CCCH domain-containin...    260   2e-81   
ref|XP_009626543.1|  PREDICTED: zinc finger CCCH domain-containin...    259   3e-81   
ref|XP_009626542.1|  PREDICTED: zinc finger CCCH domain-containin...    260   3e-81   Nicotiana tomentosiformis
ref|XP_006428579.1|  hypothetical protein CICLE_v10011741mg             259   1e-80   
ref|XP_006428577.1|  hypothetical protein CICLE_v10011741mg             258   1e-80   
ref|XP_011015459.1|  PREDICTED: zinc finger CCCH domain-containin...    258   1e-80   Populus euphratica
ref|XP_011014133.1|  PREDICTED: zinc finger CCCH domain-containin...    258   2e-80   Populus euphratica
ref|XP_008359919.1|  PREDICTED: zinc finger CCCH domain-containin...    258   3e-80   Malus domestica [apple tree]
ref|XP_008359920.1|  PREDICTED: zinc finger CCCH domain-containin...    258   3e-80   Malus domestica [apple tree]
ref|XP_011014371.1|  PREDICTED: zinc finger CCCH domain-containin...    257   9e-80   Populus euphratica
ref|XP_002325901.2|  zinc finger family protein                         257   1e-79   
ref|XP_010111067.1|  Zinc finger CCCH domain-containing protein Z...    255   2e-79   
ref|XP_003534518.1|  PREDICTED: zinc finger CCCH domain-containin...    254   6e-79   Glycine max [soybeans]
ref|XP_011084651.1|  PREDICTED: zinc finger CCCH domain-containin...    254   7e-79   
ref|XP_006587810.1|  PREDICTED: zinc finger CCCH domain-containin...    254   8e-79   Glycine max [soybeans]
gb|EYU39704.1|  hypothetical protein MIMGU_mgv1a0076882mg               253   1e-78   Erythranthe guttata [common monkey flower]
ref|XP_008355849.1|  PREDICTED: zinc finger CCCH domain-containin...    254   1e-78   
emb|CBI17647.3|  unnamed protein product                                247   1e-77   Vitis vinifera
emb|CDP04213.1|  unnamed protein product                                249   2e-77   Coffea canephora [robusta coffee]
ref|XP_007139733.1|  hypothetical protein PHAVU_008G054800g             249   2e-77   Phaseolus vulgaris [French bean]
gb|KHN40466.1|  Zinc finger CCCH domain-containing protein ZFN-like     248   2e-77   Glycine soja [wild soybean]
ref|XP_007139732.1|  hypothetical protein PHAVU_008G054800g             250   2e-77   Phaseolus vulgaris [French bean]
ref|XP_009338000.1|  PREDICTED: zinc finger CCCH domain-containin...    249   7e-77   Pyrus x bretschneideri [bai li]
ref|XP_009337999.1|  PREDICTED: zinc finger CCCH domain-containin...    249   7e-77   Pyrus x bretschneideri [bai li]
ref|XP_006602842.1|  PREDICTED: zinc finger CCCH domain-containin...    246   9e-76   
ref|XP_007029392.1|  Zinc finger CCCH domain-containing protein 3...    245   2e-75   
ref|XP_007143976.1|  hypothetical protein PHAVU_007G118500g             245   2e-75   Phaseolus vulgaris [French bean]
ref|XP_007029391.1|  Zinc finger CCCH domain-containing protein 3...    245   3e-75   Theobroma cacao [chocolate]
gb|KJB82176.1|  hypothetical protein B456_013G179800                    242   1e-74   Gossypium raimondii
gb|KJB75170.1|  hypothetical protein B456_012G028600                    241   2e-74   Gossypium raimondii
gb|KJB75168.1|  hypothetical protein B456_012G028600                    242   5e-74   Gossypium raimondii
gb|KJB82177.1|  hypothetical protein B456_013G179800                    242   5e-74   Gossypium raimondii
ref|XP_010038283.1|  PREDICTED: zinc finger CCCH domain-containin...    239   3e-73   Eucalyptus grandis [rose gum]
gb|KHN14776.1|  Zinc finger CCCH domain-containing protein ZFN-like     238   7e-73   Glycine soja [wild soybean]
ref|XP_003536159.1|  PREDICTED: zinc finger CCCH domain-containin...    238   1e-72   Glycine max [soybeans]
ref|XP_008443710.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    238   2e-72   
gb|KEH23393.1|  zinc finger CCCH domain protein                         237   2e-72   Medicago truncatula
ref|XP_003624157.1|  Zinc finger CCCH domain-containing protein         237   2e-72   Medicago truncatula
gb|ABD28369.2|  Zinc finger, CCCH-type; Sugar transporter superfa...    237   2e-72   Medicago truncatula
ref|XP_006606434.1|  PREDICTED: zinc finger CCCH domain-containin...    235   3e-72   Glycine max [soybeans]
gb|ACC85690.1|  zinc finger protein                                     236   4e-72   Medicago sativa [alfalfa]
gb|KHN04981.1|  Zinc finger CCCH domain-containing protein ZFN-like     235   1e-71   Glycine soja [wild soybean]
ref|XP_006606433.1|  PREDICTED: zinc finger CCCH domain-containin...    235   2e-71   Glycine max [soybeans]
gb|ADN33845.1|  nucleic acid binding protein                            233   2e-71   Cucumis melo subsp. melo
ref|XP_010673925.1|  PREDICTED: zinc finger CCCH domain-containin...    235   2e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004142565.1|  PREDICTED: zinc finger CCCH domain-containin...    233   3e-71   
gb|KHG30243.1|  Zinc finger CCCH domain-containing protein ZFN-li...    231   5e-71   Gossypium arboreum [tree cotton]
gb|KJB26822.1|  hypothetical protein B456_004G261700                    231   1e-70   Gossypium raimondii
gb|KJB26823.1|  hypothetical protein B456_004G261700                    232   4e-70   Gossypium raimondii
gb|KDO47608.1|  hypothetical protein CISIN_1g0472482mg                  223   1e-69   Citrus sinensis [apfelsine]
sp|Q9SWF9.1|ZFNL_PEA  RecName: Full=Zinc finger CCCH domain-conta...    229   2e-69   Pisum sativum [garden pea]
ref|XP_011077184.1|  PREDICTED: zinc finger CCCH domain-containin...    226   2e-68   Sesamum indicum [beniseed]
ref|XP_006848460.1|  hypothetical protein AMTR_s00013p00248880          228   3e-68   Amborella trichopoda
ref|XP_010673926.1|  PREDICTED: zinc finger CCCH domain-containin...    227   3e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011077187.1|  PREDICTED: zinc finger CCCH domain-containin...    226   4e-68   Sesamum indicum [beniseed]
ref|XP_010245962.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    224   6e-67   
ref|XP_010929828.1|  PREDICTED: zinc finger CCCH domain-containin...    221   1e-66   
gb|KCW84568.1|  hypothetical protein EUGRSUZ_B01407                     221   3e-66   Eucalyptus grandis [rose gum]
ref|XP_010927660.1|  PREDICTED: zinc finger CCCH domain-containin...    223   3e-66   
ref|XP_010929826.1|  PREDICTED: zinc finger CCCH domain-containin...    221   7e-66   
ref|XP_010929827.1|  PREDICTED: zinc finger CCCH domain-containin...    221   7e-66   Elaeis guineensis
ref|XP_010929825.1|  PREDICTED: zinc finger CCCH domain-containin...    221   1e-65   Elaeis guineensis
ref|XP_009420319.1|  PREDICTED: zinc finger CCCH domain-containin...    219   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420318.1|  PREDICTED: zinc finger CCCH domain-containin...    219   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794629.1|  PREDICTED: zinc finger CCCH domain-containin...    221   2e-65   
ref|XP_008812314.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    219   4e-65   Phoenix dactylifera
gb|KHG12066.1|  Zinc finger CCCH domain-containing protein ZFN-li...    217   1e-64   Gossypium arboreum [tree cotton]
ref|XP_004157161.1|  PREDICTED: zinc finger CCCH domain-containin...    208   1e-63   
ref|XP_008810537.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    216   1e-63   
ref|XP_004495537.1|  PREDICTED: zinc finger CCCH domain-containin...    213   2e-63   Cicer arietinum [garbanzo]
ref|XP_009392482.1|  PREDICTED: zinc finger CCCH domain-containin...    211   4e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392481.1|  PREDICTED: zinc finger CCCH domain-containin...    211   4e-63   
ref|XP_009392483.1|  PREDICTED: zinc finger CCCH domain-containin...    211   8e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416576.1|  PREDICTED: zinc finger CCCH domain-containin...    210   2e-62   
ref|XP_010525082.1|  PREDICTED: zinc finger CCCH domain-containin...    211   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_010525081.1|  PREDICTED: zinc finger CCCH domain-containin...    212   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_009416575.1|  PREDICTED: zinc finger CCCH domain-containin...    210   3e-62   
ref|XP_009392477.1|  PREDICTED: zinc finger CCCH domain-containin...    210   3e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416573.1|  PREDICTED: zinc finger CCCH domain-containin...    210   1e-61   
ref|XP_008676804.1|  PREDICTED: hypothetical protein isoform X2         207   4e-61   Zea mays [maize]
ref|XP_008792914.1|  PREDICTED: zinc finger CCCH domain-containin...    208   5e-61   
dbj|BAG99488.1|  unnamed protein product                                202   6e-61   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141157.1|  hypothetical protein                               208   6e-61   Zea mays [maize]
ref|XP_008792915.1|  PREDICTED: zinc finger CCCH domain-containin...    207   7e-61   
ref|XP_008676803.1|  PREDICTED: hypothetical protein isoform X1         207   8e-61   Zea mays [maize]
ref|XP_008792910.1|  PREDICTED: zinc finger CCCH domain-containin...    208   9e-61   
ref|XP_006296584.1|  hypothetical protein CARUB_v100138730mg            203   3e-60   
emb|CDX74233.1|  BnaA03g28140D                                          204   5e-60   
dbj|BAD87736.1|  putative zinc finger protein                           201   1e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006408378.1|  hypothetical protein EUTSA_v10020900mg             202   2e-59   
ref|XP_006408377.1|  hypothetical protein EUTSA_v10020900mg             202   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_006408379.1|  hypothetical protein EUTSA_v10020900mg             202   2e-59   Eutrema salsugineum [saltwater cress]
ref|XP_002882253.1|  hypothetical protein ARALYDRAFT_477525             202   3e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_002450713.1|  hypothetical protein SORBIDRAFT_05g013190          203   5e-59   Sorghum bicolor [broomcorn]
gb|KFK37691.1|  hypothetical protein AALP_AA3G016100                    201   7e-59   Arabis alpina [alpine rockcress]
ref|XP_010501847.1|  PREDICTED: zinc finger CCCH domain-containin...    201   7e-59   Camelina sativa [gold-of-pleasure]
gb|EEE55890.1|  hypothetical protein OsJ_04549                          201   8e-59   Oryza sativa Japonica Group [Japonica rice]
emb|CDY53749.1|  BnaAnng12770D                                          200   1e-58   Brassica napus [oilseed rape]
emb|CDY67901.1|  BnaCnng56860D                                          200   2e-58   Brassica napus [oilseed rape]
ref|XP_009118604.1|  PREDICTED: zinc finger CCCH domain-containin...    200   2e-58   Brassica rapa
gb|EAY76977.1|  hypothetical protein OsI_04935                          201   2e-58   Oryza sativa Indica Group [Indian rice]
emb|CDY28712.1|  BnaCnng05980D                                          200   2e-58   Brassica napus [oilseed rape]
ref|XP_010463709.1|  PREDICTED: zinc finger CCCH domain-containin...    201   2e-58   Camelina sativa [gold-of-pleasure]
ref|NP_001045201.2|  Os01g0917400                                       201   2e-58   
ref|XP_009416574.1|  PREDICTED: zinc finger CCCH domain-containin...    201   2e-58   
gb|AAF26977.1|AC018363_22  zinc finger protein 1 (zfn1)                 199   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566183.1|  zinc finger protein 1                                 200   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ABG22481.1|  Zinc finger CCCH type domain containing protein Z...    200   3e-58   Oryza sativa Japonica Group [Japonica rice]
gb|EMS50271.1|  Zinc finger CCCH domain-containing protein 12           200   3e-58   Triticum urartu
dbj|BAJ99149.1|  predicted protein                                      199   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAD33769.1|AF138743_1  zinc finger protein 1                         200   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006662931.1|  PREDICTED: zinc finger CCCH domain-containin...    200   3e-58   Oryza brachyantha
ref|XP_009134712.1|  PREDICTED: zinc finger CCCH domain-containin...    199   3e-58   Brassica rapa
ref|NP_001067878.1|  Os11g0472000                                       200   4e-58   
gb|ACU21592.1|  Zinc finger protein                                     200   5e-58   Triticum aestivum [Canadian hard winter wheat]
sp|Q2R4J4.2|C3H63_ORYSJ  RecName: Full=Zinc finger CCCH domain-co...    200   5e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009406323.1|  PREDICTED: zinc finger CCCH domain-containin...    199   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ86320.1|  predicted protein                                      200   6e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008389043.1|  PREDICTED: zinc finger CCCH domain-containin...    192   6e-58   
ref|XP_010485612.1|  PREDICTED: zinc finger CCCH domain-containin...    199   7e-58   Camelina sativa [gold-of-pleasure]
ref|XP_003564925.1|  PREDICTED: zinc finger CCCH domain-containin...    199   1e-57   Brachypodium distachyon [annual false brome]
gb|EEE52080.1|  hypothetical protein OsJ_33853                          201   1e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003577562.1|  PREDICTED: zinc finger CCCH domain-containin...    199   1e-57   Brachypodium distachyon [annual false brome]
emb|CDY51531.1|  BnaA05g33310D                                          197   2e-57   Brassica napus [oilseed rape]
ref|XP_006645228.1|  PREDICTED: zinc finger CCCH domain-containin...    197   2e-57   
ref|XP_009382899.1|  PREDICTED: zinc finger CCCH domain-containin...    199   3e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010558591.1|  PREDICTED: zinc finger CCCH domain-containin...    197   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_009147316.1|  PREDICTED: zinc finger CCCH domain-containin...    197   4e-57   Brassica rapa
ref|XP_006663970.1|  PREDICTED: zinc finger CCCH domain-containin...    196   9e-57   Oryza brachyantha
ref|XP_006663969.1|  PREDICTED: zinc finger CCCH domain-containin...    197   1e-56   Oryza brachyantha
ref|XP_004979251.1|  PREDICTED: zinc finger CCCH domain-containin...    196   2e-56   Setaria italica
ref|XP_004979252.1|  PREDICTED: zinc finger CCCH domain-containin...    196   2e-56   
emb|CDX92015.1|  BnaC03g33170D                                          194   3e-56   
ref|NP_001066624.1|  Os12g0405100                                       195   6e-56   
ref|NP_001130819.1|  uncharacterized protein LOC100191923               195   7e-56   Zea mays [maize]
ref|XP_003576637.1|  PREDICTED: zinc finger CCCH domain-containin...    194   1e-55   Brachypodium distachyon [annual false brome]
ref|XP_010237293.1|  PREDICTED: zinc finger CCCH domain-containin...    194   2e-55   Brachypodium distachyon [annual false brome]
ref|XP_010501886.1|  PREDICTED: zinc finger CCCH domain-containin...    192   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009118612.1|  PREDICTED: zinc finger CCCH domain-containin...    191   4e-55   Brassica rapa
ref|XP_010463710.1|  PREDICTED: zinc finger CCCH domain-containin...    192   4e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009134713.1|  PREDICTED: zinc finger CCCH domain-containin...    190   8e-55   Brassica rapa
gb|EEC69137.1|  hypothetical protein OsI_38063                          190   1e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_004971057.1|  PREDICTED: zinc finger CCCH domain-containin...    189   6e-54   Setaria italica
gb|AFW84181.1|  hypothetical protein ZEAMMB73_594165                    185   8e-53   
gb|ACN33948.1|  unknown                                                 185   9e-53   Zea mays [maize]
ref|NP_001150019.1|  zinc finger CCCH type domain-containing prot...    185   2e-52   
gb|ACF82040.1|  unknown                                                 185   2e-52   Zea mays [maize]
ref|NP_001132883.1|  uncharacterized protein LOC100194377               184   9e-52   Zea mays [maize]
gb|ACF80171.1|  unknown                                                 181   1e-51   Zea mays [maize]
ref|XP_006400193.1|  hypothetical protein EUTSA_v10013743mg             182   2e-51   Eutrema salsugineum [saltwater cress]
gb|KFK25872.1|  hypothetical protein AALP_AA8G173100                    181   5e-51   Arabis alpina [alpine rockcress]
tpg|DAA56151.1|  TPA: hypothetical protein ZEAMMB73_608000              181   1e-50   
ref|NP_974790.1|  zinc finger nuclease 3                                177   3e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851041.1|  zinc finger nuclease 3                                178   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|ACN40302.1|  unknown                                                 179   6e-50   Picea sitchensis
ref|XP_010492565.1|  PREDICTED: zinc finger CCCH domain-containin...    175   9e-49   Camelina sativa [gold-of-pleasure]
gb|KCW84570.1|  hypothetical protein EUGRSUZ_B01407                     171   9e-48   Eucalyptus grandis [rose gum]
ref|XP_002871723.1|  hypothetical protein ARALYDRAFT_488510             171   1e-47   
ref|XP_010453818.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    172   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006287837.1|  hypothetical protein CARUB_v10001057mg             171   6e-47   Capsella rubella
gb|KJB75169.1|  hypothetical protein B456_012G028600                    166   9e-46   Gossypium raimondii
ref|NP_568332.2|  zinc finger nuclease 3                                158   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420349.1|  PREDICTED: zinc finger CCCH domain-containin...    157   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_001768387.1|  predicted protein                                  155   7e-42   
ref|XP_002276435.1|  PREDICTED: zinc finger CCCH domain-containin...    156   3e-41   Vitis vinifera
emb|CAN78551.1|  hypothetical protein VITISV_003243                     156   6e-41   Vitis vinifera
ref|XP_010420350.1|  PREDICTED: zinc finger CCCH domain-containin...    152   5e-40   Camelina sativa [gold-of-pleasure]
ref|NP_001078077.1|  zinc finger CCCH domain-containing protein 32      152   8e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880326.1|  zinc finger (CCCH-type) family protein             152   1e-39   Arabidopsis lyrata subsp. lyrata
ref|NP_182306.2|  zinc finger CCCH domain-containing protein 32         152   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294140.1|  hypothetical protein CARUB_v10023134mg             151   2e-39   Capsella rubella
ref|XP_006419655.1|  hypothetical protein CICLE_v10004882mg             151   2e-39   Citrus clementina [clementine]
gb|EYU22370.1|  hypothetical protein MIMGU_mgv1a005385mg                151   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_006294141.1|  hypothetical protein CARUB_v10023134mg             151   3e-39   Capsella rubella
ref|XP_010938478.1|  PREDICTED: zinc finger CCCH domain-containin...    150   3e-39   Elaeis guineensis
ref|XP_007200997.1|  hypothetical protein PRUPE_ppa005229mg             150   4e-39   Prunus persica
ref|XP_006855486.1|  hypothetical protein AMTR_s00057p00193570          150   5e-39   Amborella trichopoda
ref|XP_010652064.1|  PREDICTED: zinc finger CCCH domain-containin...    150   5e-39   Vitis vinifera
ref|XP_006397979.1|  hypothetical protein EUTSA_v10001399mg             150   6e-39   
ref|XP_008796232.1|  PREDICTED: zinc finger CCCH domain-containin...    149   7e-39   Phoenix dactylifera
ref|XP_010921758.1|  PREDICTED: zinc finger CCCH domain-containin...    149   1e-38   Elaeis guineensis
emb|CAN74119.1|  hypothetical protein VITISV_002050                     153   1e-38   Vitis vinifera
ref|XP_011090931.1|  PREDICTED: zinc finger CCCH domain-containin...    149   2e-38   Sesamum indicum [beniseed]
ref|XP_010507789.1|  PREDICTED: zinc finger CCCH domain-containin...    147   2e-38   
ref|XP_008796231.1|  PREDICTED: zinc finger CCCH domain-containin...    148   3e-38   Phoenix dactylifera
ref|XP_009802825.1|  PREDICTED: zinc finger CCCH domain-containin...    147   7e-38   Nicotiana sylvestris
ref|XP_009802826.1|  PREDICTED: zinc finger CCCH domain-containin...    147   8e-38   Nicotiana sylvestris
ref|XP_010523985.1|  PREDICTED: zinc finger CCCH domain-containin...    147   1e-37   Tarenaya hassleriana [spider flower]
ref|XP_008802110.1|  PREDICTED: zinc finger CCCH domain-containin...    146   1e-37   Phoenix dactylifera
ref|XP_010507842.1|  PREDICTED: zinc finger CCCH domain-containin...    146   1e-37   
ref|XP_007035523.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    146   2e-37   
ref|XP_010507840.1|  PREDICTED: zinc finger CCCH domain-containin...    145   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010518502.1|  PREDICTED: zinc finger CCCH domain-containin...    145   2e-37   Camelina sativa [gold-of-pleasure]
gb|EEE54266.1|  hypothetical protein OsJ_01160                          139   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011071464.1|  PREDICTED: zinc finger CCCH domain-containin...    145   3e-37   Sesamum indicum [beniseed]
ref|XP_009378917.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    146   3e-37   Pyrus x bretschneideri [bai li]
gb|AAC63639.1|  unknown protein                                         145   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KDP28101.1|  hypothetical protein JCGZ_13872                         145   4e-37   Jatropha curcas
ref|XP_011077188.1|  PREDICTED: zinc finger CCCH domain-containin...    142   4e-37   
ref|XP_002520668.1|  nucleic acid binding protein, putative             145   4e-37   Ricinus communis
ref|XP_010112757.1|  Zinc finger CCCH domain-containing protein 32      145   5e-37   Morus notabilis
ref|XP_010913061.1|  PREDICTED: zinc finger CCCH domain-containin...    143   6e-37   Elaeis guineensis
emb|CDO98891.1|  unnamed protein product                                145   6e-37   Coffea canephora [robusta coffee]
ref|XP_007050814.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    144   8e-37   Theobroma cacao [chocolate]
ref|XP_011013662.1|  PREDICTED: zinc finger CCCH domain-containin...    144   9e-37   Populus euphratica
ref|XP_004309682.1|  PREDICTED: zinc finger CCCH domain-containin...    144   1e-36   Fragaria vesca subsp. vesca
ref|XP_001752915.1|  predicted protein                                  134   1e-36   
ref|XP_009631342.1|  PREDICTED: zinc finger CCCH domain-containin...    144   1e-36   Nicotiana tomentosiformis
gb|AGT16102.1|  hypothetical protein SHCRBa_134_J05_F_10                142   1e-36   Saccharum hybrid cultivar R570
ref|XP_006644012.1|  PREDICTED: zinc finger CCCH domain-containin...    143   2e-36   Oryza brachyantha
ref|XP_002314462.1|  hypothetical protein POPTR_0010s02320g             143   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_008389190.1|  PREDICTED: zinc finger CCCH domain-containin...    142   2e-36   
gb|KHG04581.1|  hypothetical protein F383_30084                         141   3e-36   Gossypium arboreum [tree cotton]
ref|XP_008235007.1|  PREDICTED: zinc finger CCCH domain-containin...    143   3e-36   Prunus mume [ume]
ref|NP_001042632.2|  Os01g0257400                                       142   4e-36   
ref|XP_010545037.1|  PREDICTED: zinc finger CCCH domain-containin...    142   6e-36   Tarenaya hassleriana [spider flower]
gb|AGT16494.1|  zinc finger CCCH type domain-containing protein         141   6e-36   Saccharum hybrid cultivar R570
ref|XP_010545038.1|  PREDICTED: zinc finger CCCH domain-containin...    141   6e-36   Tarenaya hassleriana [spider flower]
ref|XP_006829498.1|  hypothetical protein AMTR_s00074p00109750          135   9e-36   
gb|KHG22563.1|  hypothetical protein F383_29382                         141   1e-35   Gossypium arboreum [tree cotton]
ref|XP_010241841.1|  PREDICTED: zinc finger CCCH domain-containin...    140   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_006380188.1|  hypothetical protein POPTR_0008s22730g             140   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011018690.1|  PREDICTED: zinc finger CCCH domain-containin...    140   2e-35   Populus euphratica
gb|KHF99697.1|  hypothetical protein F383_18975                         140   3e-35   Gossypium arboreum [tree cotton]
gb|KHG21967.1|  hypothetical protein F383_08187                         139   3e-35   Gossypium arboreum [tree cotton]
ref|XP_009142498.1|  PREDICTED: zinc finger CCCH domain-containin...    139   3e-35   Brassica rapa
emb|CDX80137.1|  BnaA05g00190D                                          139   3e-35   
ref|XP_009142499.1|  PREDICTED: zinc finger CCCH domain-containin...    139   4e-35   Brassica rapa
emb|CDY53022.1|  BnaC04g00080D                                          139   4e-35   Brassica napus [oilseed rape]
gb|KJB47069.1|  hypothetical protein B456_008G009500                    139   6e-35   Gossypium raimondii
ref|XP_004240519.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    138   7e-35   
ref|XP_010270054.1|  PREDICTED: zinc finger CCCH domain-containin...    137   7e-35   Nelumbo nucifera [Indian lotus]
gb|KJB12614.1|  hypothetical protein B456_002G027000                    139   7e-35   Gossypium raimondii
ref|XP_010243539.1|  PREDICTED: zinc finger CCCH domain-containin...    139   8e-35   Nelumbo nucifera [Indian lotus]
ref|XP_006444253.1|  hypothetical protein CICLE_v10019968mg             139   8e-35   Citrus clementina [clementine]
ref|XP_009411695.1|  PREDICTED: zinc finger CCCH domain-containin...    138   9e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007222805.1|  hypothetical protein PRUPE_ppa005056mg             138   1e-34   Prunus persica
gb|KJB22540.1|  hypothetical protein B456_004G053200                    137   1e-34   Gossypium raimondii
ref|XP_010524751.1|  PREDICTED: zinc finger CCCH domain-containin...    138   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_010270053.1|  PREDICTED: zinc finger CCCH domain-containin...    137   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_008672228.1|  PREDICTED: uncharacterized protein LOC100194...    137   2e-34   Zea mays [maize]
ref|XP_003566542.1|  PREDICTED: zinc finger CCCH domain-containin...    137   2e-34   
tpg|DAA53995.1|  TPA: hypothetical protein ZEAMMB73_505725              133   2e-34   
ref|XP_008223126.1|  PREDICTED: zinc finger CCCH domain-containin...    137   2e-34   Prunus mume [ume]
ref|XP_006366678.1|  PREDICTED: zinc finger CCCH domain-containin...    135   3e-34   Solanum tuberosum [potatoes]
ref|XP_004967812.1|  PREDICTED: zinc finger CCCH domain-containin...    137   3e-34   Setaria italica
ref|XP_004967813.1|  PREDICTED: zinc finger CCCH domain-containin...    137   3e-34   
ref|NP_001150792.1|  zinc finger CCCH type domain-containing prot...    136   4e-34   
ref|XP_009776613.1|  PREDICTED: zinc finger CCCH domain-containin...    136   4e-34   Nicotiana sylvestris
ref|XP_010684493.1|  PREDICTED: zinc finger CCCH domain-containin...    136   4e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP40004.1|  hypothetical protein JCGZ_02002                         136   4e-34   Jatropha curcas
ref|XP_008389189.1|  PREDICTED: zinc finger CCCH domain-containin...    137   6e-34   Malus domestica [apple tree]
gb|EEC80695.1|  hypothetical protein OsI_23121                          131   7e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_001752815.1|  predicted protein                                  127   7e-34   
ref|XP_006366677.1|  PREDICTED: zinc finger CCCH domain-containin...    135   8e-34   Solanum tuberosum [potatoes]
gb|KJB23207.1|  hypothetical protein B456_004G086700                    135   9e-34   Gossypium raimondii
gb|KCW58527.1|  hypothetical protein EUGRSUZ_H01196                     135   1e-33   Eucalyptus grandis [rose gum]
gb|KHG22135.1|  hypothetical protein F383_09601                         135   1e-33   Gossypium arboreum [tree cotton]
ref|XP_010069978.1|  PREDICTED: zinc finger CCCH domain-containin...    135   1e-33   Eucalyptus grandis [rose gum]
gb|EMT21637.1|  Zinc finger CCCH domain-containing protein 5            135   1e-33   
ref|XP_010270055.1|  PREDICTED: zinc finger CCCH domain-containin...    134   1e-33   
ref|XP_009588295.1|  PREDICTED: zinc finger CCCH domain-containin...    135   1e-33   
gb|ABR16930.1|  unknown                                                 135   2e-33   
ref|XP_010252578.1|  PREDICTED: zinc finger CCCH domain-containin...    135   2e-33   
ref|XP_009408337.1|  PREDICTED: zinc finger CCCH domain-containin...    135   2e-33   
ref|XP_009408338.1|  PREDICTED: zinc finger CCCH domain-containin...    135   2e-33   
gb|EMS67785.1|  Zinc finger CCCH domain-containing protein 5            135   2e-33   
emb|CDM82689.1|  unnamed protein product                                135   2e-33   
ref|XP_009408339.1|  PREDICTED: zinc finger CCCH domain-containin...    135   2e-33   
gb|KJB23208.1|  hypothetical protein B456_004G086700                    133   2e-33   
dbj|BAK02824.1|  predicted protein                                      134   2e-33   
emb|CDM82679.1|  unnamed protein product                                134   2e-33   
gb|EMT01168.1|  Zinc finger CCCH domain-containing protein 6            134   3e-33   
gb|KJB72632.1|  hypothetical protein B456_011G188400                    134   3e-33   
ref|XP_004169150.1|  PREDICTED: zinc finger CCCH domain-containin...    133   5e-33   
ref|XP_009774842.1|  PREDICTED: zinc finger CCCH domain-containin...    133   6e-33   
ref|XP_008386632.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    133   6e-33   
gb|KJB41978.1|  hypothetical protein B456_007G130500                    133   6e-33   
dbj|BAJ86598.1|  predicted protein                                      133   6e-33   
gb|ACN28458.1|  unknown                                                 133   7e-33   
ref|NP_001147888.1|  zinc finger CCCH type domain-containing prot...    133   7e-33   
ref|XP_003566545.1|  PREDICTED: zinc finger CCCH domain-containin...    133   8e-33   
ref|XP_002511264.1|  nucleic acid binding protein, putative             133   9e-33   
ref|XP_003518955.1|  PREDICTED: zinc finger CCCH domain-containin...    132   1e-32   
ref|XP_008438828.1|  PREDICTED: zinc finger CCCH domain-containin...    132   1e-32   
ref|XP_002516892.1|  nucleic acid binding protein, putative             132   1e-32   
ref|XP_004134198.1|  PREDICTED: zinc finger CCCH domain-containin...    132   1e-32   
gb|KGN57087.1|  hypothetical protein Csa_3G152140                       132   1e-32   
gb|AFW79659.1|  hypothetical protein ZEAMMB73_788382                    131   1e-32   
ref|XP_002457592.1|  hypothetical protein SORBIDRAFT_03g009920          132   1e-32   
ref|XP_006645727.1|  PREDICTED: zinc finger CCCH domain-containin...    131   2e-32   
emb|CDP03533.1|  unnamed protein product                                132   2e-32   
ref|XP_009369128.1|  PREDICTED: zinc finger CCCH domain-containin...    132   2e-32   
ref|XP_009776617.1|  PREDICTED: zinc finger CCCH domain-containin...    130   3e-32   
ref|XP_009339837.1|  PREDICTED: zinc finger CCCH domain-containin...    131   3e-32   
gb|AFW79656.1|  zinc finger CCCH type domain-containing protein Z...    131   4e-32   
ref|XP_006407950.1|  hypothetical protein EUTSA_v10020686mg             129   9e-32   
ref|XP_010666383.1|  PREDICTED: zinc finger CCCH domain-containin...    129   1e-31   
ref|XP_010666382.1|  PREDICTED: zinc finger CCCH domain-containin...    130   1e-31   
ref|XP_004508292.1|  PREDICTED: zinc finger CCCH domain-containin...    129   1e-31   
gb|EAY73369.1|  hypothetical protein OsI_01247                          128   1e-31   
gb|KDO69368.1|  hypothetical protein CISIN_1g033320mg                   122   1e-31   
ref|XP_004495984.1|  PREDICTED: zinc finger CCCH domain-containin...    129   2e-31   
gb|AAT28673.1|  zinc finger protein                                     124   2e-31   
ref|XP_006287665.1|  hypothetical protein CARUB_v10000876mg             129   2e-31   
ref|XP_004495983.1|  PREDICTED: zinc finger CCCH domain-containin...    129   2e-31   
ref|XP_004967811.1|  PREDICTED: zinc finger CCCH domain-containin...    129   3e-31   
ref|XP_006342757.1|  PREDICTED: zinc finger CCCH domain-containin...    129   3e-31   
ref|XP_009626457.1|  PREDICTED: zinc finger CCCH domain-containin...    128   3e-31   
gb|EAZ11305.1|  hypothetical protein OsJ_01167                          127   3e-31   
ref|XP_008340827.1|  PREDICTED: zinc finger CCCH domain-containin...    128   4e-31   
ref|XP_010454104.1|  PREDICTED: zinc finger CCCH domain-containin...    128   4e-31   
ref|XP_006359420.1|  PREDICTED: zinc finger CCCH domain-containin...    128   4e-31   
ref|XP_010454106.1|  PREDICTED: zinc finger CCCH domain-containin...    128   4e-31   
ref|XP_009391577.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    128   4e-31   
ref|XP_006359417.1|  PREDICTED: zinc finger CCCH domain-containin...    128   4e-31   
ref|XP_004229205.1|  PREDICTED: zinc finger CCCH domain-containin...    128   4e-31   
ref|XP_006440013.1|  hypothetical protein CICLE_v10019979mg             124   4e-31   
ref|XP_006407949.1|  hypothetical protein EUTSA_v10020686mg             127   6e-31   
gb|KHG07834.1|  hypothetical protein F383_35307                         127   6e-31   
dbj|BAD81402.1|  putative floral homeotic protein HUA1                  127   6e-31   
ref|XP_003638527.1|  Zinc finger CCCH domain-containing protein         128   6e-31   
ref|NP_001042637.1|  Os01g0258700                                       127   7e-31   
dbj|BAG99345.1|  unnamed protein product                                127   7e-31   
ref|XP_006476951.1|  PREDICTED: zinc finger CCCH domain-containin...    124   8e-31   
ref|XP_002277300.1|  PREDICTED: zinc finger CCCH domain-containin...    127   9e-31   
ref|XP_009418524.1|  PREDICTED: zinc finger CCCH domain-containin...    127   1e-30   
gb|ACN33323.1|  unknown                                                 127   1e-30   
ref|NP_001150480.1|  LOC100284111                                       127   1e-30   
gb|KHN03741.1|  Zinc finger CCCH domain-containing protein 32           127   1e-30   
ref|XP_010546927.1|  PREDICTED: zinc finger CCCH domain-containin...    127   1e-30   
gb|ABR16973.1|  unknown                                                 127   1e-30   
ref|XP_010546925.1|  PREDICTED: zinc finger CCCH domain-containin...    127   1e-30   
ref|XP_003529584.1|  PREDICTED: zinc finger CCCH domain-containin...    126   2e-30   
ref|XP_004247451.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    126   2e-30   
gb|KJB28621.1|  hypothetical protein B456_005G058800                    126   2e-30   
ref|XP_009417930.1|  PREDICTED: zinc finger CCCH domain-containin...    126   2e-30   
ref|XP_010420626.1|  PREDICTED: zinc finger CCCH domain-containin...    125   3e-30   
ref|XP_010420624.1|  PREDICTED: zinc finger CCCH domain-containin...    125   3e-30   
ref|XP_006440011.1|  hypothetical protein CICLE_v10019979mg             125   3e-30   
emb|CDY08054.1|  BnaC03g34690D                                          125   3e-30   
gb|KHN46585.1|  Zinc finger CCCH domain-containing protein 32           125   3e-30   
gb|KDO59559.1|  hypothetical protein CISIN_1g013033mg                   124   3e-30   
ref|XP_003525622.1|  PREDICTED: zinc finger CCCH domain-containin...    125   4e-30   
ref|XP_004296815.1|  PREDICTED: zinc finger CCCH domain-containin...    125   5e-30   
emb|CDX70825.1|  BnaC03g09090D                                          124   5e-30   
ref|XP_007137964.1|  hypothetical protein PHAVU_009G169600g             125   5e-30   
ref|XP_003550189.1|  PREDICTED: zinc finger CCCH domain-containin...    125   5e-30   
ref|XP_003608904.1|  Zinc finger CCCH domain-containing protein         125   5e-30   
ref|XP_009133833.1|  PREDICTED: zinc finger CCCH domain-containin...    125   5e-30   
ref|XP_007144548.1|  hypothetical protein PHAVU_007G165200g             125   5e-30   
ref|XP_006440009.1|  hypothetical protein CICLE_v10019979mg             125   5e-30   
emb|CDX95738.1|  BnaC03g26190D                                          124   6e-30   
ref|XP_006476949.1|  PREDICTED: zinc finger CCCH domain-containin...    125   6e-30   
gb|AGT16495.1|  zinc finger CCCH type domain-containing protein         125   6e-30   
gb|EPS74440.1|  hypothetical protein M569_00316                         124   7e-30   
ref|XP_002457593.1|  hypothetical protein SORBIDRAFT_03g009930          125   7e-30   
ref|XP_003608905.1|  Zinc finger CCCH domain-containing protein         123   7e-30   
ref|NP_001288815.1|  CCCH type zinc finger protein                      124   7e-30   
emb|CDX92600.1|  BnaA10g16390D                                          124   7e-30   
ref|XP_010928414.1|  PREDICTED: zinc finger CCCH domain-containin...    124   8e-30   
gb|KDP30984.1|  hypothetical protein JCGZ_11360                         124   8e-30   
gb|EPS71438.1|  hypothetical protein M569_03319                         124   8e-30   
ref|XP_006440008.1|  hypothetical protein CICLE_v10019979mg             123   9e-30   
ref|XP_007154244.1|  hypothetical protein PHAVU_003G102600g             124   9e-30   
ref|XP_008439243.1|  PREDICTED: zinc finger CCCH domain-containin...    124   9e-30   
gb|EYU44830.1|  hypothetical protein MIMGU_mgv1a007498mg                124   1e-29   
gb|KHN34381.1|  Zinc finger CCCH domain-containing protein 43           124   1e-29   
ref|XP_009129667.1|  PREDICTED: zinc finger CCCH domain-containin...    124   1e-29   
ref|XP_010248777.1|  PREDICTED: zinc finger CCCH domain-containin...    124   1e-29   
ref|XP_009352233.1|  PREDICTED: zinc finger CCCH domain-containin...    124   1e-29   
ref|XP_007155512.1|  hypothetical protein PHAVU_003G207900g             124   1e-29   
ref|XP_010248778.1|  PREDICTED: zinc finger CCCH domain-containin...    124   1e-29   
ref|XP_010098340.1|  Zinc finger CCCH domain-containing protein 58      124   1e-29   
ref|XP_002302855.1|  ZINC FINGER protein 2                              124   1e-29   
ref|XP_002528968.1|  zinc finger protein, putative                      124   2e-29   
ref|XP_004515843.1|  PREDICTED: zinc finger CCCH domain-containin...    124   2e-29   
gb|KDO59558.1|  hypothetical protein CISIN_1g013033mg                   123   2e-29   
ref|NP_001150919.1|  zinc finger CCCH type domain-containing prot...    123   2e-29   
ref|XP_010492867.1|  PREDICTED: zinc finger CCCH domain-containin...    123   2e-29   
ref|XP_006581890.1|  PREDICTED: zinc finger CCCH domain-containin...    124   2e-29   
ref|XP_010492866.1|  PREDICTED: zinc finger CCCH domain-containin...    123   2e-29   
ref|XP_006447662.1|  hypothetical protein CICLE_v10015215mg             123   2e-29   
emb|CDY24694.1|  BnaA05g30930D                                          123   2e-29   
gb|KHN31930.1|  Zinc finger CCCH domain-containing protein 43           124   2e-29   
ref|XP_010026837.1|  PREDICTED: zinc finger CCCH domain-containin...    123   3e-29   
gb|KJB40000.1|  hypothetical protein B456_007G041600                    123   3e-29   
ref|XP_007049197.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    123   3e-29   
ref|XP_006852277.1|  hypothetical protein AMTR_s00049p00179390          122   3e-29   
ref|XP_002275775.1|  PREDICTED: zinc finger CCCH domain-containin...    123   3e-29   
ref|XP_003522417.1|  PREDICTED: zinc finger CCCH domain-containin...    124   3e-29   
gb|KHN05794.1|  Zinc finger CCCH domain-containing protein 43           124   3e-29   
ref|XP_009134895.1|  PREDICTED: zinc finger CCCH domain-containin...    122   3e-29   
ref|XP_006400404.1|  hypothetical protein EUTSA_v10013460mg             122   3e-29   
gb|ACF86739.1|  unknown                                                 119   4e-29   
gb|KJB39998.1|  hypothetical protein B456_007G041600                    123   4e-29   
gb|KHG29012.1|  hypothetical protein F383_11348                         122   4e-29   
gb|KJB08070.1|  hypothetical protein B456_001G061800                    122   4e-29   
gb|KJB39999.1|  hypothetical protein B456_007G041600                    122   4e-29   
ref|XP_002320490.1|  ZINC FINGER protein 2                              122   4e-29   
ref|XP_004152505.1|  PREDICTED: zinc finger CCCH domain-containin...    122   5e-29   
ref|XP_004157770.1|  PREDICTED: zinc finger CCCH domain-containin...    122   5e-29   
ref|XP_010026830.1|  PREDICTED: zinc finger CCCH domain-containin...    122   5e-29   
ref|XP_004501830.1|  PREDICTED: zinc finger CCCH domain-containin...    122   7e-29   
ref|XP_010037077.1|  PREDICTED: zinc finger CCCH domain-containin...    121   8e-29   
ref|XP_008799415.1|  PREDICTED: zinc finger CCCH domain-containin...    120   9e-29   
emb|CDY13900.1|  BnaC09g39260D                                          121   9e-29   
gb|KFK26093.1|  hypothetical protein AALP_AA8G202000                    121   1e-28   
ref|XP_002871822.1|  hypothetical protein ARALYDRAFT_488738             121   1e-28   
gb|KHG13153.1|  hypothetical protein F383_04055                         121   1e-28   
ref|XP_008803513.1|  PREDICTED: zinc finger CCCH domain-containin...    121   1e-28   
ref|XP_008803512.1|  PREDICTED: zinc finger CCCH domain-containin...    121   1e-28   
emb|CDY05262.1|  BnaC05g45410D                                          121   1e-28   
ref|XP_011040430.1|  PREDICTED: zinc finger CCCH domain-containin...    121   1e-28   
gb|KHN14074.1|  Zinc finger CCCH domain-containing protein 43           121   1e-28   
ref|XP_003549835.1|  PREDICTED: zinc finger CCCH domain-containin...    121   1e-28   
gb|KFK38099.1|  hypothetical protein AALP_AA3G069300                    121   1e-28   
ref|XP_008799408.1|  PREDICTED: zinc finger CCCH domain-containin...    121   1e-28   
ref|XP_007037859.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    121   1e-28   
ref|XP_009120963.1|  PREDICTED: zinc finger CCCH domain-containin...    120   2e-28   
ref|XP_002318105.1|  hypothetical protein POPTR_0012s09400g             120   2e-28   
ref|XP_008803514.1|  PREDICTED: zinc finger CCCH domain-containin...    120   2e-28   
ref|XP_010943247.1|  PREDICTED: zinc finger CCCH domain-containin...    120   2e-28   
ref|XP_008803515.1|  PREDICTED: zinc finger CCCH domain-containin...    120   2e-28   
ref|XP_009126264.1|  PREDICTED: zinc finger CCCH domain-containin...    120   2e-28   
ref|XP_008796043.1|  PREDICTED: zinc finger CCCH domain-containin...    121   2e-28   
ref|XP_010667394.1|  PREDICTED: zinc finger CCCH domain-containin...    120   2e-28   
ref|XP_007209937.1|  hypothetical protein PRUPE_ppa004690mg             120   2e-28   
ref|XP_008239614.1|  PREDICTED: zinc finger CCCH domain-containin...    120   2e-28   
emb|CDX74105.1|  BnaA03g29420D                                          120   2e-28   
gb|KJB51160.1|  hypothetical protein B456_008G204400                    120   3e-28   
gb|KHG04838.1|  hypothetical protein F383_29515                         120   3e-28   
ref|XP_006297647.1|  hypothetical protein CARUB_v10013665mg             120   3e-28   
ref|XP_010929993.1|  PREDICTED: zinc finger CCCH domain-containin...    120   3e-28   
ref|XP_011085491.1|  PREDICTED: zinc finger CCCH domain-containin...    119   3e-28   
ref|XP_010464213.1|  PREDICTED: zinc finger CCCH domain-containin...    120   3e-28   
ref|XP_010943244.1|  PREDICTED: zinc finger CCCH domain-containin...    120   3e-28   
gb|KHG01635.1|  hypothetical protein F383_21492                         120   3e-28   
ref|XP_010929994.1|  PREDICTED: zinc finger CCCH domain-containin...    120   3e-28   
ref|XP_011100471.1|  PREDICTED: zinc finger CCCH domain-containin...    119   4e-28   
ref|XP_011100472.1|  PREDICTED: zinc finger CCCH domain-containin...    119   4e-28   
ref|XP_010439690.1|  PREDICTED: zinc finger CCCH domain-containin...    119   5e-28   
ref|XP_002993272.1|  hypothetical protein SELMODRAFT_45667              117   5e-28   
ref|XP_004299182.1|  PREDICTED: zinc finger CCCH domain-containin...    119   5e-28   
ref|XP_002993790.1|  hypothetical protein SELMODRAFT_45658              117   5e-28   
ref|NP_197356.2|  zinc finger CCCH domain-containing protein 58         119   5e-28   
gb|KFK25871.1|  hypothetical protein AALP_AA8G173100                    118   6e-28   
ref|XP_011085488.1|  PREDICTED: zinc finger CCCH domain-containin...    119   7e-28   
ref|XP_011085489.1|  PREDICTED: zinc finger CCCH domain-containin...    119   7e-28   
ref|XP_011008920.1|  PREDICTED: zinc finger CCCH domain-containin...    119   7e-28   
ref|XP_008379695.1|  PREDICTED: zinc finger CCCH domain-containin...    118   1e-27   
emb|CDY58107.1|  BnaA02g35100D                                          118   1e-27   
gb|KJB08671.1|  hypothetical protein B456_001G096900                    118   1e-27   
ref|XP_004491091.1|  PREDICTED: zinc finger CCCH domain-containin...    118   1e-27   
gb|KJB08672.1|  hypothetical protein B456_001G096900                    118   1e-27   
gb|KJB08677.1|  hypothetical protein B456_001G097100                    118   1e-27   
dbj|BAF02113.1|  hypothetical protein                                   118   2e-27   
gb|KJB08673.1|  hypothetical protein B456_001G096900                    118   2e-27   
emb|CDX88932.1|  BnaA03g07170D                                          117   2e-27   
ref|NP_187292.2|  zinc finger CCCH domain-containing protein 34         118   2e-27   
ref|XP_010486149.1|  PREDICTED: zinc finger CCCH domain-containin...    118   2e-27   
gb|AAF08587.1|AC011623_20  hypothetical protein                         117   2e-27   
gb|KJB08674.1|  hypothetical protein B456_001G096900                    117   2e-27   
ref|XP_006347414.1|  PREDICTED: zinc finger CCCH domain-containin...    119   2e-27   
ref|XP_009385235.1|  PREDICTED: zinc finger CCCH domain-containin...    117   2e-27   
ref|XP_009365130.1|  PREDICTED: zinc finger CCCH domain-containin...    117   2e-27   
ref|XP_006347415.1|  PREDICTED: zinc finger CCCH domain-containin...    119   2e-27   
ref|XP_002884577.1|  hypothetical protein ARALYDRAFT_477944             117   2e-27   
ref|XP_009394545.1|  PREDICTED: zinc finger CCCH domain-containin...    117   3e-27   
gb|KHG06790.1|  hypothetical protein F383_05075                         117   3e-27   
emb|CAN76191.1|  hypothetical protein VITISV_020358                     117   4e-27   
ref|XP_010519530.1|  PREDICTED: zinc finger CCCH domain-containin...    117   4e-27   
ref|XP_009131674.1|  PREDICTED: zinc finger CCCH domain-containin...    116   6e-27   
ref|XP_009131673.1|  PREDICTED: zinc finger CCCH domain-containin...    116   6e-27   
ref|XP_011098795.1|  PREDICTED: zinc finger CCCH domain-containin...    116   6e-27   
ref|NP_190414.1|  zinc finger CCCH domain-containing protein 43         116   7e-27   
emb|CDP16640.1|  unnamed protein product                                115   8e-27   
ref|XP_010503473.1|  PREDICTED: zinc finger CCCH domain-containin...    115   9e-27   
gb|KDO59557.1|  hypothetical protein CISIN_1g013033mg                   115   9e-27   
ref|XP_010503475.1|  PREDICTED: zinc finger CCCH domain-containin...    115   1e-26   



>ref|XP_004250094.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum lycopersicum]
Length=433

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/228 (69%), Positives = 177/228 (78%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQGPS Y+PL+VPQG+VSVPG+AYSGQ+GSVSS EGQ  TAG++QVYGTSR         
Sbjct  205  WQGPSGYTPLIVPQGVVSVPGFAYSGQMGSVSSPEGQGQTAGNNQVYGTSRSSDPVAMGS  264

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  265  QAVTSPYRQASGPMGYYALQEENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIP  324

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPM VF YS++ S +TDAP  Q
Sbjct  325  PPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSIAASSATDAPTVQ  384

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGT AL ++SEGLV+A ST PRRL        PSGDNNI+ E
Sbjct  385  RLLGSSSGTSALNMTSEGLVEAVSTKPRRLSLSETRKMPSGDNNIDRE  432


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+++KTG CKFG+ C+FHHP+++        L+ +G PLRP E  C +Y 
Sbjct  88   YPERIGQPECQYFLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVMGYPLRPNESECAYYM  147

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  148  RTGQCKFGSTCKFHHP  163


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 59/114 (52%), Gaps = 12/114 (11%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   SR       +P R G+P+C +Y++TG C+FGS CRF+HP  R +      +    
Sbjct  29   QMNLRSRDSIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKG-E  87

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPSPS  443
             P R G+P C ++ + G CKFG +CKF HP           + V  Y L P+ S
Sbjct  88   YPERIGQPECQYFLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVMGYPLRPNES  141


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEP  338
            +P RP + EC +YM+TG CKFGS C+FHHP+     P + M+S  G P+ P  P
Sbjct  134  YPLRPNESECAYYMRTGQCKFGSTCKFHHPQ-----PSNMMVSLRGSPVYPPVP  182



>ref|XP_009611378.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=450

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 178/228 (78%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQ PS+Y+PL++PQG+VSVPG+AYSGQ+GS+SS EGQ+ TAG+SQVYGTSR         
Sbjct  222  WQAPSSYTPLIMPQGVVSVPGFAYSGQMGSISSPEGQQQTAGNSQVYGTSRSGDAANMGS  281

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  282  QGVTSPYRPASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIP  341

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDCMLSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPM VF YS+S S STDAPA Q
Sbjct  342  PPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSSTDAPAVQ  401

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGT ALTL+SEGLV+A ST PRRL        P GDNNI+ E
Sbjct  402  RLLGSSSGTSALTLTSEGLVEAVSTKPRRLSLSETRKMPPGDNNIDRE  449


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 17/93 (18%)
 Frame = +3

Query  177  FPERPGQPECQ-----------------FYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
            +PER GQPECQ                 +Y+KTG CKFG+ C+FHHP+++        L+
Sbjct  88   YPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLN  147

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             +G PLRP E  C +Y R G CKFG +CKF HP
Sbjct  148  VLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHP  180


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 52/107 (49%), Gaps = 18/107 (17%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   SR       +P R G+P+C +Y++TG C+FGS CRF+HP  R +      +    
Sbjct  29   QMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKG-E  87

Query  315  LPLRPGEPIC-----------------IFYSRYGICKFGPSCKFDHP  404
             P R G+P C                  +Y + G CKFG +CKF HP
Sbjct  88   YPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGATCKFHHP  134


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEP  338
            +P RP + EC +YM+TG CKFGS C+FHHP+     P + M+S  G P+ P  P
Sbjct  151  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQ-----PSNMMVSLRGSPVYPPVP  199



>ref|XP_009611374.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611375.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611377.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=454

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 178/228 (78%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQ PS+Y+PL++PQG+VSVPG+AYSGQ+GS+SS EGQ+ TAG+SQVYGTSR         
Sbjct  226  WQAPSSYTPLIMPQGVVSVPGFAYSGQMGSISSPEGQQQTAGNSQVYGTSRSGDAANMGS  285

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  286  QGVTSPYRPASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIP  345

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDCMLSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPM VF YS+S S STDAPA Q
Sbjct  346  PPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSSTDAPAVQ  405

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGT ALTL+SEGLV+A ST PRRL        P GDNNI+ E
Sbjct  406  RLLGSSSGTSALTLTSEGLVEAVSTKPRRLSLSETRKMPPGDNNIDRE  453


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 20/107 (19%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQ-----------------FYMKTGDCKFGSVCRFHH  263
            Q   T+R    +  +PER GQPECQ                 +Y+KTG CKFG+ C+FHH
Sbjct  81   QAIATARM---KGEYPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGATCKFHH  137

Query  264  PRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            P+++        L+ +G PLRP E  C +Y R G CKFG +CKF HP
Sbjct  138  PKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHP  184


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 54/114 (47%), Gaps = 28/114 (25%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   SR       +P R G+P+C +Y++TG C+FGS CRF+HP  R +     ++  I 
Sbjct  29   QMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKL----YLMQAIA  84

Query  315  L-------PLRPGEPIC-----------------IFYSRYGICKFGPSCKFDHP  404
                    P R G+P C                  +Y + G CKFG +CKF HP
Sbjct  85   TARMKGEYPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGATCKFHHP  138


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEP  338
            +P RP + EC +YM+TG CKFGS C+FHHP+     P + M+S  G P+ P  P
Sbjct  155  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQ-----PSNMMVSLRGSPVYPPVP  203



>ref|XP_009611379.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=437

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 178/228 (78%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQ PS+Y+PL++PQG+VSVPG+AYSGQ+GS+SS EGQ+ TAG+SQVYGTSR         
Sbjct  209  WQAPSSYTPLIMPQGVVSVPGFAYSGQMGSISSPEGQQQTAGNSQVYGTSRSGDAANMGS  268

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  269  QGVTSPYRPASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIP  328

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDCMLSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPM VF YS+S S STDAPA Q
Sbjct  329  PPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSSTDAPAVQ  388

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGT ALTL+SEGLV+A ST PRRL        P GDNNI+ E
Sbjct  389  RLLGSSSGTSALTLTSEGLVEAVSTKPRRLSLSETRKMPPGDNNIDRE  436


 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 59/90 (66%), Gaps = 3/90 (3%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q   T+R    +  +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G
Sbjct  81   QAIATARM---KGEYPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLG  137

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             PLRP E  C +Y R G CKFG +CKF HP
Sbjct  138  YPLRPNEAECAYYMRTGQCKFGSTCKFHHP  167


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 22/119 (18%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   SR       +P R G+P+C +Y++TG C+FGS CRF+HP  R +     ++  I 
Sbjct  29   QMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKL----YLMQAIA  84

Query  315  L-------PLRPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
                    P R G+P C +Y + G CKFG +CKF HP           + V  Y L P+
Sbjct  85   TARMKGEYPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPN  143


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEP  338
            +P RP + EC +YM+TG CKFGS C+FHHP+     P + M+S  G P+ P  P
Sbjct  138  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQ-----PSNMMVSLRGSPVYPPVP  186



>ref|XP_009611380.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=433

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 178/228 (78%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQ PS+Y+PL++PQG+VSVPG+AYSGQ+GS+SS EGQ+ TAG+SQVYGTSR         
Sbjct  205  WQAPSSYTPLIMPQGVVSVPGFAYSGQMGSISSPEGQQQTAGNSQVYGTSRSGDAANMGS  264

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  265  QGVTSPYRPASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLIP  324

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDCMLSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPM VF YS+S S STDAPA Q
Sbjct  325  PPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSSTDAPAVQ  384

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGT ALTL+SEGLV+A ST PRRL        P GDNNI+ E
Sbjct  385  RLLGSSSGTSALTLTSEGLVEAVSTKPRRLSLSETRKMPPGDNNIDRE  432


 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP E  C +Y 
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYM  147

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  148  RTGQCKFGSTCKFHHP  163


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 58/112 (52%), Gaps = 12/112 (11%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   SR       +P R G+P+C +Y++TG C+FGS CRF+HP  R +      +    
Sbjct  29   QMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKG-E  87

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
             P R G+P C +Y + G CKFG +CKF HP           + V  Y L P+
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPN  139


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 5/54 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEP  338
            +P RP + EC +YM+TG CKFGS C+FHHP+     P + M+S  G P+ P  P
Sbjct  134  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQ-----PSNMMVSLRGSPVYPPVP  182



>ref|XP_009793876.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Nicotiana sylvestris]
Length=433

 Score =   278 bits (710),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 177/228 (78%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQ PS+Y+PL++PQ +VSVPG+AYSGQ+GS+SS EGQ+ TAG+SQVYGTSR         
Sbjct  205  WQAPSSYTPLIMPQAVVSVPGFAYSGQMGSISSPEGQQQTAGNSQVYGTSRSGDAVNMGS  264

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  265  QGVTSPYRPASVPMGYYALQGENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIP  324

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDCMLSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPM VF YS+S S  TDAPA Q
Sbjct  325  PPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSPTDAPAVQ  384

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGT ALTL+SEGLV+A ST PRRL        P GDNNI+ E
Sbjct  385  RLLGSSSGTSALTLTSEGLVEAVSTKPRRLSLSDTRKMPPGDNNIDRE  432


 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP E  C +Y 
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYM  147

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  148  RTGQCKFGSTCKFHHP  163


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 58/112 (52%), Gaps = 12/112 (11%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   SR       +P R G+P+C +Y++TG C+FGS CRF+HP  R +      +    
Sbjct  29   QMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKG-E  87

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
             P R G+P C +Y + G CKFG +CKF HP           + V  Y L P+
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPN  139


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (63%), Gaps = 5/54 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEP  338
            +P RP + EC +YM+TG CKFGS C+FHHP+     P + M+S  G P  P  P
Sbjct  134  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQ-----PSNMMVSLRGSPTYPPVP  182



>ref|XP_006353234.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum tuberosum]
Length=433

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 175/228 (77%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQGPS Y+PL+VPQG+VSVPG+AYSGQ+GSVSS EGQ  TAG++QVYGTSR         
Sbjct  205  WQGPSGYTPLIVPQGVVSVPGFAYSGQMGSVSSPEGQGQTAGNNQVYGTSRSSDPATMGS  264

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPERPGQ ECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  265  QGVTSPYRQASGPMGYYALQGENVFPERPGQAECQFYMKTGDCKFGAVCRFHHPRERLIP  324

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDC+LSPIGLPLR GEP+CIFYSRYGICKFGPSCKFDHPM VF YS++ S +TDAP  Q
Sbjct  325  PPDCLLSPIGLPLRTGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSIAASSTTDAPTVQ  384

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGT AL ++SEGLV+A ST PRRL        PSGDNNI+ E
Sbjct  385  RLLGSSSGTSALNMTSEGLVEAVSTKPRRLSLSETRKMPSGDNNIDRE  432


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+++KTG CKFG+ C+FHHP+++        L+ +G PLRP E  C +Y 
Sbjct  88   YPERIGQPECQYFLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNESECAYYM  147

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  148  RTGQCKFGSTCKFHHP  163


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 59/114 (52%), Gaps = 12/114 (11%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   SR       +P R G+P+C +Y++TG C+FGS CRF+HP  R +      +    
Sbjct  29   QMNLRSRDSIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKG-E  87

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPSPS  443
             P R G+P C ++ + G CKFG +CKF HP           + V  Y L P+ S
Sbjct  88   YPERIGQPECQYFLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNES  141


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +YM+TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  134  YPLRPNESECAYYMRTGQCKFGSTCKFHHPQ-----PSNMMVSLRGSPVYP  179



>ref|XP_008218439.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Prunus mume]
Length=442

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 176/230 (77%), Gaps = 36/230 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PL+VPQG+VSVPG+ AYSGQ+GSVSS E Q+   G+SQ+YGTSR        
Sbjct  214  WQAPSSYAPLIVPQGVVSVPGWSAYSGQIGSVSSPESQQQPVGNSQIYGTSRQGEPENSG  273

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  274  SQGTFSPYRSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  333

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y+ + S S DAPA 
Sbjct  334  PTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNPNASSSADAPAR  393

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETEE  587
            +  LGS+S T +L LSSEGLV+AGS NPRRL        PSGD+NI+TE+
Sbjct  394  RL-LGSTSATTSLNLSSEGLVEAGSANPRRLSLSEPRQIPSGDDNIDTED  442


 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  92   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYL  151

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CK+ HP
Sbjct  152  RTGQCKFGSTCKYHHP  167


 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKG-EFPERIGQPECQYYL  105

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C++HHP+     P + M+S  G P+ P
Sbjct  138  YPLRPNEIECAYYLRTGQCKFGSTCKYHHPQ-----PTNMMVSLRGSPVYP  183



>ref|XP_007205202.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
 gb|EMJ06401.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
Length=442

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 175/230 (76%), Gaps = 36/230 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PL+VPQG+VSVPG+ AYSGQ+GSVSS E Q+   G+SQ+YGTSR        
Sbjct  214  WQAPSSYAPLIVPQGVVSVPGWSAYSGQIGSVSSPESQQQPVGNSQIYGTSRQGEPENSG  273

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  274  SQGTFSSYRSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  333

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y+ + S S DAPA 
Sbjct  334  PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNPNASSSADAPAR  393

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETEE  587
            +  LGS+S T +L LS EGLV+AGS NPRRL        PSGD+NI+TE+
Sbjct  394  RL-LGSTSATTSLNLSPEGLVEAGSANPRRLSLSEPRQIPSGDDNIDTED  442


 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  92   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYL  151

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CK+ HP
Sbjct  152  RTGQCKFGSTCKYHHP  167


 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKG-EFPERIGQPECQYYL  105

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C++HHP+     P + M+S  G P+ P
Sbjct  138  YPLRPNEIECAYYLRTGQCKFGSTCKYHHPQ-----PTNMMVSLRGSPVYP  183



>ref|XP_002512627.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF50079.1| nucleic acid binding protein, putative [Ricinus communis]
Length=448

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 178/229 (78%), Gaps = 37/229 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PL++PQG+VSVPG+ AYSGQLGSVSS EGQ+ T G+SQ+YGTSR        
Sbjct  221  WQAPSSYTPLILPQGVVSVPGWNAYSGQLGSVSSPEGQQQT-GNSQIYGTSRQSESVNTG  279

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++R+NVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  280  SQGTLSPLRAGSMPVGFYALQRDNVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  339

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYG+CKFGPSCKFDHPMG+F Y+LS   S DAP  
Sbjct  340  PAPDCVLSPIGLPLRPGEPLCIFYSRYGVCKFGPSCKFDHPMGIFTYNLSAPSSADAPVR  399

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            +  LGSSSG+ ALTLS+EGLVDAGST PRRL        PSGD+NI+TE
Sbjct  400  RL-LGSSSGSAALTLSTEGLVDAGSTKPRRLSLSEPRQMPSGDDNIDTE  447


 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP E
Sbjct  92   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVSLNILGYPLRPNE  151

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  152  IECAYYLRTGQCKFGSTCKFHHP  174


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  54   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  112

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  113  KTGTCKFGATCKFHHP  128


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+   G P+ P
Sbjct  145  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ-----PTNVMVPLRGSPVYP  190



>ref|XP_004302155.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Fragaria vesca subsp. vesca]
Length=442

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 177/230 (77%), Gaps = 36/230 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+P++VPQG+VSVPG+ AYSGQ+GS+S++EGQ+ T G+SQVYGTSR        
Sbjct  214  WQGPSSYAPVIVPQGVVSVPGWSAYSGQVGSISTSEGQQQTVGNSQVYGTSRQREPENLG  273

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A+ RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  274  SQGAYSPYRSGSIPVGFYALPRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  333

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y+L+ S S ++P  
Sbjct  334  PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLAASSSAESPVR  393

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETEE  587
            +  LGS+SGT +L LSSEGLV+AGS  PRRL        PS + NI+TEE
Sbjct  394  RL-LGSTSGTTSLNLSSEGLVEAGSAKPRRLSLSEPRQMPSAEENIDTEE  442


 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  92   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYL  151

Query  357  RYGICKFGPSCKFDHP  404
            R G CKF  +CK+ HP
Sbjct  152  RTGQCKFASTCKYHHP  167


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  47   YPERAGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKG-EFPERVGQPECQYYL  105

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_002278934.2| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Vitis vinifera]
Length=441

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 177/229 (77%), Gaps = 37/229 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PLM+PQG+VSVPG+ AYSGQLGS S  E Q+ T G++Q+YGTSR        
Sbjct  214  WQAPSSYAPLMLPQGVVSVPGWNAYSGQLGSPS--ESQQQTGGNNQIYGTSRQSEQPNTG  271

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  272  SQGTFSPYRSGSVPIGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  331

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+FAY+LS S S DAP  
Sbjct  332  PTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFAYNLSASSSADAPVV  391

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            + LLGSSSG+ ALTLSS+GLV+AGST PRRL        P GD+NI+TE
Sbjct  392  RRLLGSSSGSAALTLSSDGLVEAGSTKPRRLSLPETRQMPPGDDNIDTE  440


 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 61/99 (62%), Gaps = 9/99 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  90   FPERMGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPDEIDCAYYL  149

Query  357  RYGICKFGPSCKFDHPM---------GVFAYSLSPSPST  446
            R G CKFG +CKF HP          G   Y   PSP+T
Sbjct  150  RTGQCKFGSTCKFHHPQPSSMMVSLRGSPVYPSVPSPTT  188



>ref|XP_009626545.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=350

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 173/228 (76%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQG S+Y+PL V QG+VS PG+ Y+GQLG+VSSAE Q+ TAG++QVYG+SR         
Sbjct  122  WQGSSSYAPLPVLQGVVSFPGFTYNGQLGAVSSAEDQQQTAGNNQVYGSSRSSDKATMGS  181

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+E ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERL+P
Sbjct  182  EGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLP  241

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPM VF Y++S S STD P+ +
Sbjct  242  PPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSVR  301

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGTGALTL+SEG+V+A ST PRRL        P GDNN + E
Sbjct  302  RLLGSSSGTGALTLTSEGIVEAASTTPRRLSLSETRKMPPGDNNFDRE  349


 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQ ECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  5    YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  64

Query  357  RYGICKFGPSCKFDHP  404
            R   CKFG +CKF HP
Sbjct  65   RTAQCKFGSTCKFHHP  80



>ref|XP_009769505.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana sylvestris]
Length=350

 Score =   260 bits (665),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 173/228 (76%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQG S+Y+PL V QG+VS PG+ Y+GQLGSVSSAEGQ+ TAG+SQVYG+SR         
Sbjct  122  WQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGNSQVYGSSRSSDKATMGS  181

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERL+P
Sbjct  182  EGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLP  241

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDC+LSPIGLPLR GEP+CIFYSRYGICKFGPSCKFDHPM VF Y++S S STD P+ +
Sbjct  242  PPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSVR  301

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGTGALTL+SEG+V+A ST PRRL        P GDNN + E
Sbjct  302  RLLGSSSGTGALTLTSEGIVEAASTTPRRLSLLETRKMPPGDNNFDRE  349


 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQ ECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  5    YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  64

Query  357  RYGICKFGPSCKFDHP  404
            R   CKFG +CKF HP
Sbjct  65   RTAQCKFGSTCKFHHP  80



>gb|KDP23293.1| hypothetical protein JCGZ_23126 [Jatropha curcas]
Length=442

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 174/229 (76%), Gaps = 37/229 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PL++PQG+VSVPG+ AYSGQLGSVSS EGQ+ T G+ Q+YGTSR        
Sbjct  215  WQAPSSYTPLILPQGVVSVPGWNAYSGQLGSVSSPEGQQQT-GNGQIYGTSRQSESLNTG  273

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++ EN FPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  274  SQGALSPYRSGSVPVGFYALQTENAFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  333

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYG+CKFGPSCK+DHPMG+F Y+LS S STD P  
Sbjct  334  PAPDCVLSPIGLPLRPGEPLCIFYSRYGVCKFGPSCKYDHPMGIFTYNLSASSSTDTPVR  393

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            +  LGSSS + ALTLS EGLV+AGST PRRL        PSGD+NI+TE
Sbjct  394  RL-LGSSSASAALTLSPEGLVEAGSTKPRRLSLSEPRQMPSGDDNIDTE  441


 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP E
Sbjct  86   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVSLNIMGYPLRPNE  145

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  146  IECAYYLRTGQCKFGSTCKFHHP  168


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  48   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  106

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  107  KTGTCKFGATCKFHHP  122


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+   G P+ P
Sbjct  139  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ-----PTNVMVPLRGSPVYP  184



>gb|KHN29278.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=267

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 173/229 (76%), Gaps = 40/229 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSVPG+ AYSGQ+GS S  +    T G+ Q YGTSR        
Sbjct  43   WQGPSSYAPLILPQGMVSVPGWSAYSGQMGSDSPQQ----TMGNGQSYGTSRQSEPANSG  98

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++REN+FPERP QPECQFYMKTGDCKFG+VCRFHHPRER+I
Sbjct  99   SQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMI  158

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMGVF Y++S SPS DAP G
Sbjct  159  PAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASPSADAP-G  217

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            + +LGSSSGT AL LSSEGLV++GS NPRRL        PSGD+NI+ E
Sbjct  218  RRMLGSSSGTSALNLSSEGLVESGSANPRRLSLSETRQIPSGDDNIDEE  266



>ref|XP_009769504.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana sylvestris]
Length=381

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 173/228 (76%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQG S+Y+PL V QG+VS PG+ Y+GQLGSVSSAEGQ+ TAG+SQVYG+SR         
Sbjct  153  WQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGNSQVYGSSRSSDKATMGS  212

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERL+P
Sbjct  213  EGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLP  272

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDC+LSPIGLPLR GEP+CIFYSRYGICKFGPSCKFDHPM VF Y++S S STD P+ +
Sbjct  273  PPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSVR  332

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGTGALTL+SEG+V+A ST PRRL        P GDNN + E
Sbjct  333  RLLGSSSGTGALTLTSEGIVEAASTTPRRLSLLETRKMPPGDNNFDRE  380


 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQ ECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  36   YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  95

Query  357  RYGICKFGPSCKFDHP  404
            R   CKFG +CKF HP
Sbjct  96   RTAQCKFGSTCKFHHP  111



>ref|XP_009769503.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana sylvestris]
Length=406

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 173/228 (76%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQG S+Y+PL V QG+VS PG+ Y+GQLGSVSSAEGQ+ TAG+SQVYG+SR         
Sbjct  178  WQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGNSQVYGSSRSSDKATMGS  237

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERL+P
Sbjct  238  EGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLP  297

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDC+LSPIGLPLR GEP+CIFYSRYGICKFGPSCKFDHPM VF Y++S S STD P+ +
Sbjct  298  PPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSVR  357

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGTGALTL+SEG+V+A ST PRRL        P GDNN + E
Sbjct  358  RLLGSSSGTGALTLTSEGIVEAASTTPRRLSLLETRKMPPGDNNFDRE  405


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  210  FYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSC  389
            +Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y R   CKFG +C
Sbjct  72   YYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKFGSTC  131

Query  390  KFDHP  404
            KF HP
Sbjct  132  KFHHP  136


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +YM+T  CKFGS C+FHHP      P + M+S  G P+ P
Sbjct  107  YPLRPNENECTYYMRTAQCKFGSTCKFHHPE-----PSNMMVSSRGSPVYP  152



>ref|XP_009626544.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=381

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 173/228 (76%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQG S+Y+PL V QG+VS PG+ Y+GQLG+VSSAE Q+ TAG++QVYG+SR         
Sbjct  153  WQGSSSYAPLPVLQGVVSFPGFTYNGQLGAVSSAEDQQQTAGNNQVYGSSRSSDKATMGS  212

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+E ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERL+P
Sbjct  213  EGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLP  272

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPM VF Y++S S STD P+ +
Sbjct  273  PPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSVR  332

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGTGALTL+SEG+V+A ST PRRL        P GDNN + E
Sbjct  333  RLLGSSSGTGALTLTSEGIVEAASTTPRRLSLSETRKMPPGDNNFDRE  380


 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQ ECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  36   YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  95

Query  357  RYGICKFGPSCKFDHP  404
            R   CKFG +CKF HP
Sbjct  96   RTAQCKFGSTCKFHHP  111



>ref|XP_009769498.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769499.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769500.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769502.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
Length=427

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 173/228 (76%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQG S+Y+PL V QG+VS PG+ Y+GQLGSVSSAEGQ+ TAG+SQVYG+SR         
Sbjct  199  WQGSSSYAPLPVLQGVVSFPGFTYNGQLGSVSSAEGQQQTAGNSQVYGSSRSSDKATMGS  258

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERL+P
Sbjct  259  EGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLLP  318

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDC+LSPIGLPLR GEP+CIFYSRYGICKFGPSCKFDHPM VF Y++S S STD P+ +
Sbjct  319  PPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSVR  378

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGTGALTL+SEG+V+A ST PRRL        P GDNN + E
Sbjct  379  RLLGSSSGTGALTLTSEGIVEAASTTPRRLSLLETRKMPPGDNNFDRE  426


 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQ ECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  82   YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  141

Query  357  RYGICKFGPSCKFDHP  404
            R   CKFG +CKF HP
Sbjct  142  RTAQCKFGSTCKFHHP  157


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P R G+ +C +Y++TG C+FGS C+F+HP  R +      ++    P R G+  C +Y 
Sbjct  37   YPVREGESDCSYYIRTGLCRFGSTCQFNHPPNRKLALAAASMNG-EYPERIGQLECQYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGATCKFHHP  111



>ref|XP_006480414.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Citrus sinensis]
 ref|XP_006480415.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Citrus sinensis]
 ref|XP_006480416.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Citrus sinensis]
 ref|XP_006480417.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X5 [Citrus sinensis]
Length=420

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 174/227 (77%), Gaps = 34/227 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+P+++PQGMVSVPG+  YSGQLGSVSS+E  + T+G+SQ+YG SR        
Sbjct  194  WQGPSSYAPMLLPQGMVSVPGWNTYSGQLGSVSSSENLQQTSGNSQIYGASRQTEPSNSG  253

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RE+VFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERL+
Sbjct  254  SQGTMSPFRSGSIPVGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLL  313

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y+LS S S DAP  
Sbjct  314  PVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSASSSADAPVR  373

Query  462  QFllgsssgtgaltlsseglVDAGST------NPRRLPSGDNNIETE  584
            +F LGSSS TGAL LSSEGLV+AGS         R++ SGD+ I+TE
Sbjct  374  RF-LGSSSATGALNLSSEGLVEAGSGRRLSLPETRQMSSGDDEIDTE  419


 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 3/101 (3%)
 Frame = +3

Query  111  QKLTAGSSQVYGTSRAIERENV---FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
            Q +     ++    +AI    +   +PER GQPECQ+Y+KTG CKFG+ C+FHHPR++  
Sbjct  47   QHVLTNICELKSKQKAIATARIKGDYPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAG  106

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
                  L+ +G PLRP E  C +Y R G CKFG +CKF HP
Sbjct  107  IAGRVSLNVLGYPLRPNEIECAYYLRTGQCKFGSTCKFHHP  147


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  118  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ-----PNNMMVSLRGSPVYP  163



>ref|XP_009626543.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=406

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 173/228 (76%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQG S+Y+PL V QG+VS PG+ Y+GQLG+VSSAE Q+ TAG++QVYG+SR         
Sbjct  178  WQGSSSYAPLPVLQGVVSFPGFTYNGQLGAVSSAEDQQQTAGNNQVYGSSRSSDKATMGS  237

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+E ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERL+P
Sbjct  238  EGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLP  297

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPM VF Y++S S STD P+ +
Sbjct  298  PPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSVR  357

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGTGALTL+SEG+V+A ST PRRL        P GDNN + E
Sbjct  358  RLLGSSSGTGALTLTSEGIVEAASTTPRRLSLSETRKMPPGDNNFDRE  405


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  210  FYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSC  389
            +Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y R   CKFG +C
Sbjct  72   YYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKFGSTC  131

Query  390  KFDHP  404
            KF HP
Sbjct  132  KFHHP  136



>ref|XP_009626542.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=427

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 173/228 (76%), Gaps = 34/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQG S+Y+PL V QG+VS PG+ Y+GQLG+VSSAE Q+ TAG++QVYG+SR         
Sbjct  199  WQGSSSYAPLPVLQGVVSFPGFTYNGQLGAVSSAEDQQQTAGNNQVYGSSRSSDKATMGS  258

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+E ENVFPER GQPECQFYMKTGDCKFG+VCRFHHPRERL+P
Sbjct  259  EGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLLP  318

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
            PPDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPM VF Y++S S STD P+ +
Sbjct  319  PPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASSSTDDPSVR  378

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             LLGSSSGTGALTL+SEG+V+A ST PRRL        P GDNN + E
Sbjct  379  RLLGSSSGTGALTLTSEGIVEAASTTPRRLSLSETRKMPPGDNNFDRE  426


 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQ ECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  82   YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  141

Query  357  RYGICKFGPSCKFDHP  404
            R   CKFG +CKF HP
Sbjct  142  RTAQCKFGSTCKFHHP  157


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P R G+P+C +Y++TG C+FGS CRF+HP  R +      ++    P R G+  C +Y 
Sbjct  37   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLALAAASMNG-EYPERIGQLECQYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGATCKFHHP  111



>ref|XP_006428579.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428580.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480413.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Citrus sinensis]
 gb|ESR41819.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41820.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=439

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 174/227 (77%), Gaps = 34/227 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+P+++PQGMVSVPG+  YSGQLGSVSS+E  + T+G+SQ+YG SR        
Sbjct  213  WQGPSSYAPMLLPQGMVSVPGWNTYSGQLGSVSSSENLQQTSGNSQIYGASRQTEPSNSG  272

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RE+VFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERL+
Sbjct  273  SQGTMSPFRSGSIPVGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLL  332

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y+LS S S DAP  
Sbjct  333  PVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSASSSADAPVR  392

Query  462  QFllgsssgtgaltlsseglVDAGST------NPRRLPSGDNNIETE  584
            +F LGSSS TGAL LSSEGLV+AGS         R++ SGD+ I+TE
Sbjct  393  RF-LGSSSATGALNLSSEGLVEAGSGRRLSLPETRQMSSGDDEIDTE  438


 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  91   YPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYL  150

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  151  RTGQCKFGSTCKFHHP  166


 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 13/108 (12%)
 Frame = +3

Query  147  TSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLR  326
            T+ A+E     PERPG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R
Sbjct  37   TNEAME-SGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARIKG-DYPER  94

Query  327  PGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
             G+P C +Y + G CKFG +CKF HP           + V  Y L P+
Sbjct  95   LGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPN  142


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  137  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ-----PNNMMVSLRGSPVYP  182



>ref|XP_006428577.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428578.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480418.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X6 [Citrus sinensis]
 ref|XP_006480419.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X7 [Citrus sinensis]
 ref|XP_006480420.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X8 [Citrus sinensis]
 gb|ESR41817.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41818.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=407

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 174/227 (77%), Gaps = 34/227 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+P+++PQGMVSVPG+  YSGQLGSVSS+E  + T+G+SQ+YG SR        
Sbjct  181  WQGPSSYAPMLLPQGMVSVPGWNTYSGQLGSVSSSENLQQTSGNSQIYGASRQTEPSNSG  240

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RE+VFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERL+
Sbjct  241  SQGTMSPFRSGSIPVGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLL  300

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y+LS S S DAP  
Sbjct  301  PVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSASSSADAPVR  360

Query  462  QFllgsssgtgaltlsseglVDAGST------NPRRLPSGDNNIETE  584
            +F LGSSS TGAL LSSEGLV+AGS         R++ SGD+ I+TE
Sbjct  361  RF-LGSSSATGALNLSSEGLVEAGSGRRLSLPETRQMSSGDDEIDTE  406


 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  59   YPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYL  118

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  119  RTGQCKFGSTCKFHHP  134


 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 60/108 (56%), Gaps = 13/108 (12%)
 Frame = +3

Query  147  TSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLR  326
            T+ A+E     PERPG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R
Sbjct  5    TNEAME-SGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARIKG-DYPER  62

Query  327  PGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
             G+P C +Y + G CKFG +CKF HP           + V  Y L P+
Sbjct  63   LGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPN  110


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  105  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQ-----PNNMMVSLRGSPVYP  150



>ref|XP_011015459.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=412

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 174/228 (76%), Gaps = 37/228 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PL++PQG+VSVPG+ AYSGQLGSVSS E Q+ T G+SQ+YGTSR        
Sbjct  185  WQAPSSYTPLILPQGVVSVPGWNAYSGQLGSVSSPENQQQT-GNSQIYGTSRHSESVNAG  243

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RE+VFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  244  SQGTFSPYRSGSAPLGYYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  303

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y+L+ S S DAP  
Sbjct  304  PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLTASSSADAPVR  363

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIET  581
            +  LGSSSG+  LTLSSEGLV+AG T PRRL        P GD+NI+T
Sbjct  364  RL-LGSSSGSAGLTLSSEGLVEAGPTKPRRLSLSEPRQMPPGDDNIDT  410


 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PL+P E
Sbjct  55   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPLQPNE  114

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  115  IECAYYLRTGQCKFGSTCKFHHP  137


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  17   YPERSGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  75

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGATCKFHHP  91


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 7/52 (13%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI-GLPLRP  329
            +P +P + EC +Y++TG CKFGS C+FHHP+      P  M+ P+ G P+ P
Sbjct  108  YPLQPNEIECAYYLRTGQCKFGSTCKFHHPQ------PTNMMVPLRGSPIYP  153



>ref|XP_011014133.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=447

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 174/228 (76%), Gaps = 37/228 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PL++PQG+VSVPG+ AYSGQLGSVSS E Q+ T G+SQ+YGTSR        
Sbjct  220  WQAPSSYTPLILPQGVVSVPGWNAYSGQLGSVSSPENQQQT-GNSQIYGTSRHSESVNAG  278

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RE+VFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  279  SQGTFSPYRSGSAPLGYYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  338

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y+L+ S S DAP  
Sbjct  339  PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLTASSSADAPVR  398

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIET  581
            +  LGSSSG+  LTLSSEGLV+AG T PRRL        P GD+NI+T
Sbjct  399  RL-LGSSSGSAGLTLSSEGLVEAGPTKPRRLSLSEPRQMPPGDDNIDT  445


 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PL+P E
Sbjct  90   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPLQPNE  149

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  150  IECAYYLRTGQCKFGSTCKFHHP  172


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  52   YPERSGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  110

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  111  KTGTCKFGATCKFHHP  126


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 7/52 (13%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI-GLPLRP  329
            +P +P + EC +Y++TG CKFGS C+FHHP+      P  M+ P+ G P+ P
Sbjct  143  YPLQPNEIECAYYLRTGQCKFGSTCKFHHPQ------PTNMMVPLRGSPIYP  188



>ref|XP_008359919.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Malus domestica]
Length=444

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 175/231 (76%), Gaps = 37/231 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+PL+VPQG+VSVPG+ AYSGQLGSVSSAE Q+ TAG+SQ+YGTSR        
Sbjct  215  WQAPSNYAPLIVPQGVVSVPGWNAYSGQLGSVSSAESQQQTAGNSQMYGTSRQGEPENSG  274

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHP ERLI
Sbjct  275  SQGGFSPYRSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLI  334

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y LS S S DAPA 
Sbjct  335  PAPDCVLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMGIFTYGLSASSSADAPAR  394

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRR--------LPSG-DNNIETEE  587
            +  LGS+SG  +L L+S GLV+AGS NPRR        +PS  DNNI+ EE
Sbjct  395  RL-LGSTSGAASLNLASSGLVEAGSANPRRVSLSEPRQMPSAEDNNIDREE  444


 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP  
Sbjct  85   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPQN  144

Query  336  PI-CIFYSRYGICKFGPSCKFDHP  404
             I C +Y R G CKFG +CKF HP
Sbjct  145  EIECAYYLRTGQCKFGGTCKFHHP  168


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  105

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_008359920.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Malus domestica]
Length=443

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 175/231 (76%), Gaps = 37/231 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+PL+VPQG+VSVPG+ AYSGQLGSVSSAE Q+ TAG+SQ+YGTSR        
Sbjct  214  WQAPSNYAPLIVPQGVVSVPGWNAYSGQLGSVSSAESQQQTAGNSQMYGTSRQGEPENSG  273

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHP ERLI
Sbjct  274  SQGGFSPYRSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLI  333

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y LS S S DAPA 
Sbjct  334  PAPDCVLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMGIFTYGLSASSSADAPAR  393

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRR--------LPSG-DNNIETEE  587
            +  LGS+SG  +L L+S GLV+AGS NPRR        +PS  DNNI+ EE
Sbjct  394  RL-LGSTSGAASLNLASSGLVEAGSANPRRVSLSEPRQMPSAEDNNIDREE  443


 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E
Sbjct  85   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNE  144

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  145  IECAYYLRTGQCKFGGTCKFHHP  167


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  105

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG  C+FHHP+     P + M+S  G P+ P
Sbjct  138  YPLRPNEIECAYYLRTGQCKFGGTCKFHHPQ-----PTNMMVSVRGSPVYP  183



>ref|XP_011014371.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=445

 Score =   257 bits (656),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 174/228 (76%), Gaps = 37/228 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+PL++PQG+VSVPG+ AYSGQ+GSVSS E Q+ T G+SQ+YGTSR        
Sbjct  218  WQAPSNYTPLILPQGVVSVPGWNAYSGQVGSVSSPESQQQT-GNSQIYGTSRQSESVNAG  276

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RE+VFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  277  SQGTFSPYRSDSVPMGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  336

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LS IGLPLRPGEP+CIFYSRYGICKFGPSCKF HPMG+F Y+L+ S S DAP  
Sbjct  337  PAPDCVLSAIGLPLRPGEPLCIFYSRYGICKFGPSCKFHHPMGIFTYNLTASSSADAPVR  396

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIET  581
            +  LGSSSG+ ALTLSSEGLV+AGST PRRL        P GD+NI+T
Sbjct  397  RL-LGSSSGSAALTLSSEGLVEAGSTKPRRLSLSEPRQMPPGDDNIDT  443


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLR  E
Sbjct  88   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGVSGRVSLNILGYPLRLNE  147

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  148  MECAYYLRTGQCKFGSTCKFHHP  170


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FG  CRF+HP  R +      +     P R G+P C +Y 
Sbjct  50   YPERPGEPDCSYYIRTGLCRFGPTCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  108

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  109  KTGTCKFGATCKFHHP  124



>ref|XP_002325901.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF00283.2| zinc finger family protein [Populus trichocarpa]
Length=445

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 174/228 (76%), Gaps = 37/228 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+PL++PQG+VSVPG+ AYSGQ+GSVSS E Q+ T G+SQ+YGTSR        
Sbjct  218  WQAPSNYTPLILPQGVVSVPGWNAYSGQVGSVSSPESQQQT-GNSQIYGTSRQNESVNAG  276

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RE+VFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  277  SQGTFSPYRSDSVPMGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  336

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LS IGLPLRPGEP+CIFYSRYGICKFGPSCKF HPMG+F Y+L+ S S DAP  
Sbjct  337  PAPDCVLSAIGLPLRPGEPLCIFYSRYGICKFGPSCKFHHPMGIFTYNLTASSSADAPVR  396

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIET  581
            +  LGSSSG+ ALTLSSEGLV+AGST PRRL        P GD+NI+T
Sbjct  397  RL-LGSSSGSAALTLSSEGLVEAGSTKPRRLSLSEPRQMPPGDDNIDT  443


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLR  E
Sbjct  88   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGVSGRVSLNILGYPLRLNE  147

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  148  MECAYYLRTGQCKFGSTCKFHHP  170


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FG  CRF+HP  R +      +     P R G+P C +Y 
Sbjct  50   YPERPGEPDCSYYIRTGLCRFGPTCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  108

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  109  KTGTCKFGATCKFHHP  124



>ref|XP_010111067.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
 gb|EXC29929.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
Length=419

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/231 (65%), Positives = 175/231 (76%), Gaps = 38/231 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQG S+Y+P+++PQG+VSVPG+  YSGQLGSVSS E Q+  +GSSQ+YGTSR        
Sbjct  191  WQGSSSYAPMILPQGVVSVPGWNTYSGQLGSVSSPERQQ-PSGSSQIYGTSRQSDPANTG  249

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPER GQPECQFYMKTGDCKFG+VC+FHHPRERLI
Sbjct  250  SQGTLSPYRSGSIPVGFYALQRENVFPERTGQPECQFYMKTGDCKFGAVCKFHHPRERLI  309

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSP+GLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F  +LS + STD P  
Sbjct  310  PAPDCLLSPMGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTINLSATSSTDTPVR  369

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSG-DNNIETEE  587
            +  LGSSSGT AL LSSEGLV+AGSTNPRRL        PSG DNN +TE+
Sbjct  370  RL-LGSSSGTTALNLSSEGLVEAGSTNPRRLSLSETRQMPSGDDNNTDTED  419


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 54/101 (53%), Gaps = 24/101 (24%)
 Frame = +3

Query  174  VFPERPGQPECQFY------------------------MKTGDCKFGSVCRFHHPRERLI  281
             +PERPG+P+C +Y                        +KTG CKFG+ C+FHHPR++  
Sbjct  44   TYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLYYLKTGTCKFGATCKFHHPRDKAG  103

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
                  L+ +G PLRP E  C +Y R G CKFG +CKF HP
Sbjct  104  IAGRVSLNILGYPLRPNEMECAYYLRTGQCKFGSTCKFHHP  144


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  115  YPLRPNEMECAYYLRTGQCKFGSTCKFHHPQ-----PTNMMVSMRGSPVYP  160



>ref|XP_003534518.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoformX2 [Glycine max]
Length=426

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 173/229 (76%), Gaps = 40/229 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSVPG+ AYSGQ+GS S  +    T G+ Q YGTSR        
Sbjct  202  WQGPSSYAPLILPQGMVSVPGWSAYSGQMGSDSPQQ----TMGNGQSYGTSRQSEPANSG  257

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++REN+FPERP QPECQFYMKTGDCKFG+VCRFHHPRER+I
Sbjct  258  SQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMI  317

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMGVF Y++S SPS DAP G
Sbjct  318  PAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASPSADAP-G  376

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            + +LGSSSGT AL LSSEGLV++GS NPRRL        PSGD+NI+ E
Sbjct  377  RRMLGSSSGTSALNLSSEGLVESGSANPRRLSLSETRQIPSGDDNIDEE  425


 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ CRFHHPR++        ++ +G PLRP E
Sbjct  73   AARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVAMNILGYPLRPNE  132

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            P C +Y R G CKFG +CKF HP
Sbjct  133  PECAYYLRTGQCKFGNTCKFHHP  155


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 55/98 (56%), Gaps = 12/98 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  35   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  93

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
            + G CKFG +C+F HP           M +  Y L P+
Sbjct  94   KTGTCKFGATCRFHHPRDKAGIAGRVAMNILGYPLRPN  131


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + +LS    P+ P
Sbjct  126  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQ-----PNNMVLSMRSSPVYP  171



>ref|XP_011084651.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Sesamum indicum]
Length=425

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 166/224 (74%), Gaps = 30/224 (13%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PL++PQG+VSVPG+  YSGQLGSV S+E Q   AG+SQ  G S         
Sbjct  202  WQSPSSYAPLVMPQGVVSVPGWNTYSGQLGSVLSSENQHPAAGNSQKDGGSLQNETGDAG  261

Query  156  -------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                         A +R+NVFPERPGQPECQFYMKTGDCKFG+VC+FHHPRERLIP PDC
Sbjct  262  TQFHSGSLPMGYYAFQRDNVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLIPVPDC  321

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllg  476
            +LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPM VF Y+   S STD+PA +  L 
Sbjct  322  ILSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMTVFGYNAGASSSTDSPAIRRFLA  381

Query  477  sssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            SSSGT AL+ S + LV+AGSTN RRL        PSGDNNI++E
Sbjct  382  SSSGTVALSFSPDRLVEAGSTNNRRLSLSETRQKPSGDNNIDSE  425


 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQ ECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  86   YPERIGQSECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNEIECAYYM  145

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  146  RNGQCKFGSTCKFHHP  161


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 56/108 (52%), Gaps = 12/108 (11%)
 Frame = +3

Query  147  TSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLR  326
            T+R       +P R G+P+C +Y++TG C+FGS CRF+HP  R +      +     P R
Sbjct  31   TTREQIDSGPYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARMKG-EYPER  89

Query  327  PGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
             G+  C +Y + G CKFG +CKF HP           + V  Y L P+
Sbjct  90   IGQSECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  137


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (63%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +YM+ G CKFGS C+FHHP+     P + M+S  G  + P
Sbjct  132  YPLRPNEIECAYYMRNGQCKFGSTCKFHHPQ-----PSNMMVSVRGSAVYP  177



>ref|XP_006587810.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Glycine max]
Length=437

 Score =   254 bits (649),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 173/229 (76%), Gaps = 40/229 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSVPG+ AYSGQ+GS S  +    T G+ Q YGTSR        
Sbjct  213  WQGPSSYAPLILPQGMVSVPGWSAYSGQMGSDSPQQ----TMGNGQSYGTSRQSEPANSG  268

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++REN+FPERP QPECQFYMKTGDCKFG+VCRFHHPRER+I
Sbjct  269  SQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMI  328

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMGVF Y++S SPS DAP G
Sbjct  329  PAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASPSADAP-G  387

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            + +LGSSSGT AL LSSEGLV++GS NPRRL        PSGD+NI+ E
Sbjct  388  RRMLGSSSGTSALNLSSEGLVESGSANPRRLSLSETRQIPSGDDNIDEE  436


 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +3

Query  141  YGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLP  320
            Y    A   +  FPER GQPECQ+Y+KTG CKFG+ CRFHHPR++        ++ +G P
Sbjct  79   YQAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVAMNILGYP  138

Query  321  LRPGEPICIFYSRYGICKFGPSCKFDHP  404
            LRP EP C +Y R G CKFG +CKF HP
Sbjct  139  LRPNEPECAYYLRTGQCKFGNTCKFHHP  166


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 55/108 (51%), Gaps = 21/108 (19%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG----------LPLR  326
            +PE PG+P+C +Y++TG C+FG+ CRF+HP  R + P                    P R
Sbjct  35   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLLPDSFFFENYQAIAAARMKGEFPER  94

Query  327  PGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
             G+P C +Y + G CKFG +C+F HP           M +  Y L P+
Sbjct  95   IGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVAMNILGYPLRPN  142


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + +LS    P+ P
Sbjct  137  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQ-----PNNMVLSMRSSPVYP  182



>gb|EYU39704.1| hypothetical protein MIMGU_mgv1a0076882mg [Erythranthe guttata]
Length=398

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 168/224 (75%), Gaps = 30/224 (13%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+ L++PQG+VSVPG+ AYSG +GSV S+E Q+ T G+ Q  G S+        
Sbjct  175  WQSPSSYTQLVMPQGVVSVPGWNAYSGHMGSVLSSESQQPTTGNGQSDGASQQGGSRNTG  234

Query  156  -------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                         A +R+NVFPERPGQPECQFYMKTGDCKFG+VC+FHHPRERL+P PDC
Sbjct  235  SQFHSGSVPMGYYAFQRDNVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRERLMPVPDC  294

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllg  476
            +LSPIGLPLR GEP+C+FYSRYGICKFGPSCKFDHPM VFAY+ + SPSTD+PA +  L 
Sbjct  295  VLSPIGLPLRTGEPLCVFYSRYGICKFGPSCKFDHPMRVFAYNAAASPSTDSPAIRHFLA  354

Query  477  sssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            SS GT AL+ S++GLV+AGSTN RRL         SGDNNIE+E
Sbjct  355  SSQGTVALSYSTDGLVEAGSTNNRRLSLSEARQKSSGDNNIESE  398


 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQ ECQ+Y+KTG CKFG+ C+F HPRE+        L+ +G P+R  E  C +Y 
Sbjct  59   YPERMGQSECQYYLKTGTCKFGATCKFDHPREKAGIAGRVALNVLGYPIRANEMECAYYM  118

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  119  RNGQCKFGSTCKFHHP  134


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = +3

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
            ++P R  +P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+  C +Y
Sbjct  13   LYPVREDEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAKMKG-EYPERMGQSECQYY  71

Query  354  SRYGICKFGPSCKFDHP  404
             + G CKFG +CKFDHP
Sbjct  72   LKTGTCKFGATCKFDHP  88


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (61%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P R  + EC +YM+ G CKFGS C+FHHP+     P + M+S  G  + P
Sbjct  105  YPIRANEMECAYYMRNGQCKFGSTCKFHHPQ-----PSNMMVSLRGSAVYP  150



>ref|XP_008355849.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Malus domestica]
Length=442

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 176/230 (77%), Gaps = 36/230 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+PL+VPQG+VSVPG+ AYSGQLGSVSS EGQ+ TAG+SQ+YGTS+        
Sbjct  214  WQAQSSYTPLIVPQGVVSVPGWNAYSGQLGSVSSPEGQQQTAGNSQMYGTSQQGEPENSG  273

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG VCRFHHPRERLI
Sbjct  274  SQGGFSPYGSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGGVCRFHHPRERLI  333

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSP+GLPLRPGEP+CIFYSRYGICKFGPSCKF+HPMG+F Y+LS S S DAPA 
Sbjct  334  PAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNLSASSSADAPAR  393

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETEE  587
            +  +GS+SG  +L LSSEGLV+AGS  PRRL        PS ++NI+TEE
Sbjct  394  RL-MGSTSGAASLNLSSEGLVEAGSAKPRRLSLSEPRQMPSAEDNIDTEE  442


 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E
Sbjct  85   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGXVALNILGYPLRPNE  144

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  145  VECAYYLRTGQCKFGSTCKFHHP  167


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  47   YPERAGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  105

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>emb|CBI17647.3| unnamed protein product [Vitis vinifera]
Length=304

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 140/179 (78%), Gaps = 29/179 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PLM+PQG+VSVPG+ AYSGQLGS S  E Q+ T G++Q+YGTSR        
Sbjct  106  WQAPSSYAPLMLPQGVVSVPGWNAYSGQLGSPS--ESQQQTGGNNQIYGTSRQSEQPNTG  163

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  164  SQGTFSPYRSGSVPIGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  223

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+FAY+LS S S DAP 
Sbjct  224  PTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFAYNLSASSSADAPV  282


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 55/98 (56%), Gaps = 14/98 (14%)
 Frame = +3

Query  207  QFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPS  386
             +Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y R G CKFG +
Sbjct  13   HYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPDEIDCAYYLRTGQCKFGST  72

Query  387  CKFDHPM---------GVFAYSLS-----PSPSTDAPA  458
            CKF HP          G+  + LS     PSP   AP+
Sbjct  73   CKFHHPQPSSMMVSLRGITNWPLSRASFIPSPRWQAPS  110


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + +C +Y++TG CKFGS C+FHHP+     P   M+S  G+   P
Sbjct  49   YPLRPDEIDCAYYLRTGQCKFGSTCKFHHPQ-----PSSMMVSLRGITNWP  94



>emb|CDP04213.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 168/203 (83%), Gaps = 12/203 (6%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIERENVF  179
            WQGPS+Y+P++VPQ MVSV G+ AYSGQLGS SSAE Q+ TAG+ Q +G    ++RE VF
Sbjct  205  WQGPSSYAPVLVPQSMVSVSGWNAYSGQLGSGSSAESQQQTAGNDQTHGM---LQRETVF  261

Query  180  PERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSR  359
            PERPGQPECQFYMKTGDCKFG+VC+FHHPRER++P PDC+LSPIGLPLRPGEP+CIFYSR
Sbjct  262  PERPGQPECQFYMKTGDCKFGAVCKFHHPRERILPAPDCVLSPIGLPLRPGEPLCIFYSR  321

Query  360  YGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllgsssgtgaltlsseglVDAGST  539
            YGICKFGPSCKFDHPMGVF Y++S S ST+ P  + LLGSSSGTG LTL+SEGLV+A ST
Sbjct  322  YGICKFGPSCKFDHPMGVFTYNVS-SSSTEPPTVRRLLGSSSGTGPLTLASEGLVEASST  380

Query  540  NPR-------RLPSGDNNIETEE  587
              R       R PSGD +I+ EE
Sbjct  381  KSRLLPLSEARKPSGDTSIDPEE  403


 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPREKAGIAGRVTLNALGYPLRPNEIECAYYL  147

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  148  RTGHCKFGSTCKFHHP  163


 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   SR       +P R G+P+C +Y++TG C++G+ CRF+HP  R +      +    
Sbjct  29   QINLRSREPMEAGTYPVREGEPDCSYYIRTGLCRYGATCRFNHPPNRKLAIATARMRG-E  87

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFG +CKF HP
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHP  117


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  134  YPLRPNEIECAYYLRTGHCKFGSTCKFHHPQ-----PANMMVSVRGSPVYP  179



>ref|XP_007139733.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11727.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=408

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 172/229 (75%), Gaps = 40/229 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PL++PQGMVSVPG+ AYSGQ+GS SS +    T G+ Q YGT+R        
Sbjct  184  WQSPSSYAPLILPQGMVSVPGWSAYSGQMGSDSSQQ----TMGNGQSYGTNRQSEPTNAG  239

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A+ REN+FPERP QP+CQFYMKTGDCKFG+VCRFHHPRER+I
Sbjct  240  SQGAYSQFRSGSVPVGFYALPRENIFPERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMI  299

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMGVF Y++S SPS DAP G
Sbjct  300  PAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASPSADAP-G  358

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            + LLGSSSGT AL LSSEGL+++GS NPRRL        PSGD+NI+ E
Sbjct  359  RRLLGSSSGTSALNLSSEGLIESGSANPRRLSLSETRQIPSGDDNIDEE  407


 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ CRFHHPR++        L+ +G PLRP E
Sbjct  55   AARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPLRPNE  114

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            P C +Y R G CKFG +CKF HP
Sbjct  115  PECAYYLRTGQCKFGNTCKFHHP  137


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  17   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  75

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +C+F HP
Sbjct  76   KTGTCKFGATCRFHHP  91


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + +LS    P+ P
Sbjct  108  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQ-----PSNMVLSMRSSPVYP  153



>gb|KHN40466.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=347

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 170/229 (74%), Gaps = 40/229 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSV G+ AYSGQ+GS S  +    T  + Q YGTSR        
Sbjct  123  WQGPSSYAPLILPQGMVSVSGWSAYSGQMGSDSPQQ----TMANGQSYGTSRQSEPANSG  178

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++REN+FPERP QPECQFYMKTGDCKFG+VCRFHHPRER+I
Sbjct  179  SQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERMI  238

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMGVF Y++S SP  DAP G
Sbjct  239  PAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNMSASPLADAP-G  297

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            + +LGSSSGT AL LSSEGLV++GS NPRRL        PSGD+NI+ E
Sbjct  298  RRMLGSSSGTSALNLSSEGLVESGSANPRRLSLSETRQIPSGDDNIDEE  346


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 50/86 (58%), Gaps = 17/86 (20%)
 Frame = +3

Query  147  TSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLR  326
            +S  +E E  +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +               
Sbjct  8    SSETMESE-PYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKL---------------  51

Query  327  PGEPICIFYSRYGICKFGPSCKFDHP  404
              EP C +Y R G CKFG +CKF HP
Sbjct  52   -NEPECGYYLRTGQCKFGNTCKFHHP  76



>ref|XP_007139732.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11726.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=426

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/229 (64%), Positives = 172/229 (75%), Gaps = 40/229 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+PL++PQGMVSVPG+ AYSGQ+GS SS +    T G+ Q YGT+R        
Sbjct  202  WQSPSSYAPLILPQGMVSVPGWSAYSGQMGSDSSQQ----TMGNGQSYGTNRQSEPTNAG  257

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A+ REN+FPERP QP+CQFYMKTGDCKFG+VCRFHHPRER+I
Sbjct  258  SQGAYSQFRSGSVPVGFYALPRENIFPERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMI  317

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMGVF Y++S SPS DAP G
Sbjct  318  PAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASPSADAP-G  376

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            + LLGSSSGT AL LSSEGL+++GS NPRRL        PSGD+NI+ E
Sbjct  377  RRLLGSSSGTSALNLSSEGLIESGSANPRRLSLSETRQIPSGDDNIDEE  425


 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ CRFHHPR++        L+ +G PLRP E
Sbjct  73   AARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPLRPNE  132

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            P C +Y R G CKFG +CKF HP
Sbjct  133  PECAYYLRTGQCKFGNTCKFHHP  155


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  35   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYYL  93

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +C+F HP
Sbjct  94   KTGTCKFGATCRFHHP  109


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + +LS    P+ P
Sbjct  126  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQ-----PSNMVLSMRSSPVYP  171



>ref|XP_009338000.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Pyrus x bretschneideri]
Length=442

 Score =   249 bits (636),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 174/230 (76%), Gaps = 36/230 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+PL+VPQG+VSVPG+ AYSGQLGSVSS E Q+ TAG+SQ+YGTS         
Sbjct  214  WQAQSSYAPLIVPQGVVSVPGWNAYSGQLGSVSSPESQQQTAGNSQMYGTSHQGEPENSG  273

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  274  SQGGFSPYSSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  333

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSP+GLPLRPGEP+CIFYSRYGICKFGPSCKF+HPMG+F  +LS S S DAPA 
Sbjct  334  PAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTLNLSASSSADAPAR  393

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETEE  587
            +  LGS+SG  +L LSSEGLV+AGS  PRRL        PS ++NI+TEE
Sbjct  394  RL-LGSTSGAASLNLSSEGLVEAGSAKPRRLSLSEPRQMPSAEDNIDTEE  442


 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E
Sbjct  85   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGMAGRVALNILGYPLRPNE  144

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  145  VECAYYLRTGQCKFGSTCKFHHP  167


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
             +PER G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y
Sbjct  46   AYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYY  104

Query  354  SRYGICKFGPSCKFDHP  404
             + G CKFG +CKF HP
Sbjct  105  LKTGTCKFGATCKFHHP  121


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S    P+ P
Sbjct  138  YPLRPNEVECAYYLRTGQCKFGSTCKFHHPQ-----PTNMMVSVGASPVYP  183



>ref|XP_009337999.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Pyrus x bretschneideri]
Length=443

 Score =   249 bits (636),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 174/230 (76%), Gaps = 36/230 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+PL+VPQG+VSVPG+ AYSGQLGSVSS E Q+ TAG+SQ+YGTS         
Sbjct  215  WQAQSSYAPLIVPQGVVSVPGWNAYSGQLGSVSSPESQQQTAGNSQMYGTSHQGEPENSG  274

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  275  SQGGFSPYSSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  334

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSP+GLPLRPGEP+CIFYSRYGICKFGPSCKF+HPMG+F  +LS S S DAPA 
Sbjct  335  PAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTLNLSASSSADAPAR  394

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETEE  587
            +  LGS+SG  +L LSSEGLV+AGS  PRRL        PS ++NI+TEE
Sbjct  395  RL-LGSTSGAASLNLSSEGLVEAGSAKPRRLSLSEPRQMPSAEDNIDTEE  443


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP  
Sbjct  85   AARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGMAGRVALNILGYPLRPQN  144

Query  336  PI-CIFYSRYGICKFGPSCKFDHP  404
             + C +Y R G CKFG +CKF HP
Sbjct  145  EVECAYYLRTGQCKFGSTCKFHHP  168


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
             +PER G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y
Sbjct  46   AYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERIGQPECQYY  104

Query  354  SRYGICKFGPSCKFDHP  404
             + G CKFG +CKF HP
Sbjct  105  LKTGTCKFGATCKFHHP  121



>ref|XP_006602842.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=426

 Score =   246 bits (628),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 169/229 (74%), Gaps = 40/229 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSV G+ AYSGQ+GS S  +    T  + Q YGTSR        
Sbjct  202  WQGPSSYAPLILPQGMVSVSGWSAYSGQMGSDSPQQ----TMANGQSYGTSRQSEPANSG  257

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++REN+FPERP QPECQFYMKTGDCKFG+VCRFHHP ER+I
Sbjct  258  SQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPHERMI  317

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMGVF Y++S SP  DAP G
Sbjct  318  PAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNMSASPLADAP-G  376

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            + +LGSSSGT AL LSSEGLV++GS NPRRL        PSGD+NI+ E
Sbjct  377  RRMLGSSSGTSALNLSSEGLVESGSANPRRLSLSETRQIPSGDDNIDEE  425


 Score =   104 bits (259),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ CRFHHPR++        L+ +G PLRP E
Sbjct  73   AARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPLRPNE  132

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            P C +Y R G CKFG +CKF HP
Sbjct  133  PECGYYLRTGQCKFGNTCKFHHP  155


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +3

Query  147  TSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLR  326
            +S  +E E  +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R
Sbjct  26   SSETMESE-PYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPER  83

Query  327  PGEPICIFYSRYGICKFGPSCKFDHP  404
             G+P C +Y + G CKFG +C+F HP
Sbjct  84   IGQPECQYYLKTGTCKFGATCRFHHP  109


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + +LS    P+ P
Sbjct  126  YPLRPNEPECGYYLRTGQCKFGNTCKFHHPQ-----PNNMVLSMRSSPVYP  171



>ref|XP_007029392.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
 gb|EOY09894.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
Length=411

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 169/229 (74%), Gaps = 37/229 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQG+VSVPG+ AYSGQL SVSS+E    T G++Q YGT+         
Sbjct  184  WQGPSSYAPLILPQGVVSVPGWNAYSGQLASVSSSENLLQTNGNNQ-YGTTHQNESATAG  242

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRER++
Sbjct  243  SQASFSQFRSGSVPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVL  302

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKF+HPMG+F Y+ S S  +DAP  
Sbjct  303  PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSTSSPSDAPVH  362

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRR--------LPSGDNNIETE  584
            +  LGSSSGT  L LSSEGLV+AGST  RR        L S D+NI+TE
Sbjct  363  RL-LGSSSGTAGLNLSSEGLVEAGSTKTRRLSLSENRQLSSSDDNIDTE  410


 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 64/106 (60%), Gaps = 9/106 (8%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E
Sbjct  55   AARMKGEFPERAGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNE  114

Query  336  PICIFYSRYGICKFGPSCKFDHPM---------GVFAYSLSPSPST  446
            P C +Y R G CKFG +CKF HP          G   Y   PSP+T
Sbjct  115  PECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVRGSPIYQTVPSPTT  160



>ref|XP_007143976.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
 gb|ESW15970.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
Length=444

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 162/211 (77%), Gaps = 28/211 (13%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQG+VSVPG+ AYSGQ+GS+S+++  +    + Q YGTSR        
Sbjct  216  WQGPSSYAPLILPQGVVSVPGWSAYSGQVGSISNSDSLQQAMRNGQTYGTSRQGELANTG  275

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++REN+FPERPGQPECQFYMKTGDCKFG+VCRFHHP ERLI
Sbjct  276  THGAYSQFRSGTVPVGFYALQRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPHERLI  335

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSP+GLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMG+F Y++S SPS DAP+ 
Sbjct  336  PAPDCVLSPMGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNISASPSADAPSK  395

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL  554
               L SSSGT AL+LSSEGLV++ S  PRRL
Sbjct  396  HL-LRSSSGTAALSLSSEGLVESSSATPRRL  425


 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP EP C +Y 
Sbjct  94   FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQTGIAGRVSLNTLGYPLRPNEPECTYYL  153

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  154  RTGQCKFGNTCKFHHP  169


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 5/43 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + MLS
Sbjct  140  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ-----PSNMMLS  177



>ref|XP_007029391.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
 gb|EOY09893.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
Length=451

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 169/229 (74%), Gaps = 37/229 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQG+VSVPG+ AYSGQL SVSS+E    T G++Q YGT+         
Sbjct  224  WQGPSSYAPLILPQGVVSVPGWNAYSGQLASVSSSENLLQTNGNNQ-YGTTHQNESATAG  282

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRER++
Sbjct  283  SQASFSQFRSGSVPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVL  342

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKF+HPMG+F Y+ S S  +DAP  
Sbjct  343  PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSTSSPSDAPVH  402

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRR--------LPSGDNNIETE  584
            +  LGSSSGT  L LSSEGLV+AGST  RR        L S D+NI+TE
Sbjct  403  RL-LGSSSGTAGLNLSSEGLVEAGSTKTRRLSLSENRQLSSSDDNIDTE  450


 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 64/106 (60%), Gaps = 9/106 (8%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E
Sbjct  95   AARMKGEFPERAGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNE  154

Query  336  PICIFYSRYGICKFGPSCKFDHPM---------GVFAYSLSPSPST  446
            P C +Y R G CKFG +CKF HP          G   Y   PSP+T
Sbjct  155  PECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVRGSPIYQTVPSPTT  200



>gb|KJB82176.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=407

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 162/216 (75%), Gaps = 28/216 (13%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+ L++PQGMVSVPG+ AYSGQL SVSS+E  + T  + Q++GTSR        
Sbjct  179  WQGPSSYASLILPQGMVSVPGWNAYSGQLASVSSSENLQQTNVNHQIHGTSRQNESATAG  238

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPG+PECQFYMKTGDCKFG+VC+FHHPRER++
Sbjct  239  SQASFSELRSSSVPVGVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVL  298

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKF+HPMG+F Y+ SPS  +DAP  
Sbjct  299  PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSPSSPSDAPVH  358

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRLPSGDN  569
             F LGSSSGT  L LSSEGLV+A  T PRRL    N
Sbjct  359  CF-LGSSSGTAGLNLSSEGLVEAVPTKPRRLSLSKN  393


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 55/104 (53%), Gaps = 14/104 (13%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCML-----SPIGLPLRPGEPI  341
            +PERPG+P+C +Y++TG C+FG+ C F+HP  R +      +       +G P    E  
Sbjct  52   YPERPGEPDCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARMKGEFPERVGQPECQNETE  111

Query  342  CIFYSRYGICKFGPSCKFDHPM---------GVFAYSLSPSPST  446
            C +Y R G CKFG +CKF HP          G   Y   PSP+T
Sbjct  112  CAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPIYQTVPSPTT  155


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 11/62 (18%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQ------FYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL  317
            A   +  FPER GQPECQ      +Y++TG CKFGS C+FHHP+     P + M+S  G 
Sbjct  90   AARMKGEFPERVGQPECQNETECAYYLRTGQCKFGSTCKFHHPQ-----PTNMMVSLRGS  144

Query  318  PL  323
            P+
Sbjct  145  PI  146



>gb|KJB75170.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=401

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 171/229 (75%), Gaps = 36/229 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSVP + AY GQL SVSS+E  + T G++Q+YGTSR        
Sbjct  173  WQGPSSYAPLILPQGMVSVPSWNAYGGQLASVSSSENLQQTNGNNQIYGTSRPNESASAG  232

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPG+ ECQFYMKTGDCKFG+VCRFHHPRER++
Sbjct  233  SQALFSQFRSGSAPVGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFHHPRERVL  292

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKF+HPMGVF ++ S S   +AP  
Sbjct  293  PAPDCILSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGVFTFNYSASSPFEAPVH  352

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRR--------LPSGDNNIETE  584
            + LLGSSSG+G + LSSEGLV+AGST PRR        L S D++I+TE
Sbjct  353  R-LLGSSSGSGGINLSSEGLVEAGSTKPRRLSLSENRQLSSSDDSIDTE  400


 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  51   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYL  110

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  111  RTGQCKFGSTCKFHHP  126


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  6    YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAITTARMKG-EFPERVGQPECQYYL  64

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  65   KTGTCKFGATCKFHHP  80



>gb|KJB75168.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=444

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 171/229 (75%), Gaps = 36/229 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSVP + AY GQL SVSS+E  + T G++Q+YGTSR        
Sbjct  216  WQGPSSYAPLILPQGMVSVPSWNAYGGQLASVSSSENLQQTNGNNQIYGTSRPNESASAG  275

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPG+ ECQFYMKTGDCKFG+VCRFHHPRER++
Sbjct  276  SQALFSQFRSGSAPVGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFHHPRERVL  335

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKF+HPMGVF ++ S S   +AP  
Sbjct  336  PAPDCILSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGVFTFNYSASSPFEAPVH  395

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRR--------LPSGDNNIETE  584
            + LLGSSSG+G + LSSEGLV+AGST PRR        L S D++I+TE
Sbjct  396  R-LLGSSSGSGGINLSSEGLVEAGSTKPRRLSLSENRQLSSSDDSIDTE  443


 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  94   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYL  153

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  154  RTGQCKFGSTCKFHHP  169


 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query  126  GSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
            G+ Q+   S        +PERPG+P+C +Y++TG C+FG+ CRF+HP  R +      + 
Sbjct  32   GTWQINLRSSETMEPGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAITTARMK  91

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
                P R G+P C +Y + G CKFG +CKF HP
Sbjct  92   G-EFPERVGQPECQYYLKTGTCKFGATCKFHHP  123



>gb|KJB82177.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=447

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 162/216 (75%), Gaps = 28/216 (13%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+ L++PQGMVSVPG+ AYSGQL SVSS+E  + T  + Q++GTSR        
Sbjct  219  WQGPSSYASLILPQGMVSVPGWNAYSGQLASVSSSENLQQTNVNHQIHGTSRQNESATAG  278

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPG+PECQFYMKTGDCKFG+VC+FHHPRER++
Sbjct  279  SQASFSELRSSSVPVGVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVL  338

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKF+HPMG+F Y+ SPS  +DAP  
Sbjct  339  PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSPSSPSDAPVH  398

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRLPSGDN  569
             F LGSSSGT  L LSSEGLV+A  T PRRL    N
Sbjct  399  CF-LGSSSGTAGLNLSSEGLVEAVPTKPRRLSLSKN  433


 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 63/106 (59%), Gaps = 9/106 (8%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E
Sbjct  90   AARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNE  149

Query  336  PICIFYSRYGICKFGPSCKFDHPM---------GVFAYSLSPSPST  446
              C +Y R G CKFG +CKF HP          G   Y   PSP+T
Sbjct  150  TECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPIYQTVPSPTT  195



>ref|XP_010038283.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Eucalyptus grandis]
 gb|KCW84569.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=429

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 160/230 (70%), Gaps = 43/230 (19%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTS---------  152
            WQGPS+Y+PL+VPQGMVS+PG+ AYSGQLGSVSS++ Q +  G SQ++G+S         
Sbjct  208  WQGPSSYTPLIVPQGMVSIPGWNAYSGQLGSVSSSDSQLIMMGQSQIFGSSGQSDSVNTG  267

Query  153  -----------------RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++R+N+FPERPGQPECQFYMKTGDCKFG+VCRFHHPRERL+
Sbjct  268  SPGAFSSYQSGSMPVGFYALQRDNIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLL  327

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+   +LS S  + AP  
Sbjct  328  PAPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGILN-NLSASSPSGAPVR  386

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETEE  587
            + L  SS     +        ++G  NPRRL        PS D+NI+++E
Sbjct  387  RMLASSSGTAALVLS------ESGPGNPRRLSLSETRQIPS-DDNIDSDE  429


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G P RP E  C +Y 
Sbjct  87   YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYL  146

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  147  RTGQCKFGSTCKFHHP  162


 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 3/105 (3%)
 Frame = +3

Query  96   SSAEGQKLTAGSSQVYGTSRAIE--RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            S A+G  L+   +    T R+ E      +PERPG+P+C +Y++TG C+FG+ CRF+HP 
Sbjct  13   SVADGPSLSPSDAMWQMTLRSNETIESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPS  72

Query  270  ERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            +R +   +  +     P R G+P C +Y + G CKFG +CKF HP
Sbjct  73   DRKLAIANARMKG-EYPERVGQPECQYYLKTGTCKFGATCKFHHP  116


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  133  YPFRPNEMECAYYLRTGQCKFGSTCKFHHPQ-----PTNMMVSLRGSPVYP  178



>gb|KHN14776.1| Zinc finger CCCH domain-containing protein ZFN-like, partial 
[Glycine soja]
Length=405

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 162/209 (78%), Gaps = 26/209 (12%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQG+VSVPG+ AYSGQ+GS+S+++  +    + Q YGTSR        
Sbjct  179  WQGPSSYAPLILPQGVVSVPGWSAYSGQMGSISTSDSPQQAMRNGQTYGTSRQGELAGSQ  238

Query  156  ----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPP  287
                             ++REN+FPERPGQPECQFYMKTGDCKFG+VCRFHHP+ERL+P 
Sbjct  239  GAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLVPA  298

Query  288  PDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            P+C+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPM +F++++S SPS DAP+   
Sbjct  299  PNCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMEIFSHNISASPSADAPSRHL  358

Query  468  llgsssgtgaltlsseglVDAGSTNPRRL  554
             LGSSSGT AL LSSEGLV++ S  PRRL
Sbjct  359  -LGSSSGTAALNLSSEGLVESSSAKPRRL  386


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ   +T  CKFG+ C+FHHP+++        L+ +G PLRP EP C +Y 
Sbjct  66   FPERIGQPECQACTRT--CKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  123

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  124  RTGQCKFGNTCKFHHP  139


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + MLS  G P+ P
Sbjct  110  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ-----PSNMMLSLRGSPVYP  155



>ref|XP_003536159.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Glycine max]
Length=421

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 162/209 (78%), Gaps = 26/209 (12%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQG+VSVPG+ AYSGQ+GS+S+++  +    + Q YGTSR        
Sbjct  195  WQGPSSYAPLILPQGVVSVPGWSAYSGQMGSISTSDSPQQAMRNGQTYGTSRQGELAGSQ  254

Query  156  ----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPP  287
                             ++REN+FPERPGQPECQFYMKTGDCKFG+VCRFHHP+ERL+P 
Sbjct  255  GAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLVPA  314

Query  288  PDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            P+C+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPM +F++++S SPS DAP+   
Sbjct  315  PNCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMEIFSHNISASPSADAPSRHL  374

Query  468  llgsssgtgaltlsseglVDAGSTNPRRL  554
             LGSSSGT AL LSSEGLV++ S  PRRL
Sbjct  375  -LGSSSGTAALNLSSEGLVESSSAKPRRL  402


 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP EP C +Y 
Sbjct  80   FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  139

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  140  RTGQCKFGNTCKFHHP  155


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 52/77 (68%), Gaps = 3/77 (4%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPICIFY  353
            +PERPG+P+C +YM+TG C+FG+ CRF+HP  R +      +  IG  P R G+P C +Y
Sbjct  35   YPERPGEPDCSYYMRTGLCRFGATCRFNHPPNRKLAIATARM--IGEFPERIGQPECQYY  92

Query  354  SRYGICKFGPSCKFDHP  404
             + G CKFG +CKF HP
Sbjct  93   LKTGTCKFGATCKFHHP  109


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + MLS  G P+ P
Sbjct  126  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ-----PSNMMLSLRGSPVYP  171



>ref|XP_008443710.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Cucumis melo]
Length=437

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 163/225 (72%), Gaps = 36/225 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRA-------  158
            WQGPS+Y+ L++PQG++SVPG+ A++ QLGSVSS+E  + T G SQ+Y            
Sbjct  210  WQGPSSYASLILPQGVLSVPGWNAFNDQLGSVSSSESPQQTVGHSQIYEAXYQSEXVDAA  269

Query  159  -------------------IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                               ++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRER++
Sbjct  270  ASVAVSSLICSNCSFGFLPLQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVL  329

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+F Y+LS + S +AP  
Sbjct  330  PAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSAASSANAPV-  388

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNN  572
            Q L G+SSGT AL LSSEGLV+AGS  PRRL        PS D N
Sbjct  389  QHLFGTSSGTTALNLSSEGLVEAGSAKPRRLSISETREMPSDDEN  433


 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  89   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYL  148

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  149  RTGQCKFGNTCKFHHP  164


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 65/124 (52%), Gaps = 19/124 (15%)
 Frame = +3

Query  114  KLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPD  293
            ++  GS ++ G+         +P RPG+P+C +Y++TG C+FG+ CRF+HP  R +    
Sbjct  30   QMNLGSGEIMGSGS-------YPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIAT  82

Query  294  CMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPSP  440
              +     P R G+P C +Y + G CKFG +CKF HP           + +  Y L PS 
Sbjct  83   ARMKG-EFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSE  141

Query  441  STDA  452
            +  A
Sbjct  142  TECA  145


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M+S  G P+ P
Sbjct  135  YPLRPSETECAYYLRTGQCKFGNTCKFHHPQ-----PTNMMVSLRGSPIYP  180



>gb|KEH23393.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=408

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 169/225 (75%), Gaps = 32/225 (14%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-------------SAEGQKLTAGSSQV  140
            WQGPS+Y+PL++PQG+VSVPG++ Y+GQ+GS S             S +G    AG   V
Sbjct  184  WQGPSSYAPLILPQGVVSVPGWSTYNGQMGSDSPQQTMRNDQTYGTSHQGDPENAGLQGV  243

Query  141  YGTSR---------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPD  293
            Y   R         A++REN+FPERP QPECQFYMKTGDCKFG+VCRFHHPRER IP PD
Sbjct  244  YSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPD  303

Query  294  CMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFll  473
            C+LSP+GLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMG+F Y++S SP  +A AG+ LL
Sbjct  304  CVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEA-AGRRLL  362

Query  474  gsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            GSSSGT AL+LSSEGLV++GS  PRRL        PSGD++I+ E
Sbjct  363  GSSSGTAALSLSSEGLVESGSVKPRRLSLSETRPNPSGDDDIDDE  407


 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ CRFHHP+++        L+ +G PLRP E  C +Y 
Sbjct  62   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYL  121

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  122  RTGQCKFGNTCKFHHP  137


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 57/103 (55%), Gaps = 12/103 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  17   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKG-EFPERLGQPECQYYL  75

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPSPSTDA  452
            + G CKFG +C+F HP           + +  Y L P+ S  A
Sbjct  76   KTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECA  118


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + +L   G P+ P
Sbjct  108  YPLRPNESECAYYLRTGQCKFGNTCKFHHPQ-----PSNMVLPMRGSPVYP  153



>ref|XP_003624157.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES80375.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=418

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 169/225 (75%), Gaps = 32/225 (14%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-------------SAEGQKLTAGSSQV  140
            WQGPS+Y+PL++PQG+VSVPG++ Y+GQ+GS S             S +G    AG   V
Sbjct  194  WQGPSSYAPLILPQGVVSVPGWSTYNGQMGSDSPQQTMRNDQTYGTSHQGDPENAGLQGV  253

Query  141  YGTSR---------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPD  293
            Y   R         A++REN+FPERP QPECQFYMKTGDCKFG+VCRFHHPRER IP PD
Sbjct  254  YSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPD  313

Query  294  CMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFll  473
            C+LSP+GLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMG+F Y++S SP  +A AG+ LL
Sbjct  314  CVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEA-AGRRLL  372

Query  474  gsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            GSSSGT AL+LSSEGLV++GS  PRRL        PSGD++I+ E
Sbjct  373  GSSSGTAALSLSSEGLVESGSVKPRRLSLSETRPNPSGDDDIDDE  417


 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ CRFHHP+++        L+ +G PLRP E  C +Y 
Sbjct  72   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYL  131

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGNTCKFHHP  147


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 12/100 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKG-EFPERLGQPECQYYL  85

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPSPS  443
            + G CKFG +C+F HP           + +  Y L P+ S
Sbjct  86   KTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNES  125


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + +L   G P+ P
Sbjct  118  YPLRPNESECAYYLRTGQCKFGNTCKFHHPQ-----PSNMVLPMRGSPVYP  163



>gb|ABD28369.2| Zinc finger, CCCH-type; Sugar transporter superfamily [Medicago 
truncatula]
Length=428

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 169/225 (75%), Gaps = 32/225 (14%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-------------SAEGQKLTAGSSQV  140
            WQGPS+Y+PL++PQG+VSVPG++ Y+GQ+GS S             S +G    AG   V
Sbjct  204  WQGPSSYAPLILPQGVVSVPGWSTYNGQMGSDSPQQTMRNDQTYGTSHQGDPENAGLQGV  263

Query  141  YGTSR---------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPD  293
            Y   R         A++REN+FPERP QPECQFYMKTGDCKFG+VCRFHHPRER IP PD
Sbjct  264  YSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPD  323

Query  294  CMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFll  473
            C+LSP+GLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMG+F Y++S SP  +A AG+ LL
Sbjct  324  CVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEA-AGRRLL  382

Query  474  gsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            GSSSGT AL+LSSEGLV++GS  PRRL        PSGD++I+ E
Sbjct  383  GSSSGTAALSLSSEGLVESGSVKPRRLSLSETRPNPSGDDDIDDE  427


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 54/86 (63%), Gaps = 10/86 (12%)
 Frame = +3

Query  177  FPERPGQPECQ----------FYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLR  326
            FPER GQPECQ          +Y+KTG CKFG+ CRFHHP+++        L+ +G PLR
Sbjct  72   FPERLGQPECQASVNECCIMHYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLR  131

Query  327  PGEPICIFYSRYGICKFGPSCKFDHP  404
            P E  C +Y R G CKFG +CKF HP
Sbjct  132  PNESECAYYLRTGQCKFGNTCKFHHP  157


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 57/113 (50%), Gaps = 22/113 (19%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICI---  347
            +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C    
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKG-EFPERLGQPECQASV  85

Query  348  -------FYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPSPSTDA  452
                   +Y + G CKFG +C+F HP           + +  Y L P+ S  A
Sbjct  86   NECCIMHYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECA  138


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + +L   G P+ P
Sbjct  128  YPLRPNESECAYYLRTGQCKFGNTCKFHHPQ-----PSNMVLPMRGSPVYP  173



>ref|XP_006606434.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Glycine max]
Length=356

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 169/229 (74%), Gaps = 36/229 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAE-----------------GQKLTAG  128
            WQGPS+Y PL++PQG+VSVPG+ AYSGQ+GS+S+++                 G+   AG
Sbjct  127  WQGPSSYGPLILPQGVVSVPGWSAYSGQMGSISTSDSPQQAMRNGQTYETSHQGELANAG  186

Query  129  SSQVYGTSRA---------IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
            S   Y   R+         ++REN+FPERPGQPECQFY+KTGDCKFG+VC+FHHPRERLI
Sbjct  187  SQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLI  246

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLR GEP+C+FYSRYGICKFGPSCKFDHPM +F+Y+++ SPS DAP+ 
Sbjct  247  PAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMEIFSYNITTSPSADAPSR  306

Query  462  QFllgsssgtgaltlsseglVDAGSTNP--------RRLPSGDNNIETE  584
               LGSSSGT AL LSSEGLV++ S  P        R++PSGD+NI+ +
Sbjct  307  HL-LGSSSGTAALNLSSEGLVESSSAKPRPLSLSEIRQIPSGDDNIDDD  354


 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP EP C +Y 
Sbjct  5    FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  64

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  65   RTGQCKFGNTCKFHHP  80


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + MLS  G P+ P
Sbjct  51   YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ-----PSNMMLSLRGSPVYP  96



>gb|ACC85690.1| zinc finger protein [Medicago sativa]
 gb|AFP86282.1| zinc finger protein [Medicago sativa]
Length=418

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 169/225 (75%), Gaps = 32/225 (14%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-------------SAEGQKLTAGSSQV  140
            WQGPS+Y+PL++PQG+VSVPG++ Y+GQ+GS S             S +G    AG   V
Sbjct  194  WQGPSSYAPLILPQGVVSVPGWSTYNGQMGSDSPQQTMRNDQTYGTSHQGDPENAGLPGV  253

Query  141  YGTSR---------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPD  293
            Y   R         A++REN+FPERP QPECQFYMKTGDCKFG+VCRFHHPRER IP PD
Sbjct  254  YSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAPD  313

Query  294  CMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFll  473
            C+LSP+GLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMG+F Y++S SP  +A AG+ LL
Sbjct  314  CVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEA-AGRRLL  372

Query  474  gsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            GSSSGT AL+LSSEGLV++GS  PRRL        PSGD++I+ E
Sbjct  373  GSSSGTAALSLSSEGLVESGSVKPRRLSLSETRPNPSGDDDIDDE  417


 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ CRFHHP+++        L+ +G PLRP E  C +Y 
Sbjct  72   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYL  131

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGNTCKFHHP  147


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 12/100 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKG-EFPERLGQPECQYYL  85

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPSPS  443
            + G CKFG +C+F HP           + +  Y L P+ S
Sbjct  86   KTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNES  125


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + +L   G P+ P
Sbjct  118  YPLRPNESECAYYLRTGQCKFGNTCKFHHPQ-----PSNMVLPMRGSPVYP  163



>gb|KHN04981.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=428

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 169/229 (74%), Gaps = 36/229 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAE-----------------GQKLTAG  128
            WQGPS+Y PL++PQG+VSVPG+ AYSGQ+GS+S+++                 G+   AG
Sbjct  199  WQGPSSYGPLILPQGVVSVPGWSAYSGQMGSISTSDSPQQAMRNGQTYETSHQGELANAG  258

Query  129  SSQVYGTSRA---------IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
            S   Y   R+         ++REN+FPERPGQPECQFY+KTGDCKFG+VC+FHHPRERLI
Sbjct  259  SQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLI  318

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLR GEP+C+FYSRYGICKFGPSCKFDHPM +F+Y+++ SPS DAP+ 
Sbjct  319  PAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMEIFSYNITASPSADAPSR  378

Query  462  QFllgsssgtgaltlsseglVDAGSTNP--------RRLPSGDNNIETE  584
               LGSSSGT AL LSSEGLV++ S  P        R++PSGD+NI+ +
Sbjct  379  HL-LGSSSGTAALNLSSEGLVESSSAKPRPLSLSEIRQIPSGDDNIDDD  426


 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ   +T  CKFG+ C+FHHP+++        L+ +G PLRP EP C +Y 
Sbjct  79   FPERIGQPECQ--ARTRTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  136

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  137  RTGQCKFGNTCKFHHP  152


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + MLS  G P+ P
Sbjct  123  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ-----PSNMMLSLRGSPVYP  168



>ref|XP_006606433.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=430

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 169/229 (74%), Gaps = 36/229 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAE-----------------GQKLTAG  128
            WQGPS+Y PL++PQG+VSVPG+ AYSGQ+GS+S+++                 G+   AG
Sbjct  201  WQGPSSYGPLILPQGVVSVPGWSAYSGQMGSISTSDSPQQAMRNGQTYETSHQGELANAG  260

Query  129  SSQVYGTSRA---------IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
            S   Y   R+         ++REN+FPERPGQPECQFY+KTGDCKFG+VC+FHHPRERLI
Sbjct  261  SQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLI  320

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLR GEP+C+FYSRYGICKFGPSCKFDHPM +F+Y+++ SPS DAP+ 
Sbjct  321  PAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMEIFSYNITTSPSADAPSR  380

Query  462  QFllgsssgtgaltlsseglVDAGSTNP--------RRLPSGDNNIETE  584
               LGSSSGT AL LSSEGLV++ S  P        R++PSGD+NI+ +
Sbjct  381  HL-LGSSSGTAALNLSSEGLVESSSAKPRPLSLSEIRQIPSGDDNIDDD  428


 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP EP C +Y 
Sbjct  79   FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  138

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  139  RTGQCKFGNTCKFHHP  154


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP +PEC +Y++TG CKFG+ C+FHHP+     P + MLS  G P+ P
Sbjct  125  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ-----PSNMMLSLRGSPVYP  170



>gb|ADN33845.1| nucleic acid binding protein [Cucumis melo subsp. melo]
Length=367

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 156/199 (78%), Gaps = 24/199 (12%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIERENVF  179
            WQGPS+Y+ L++PQG++SVPG+ A++ QLGSVSS+E  + T              RENVF
Sbjct  180  WQGPSSYASLILPQGVLSVPGWNAFNDQLGSVSSSESPQQT--------------RENVF  225

Query  180  PERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSR  359
            PERPGQPECQFYMKTGDCKFG+VCRFHHPRER++P PDC+LSPIGLPLRPGEP+CIFYSR
Sbjct  226  PERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSR  285

Query  360  YGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllgsssgtgaltlsseglVDAGST  539
            YGICKFGPSCKFDHPMG+F Y+LS + S +AP  Q L G+SSGT AL LSSEGLV+AGS 
Sbjct  286  YGICKFGPSCKFDHPMGIFTYNLSAASSANAPV-QHLFGTSSGTTALNLSSEGLVEAGSA  344

Query  540  NPRRL--------PSGDNN  572
             PRRL        PS D N
Sbjct  345  KPRRLSISETREMPSDDEN  363


 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  59   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYL  118

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  119  RTGQCKFGNTCKFHHP  134


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 19/123 (15%)
 Frame = +3

Query  117  LTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
            +  GS ++ G+         +P RPG+P+C +Y++TG C+FG+ CRF+HP  R +     
Sbjct  1    MNLGSGEIMGSGS-------YPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATA  53

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPSPS  443
             +     P R G+P C +Y + G CKFG +CKF HP           + +  Y L PS +
Sbjct  54   RMKG-EFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSET  112

Query  444  TDA  452
              A
Sbjct  113  ECA  115


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M+S  G P+ P
Sbjct  105  YPLRPSETECAYYLRTGQCKFGNTCKFHHPQ-----PTNMMVSLRGSPIYP  150



>ref|XP_010673925.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=459

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 170/230 (74%), Gaps = 40/230 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+P+++PQG+VSVPG+ AY GQ+GS    +GQ+ T G+S  YGT+R        
Sbjct  235  WQGPSSYTPMILPQGVVSVPGWNAYMGQMGS----DGQQQTPGNSPGYGTARQSESPVSA  290

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++R+NVFPERPGQPECQ+YMKTGDCKFG+VCRFHHPRERLI
Sbjct  291  SQGAYSSYRSGSVPVGYYALQRDNVFPERPGQPECQYYMKTGDCKFGAVCRFHHPRERLI  350

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LS +GLPLRPGEP+CIFYSRYGICKFGP+CKFDHPMG+FAY++SP+ +TDA A 
Sbjct  351  PAPDCLLSALGLPLRPGEPLCIFYSRYGICKFGPNCKFDHPMGIFAYNVSPT-ATDASAM  409

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRLP--------SGDNNIETEE  587
            +  LGSSS +G LTL+SEGLV++G    RRL         S D+NIET+ 
Sbjct  410  RRYLGSSSASGGLTLTSEGLVESGPGKNRRLTLSETRDIQSSDDNIETDR  459


 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+F+HP+++        L+ +G PLRP EP C +Y 
Sbjct  113  FPERTGQPECQYYLKTGTCKFGATCKFNHPKDKAGIAGRVPLNVLGYPLRPNEPECAYYL  172

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  173  RTGQCKFGSTCKFHHP  188


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 55/98 (56%), Gaps = 12/98 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+ +C FY++TG C+FGS CRF+HP  R +      +     P R G+P C +Y 
Sbjct  68   YPEREGEADCSFYLRTGLCRFGSTCRFNHPPNRKLALATARMKG-EFPERTGQPECQYYL  126

Query  357  RYGICKFGPSCKFDH-----------PMGVFAYSLSPS  437
            + G CKFG +CKF+H           P+ V  Y L P+
Sbjct  127  KTGTCKFGATCKFNHPKDKAGIAGRVPLNVLGYPLRPN  164


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            +P RP +PEC +Y++TG CKFGS C+FHHP+         +  P+  P  PG+
Sbjct  159  YPLRPNEPECAYYLRTGQCKFGSTCKFHHPQPSASFRGSSVYPPVQSPTTPGQ  211



>ref|XP_004142565.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Cucumis sativus]
 gb|KGN66679.1| hypothetical protein Csa_1G659020 [Cucumis sativus]
Length=367

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 156/199 (78%), Gaps = 24/199 (12%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIERENVF  179
            WQGPS+Y+ L++PQG++SVPG+ A++ QLGSVSS+E  + T              RENVF
Sbjct  180  WQGPSSYASLILPQGVLSVPGWNAFNDQLGSVSSSESPQQT--------------RENVF  225

Query  180  PERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSR  359
            PERPGQPECQFYMKTGDCKFG+VCRFHHPRER++P PDC+LSPIGLPLRPGEP+CIFYSR
Sbjct  226  PERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSR  285

Query  360  YGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllgsssgtgaltlsseglVDAGST  539
            YGICKFGPSCKFDHPMG+F Y+LS + S +AP  Q L G+SSGT AL LSSEGLV+AGS 
Sbjct  286  YGICKFGPSCKFDHPMGIFTYNLSAASSANAPV-QHLFGTSSGTTALNLSSEGLVEAGSA  344

Query  540  NPRRL--------PSGDNN  572
             PRRL        PS D N
Sbjct  345  KPRRLSISESREMPSDDEN  363


 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  59   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYL  118

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  119  RTGQCKFGNTCKFHHP  134


 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 19/123 (15%)
 Frame = +3

Query  117  LTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
            +  GS ++ G+         +P RPG+P+C +Y++TG C+FG+ CRF+HP  R +     
Sbjct  1    MNLGSGEIMGSGS-------YPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATA  53

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPSPS  443
             +     P R G+P C +Y + G CKFG +CKF HP           + +  Y L PS +
Sbjct  54   RMKG-EFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSET  112

Query  444  TDA  452
              A
Sbjct  113  ECA  115


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M+S  G P+ P
Sbjct  105  YPLRPSETECAYYLRTGQCKFGNTCKFHHPQ-----PTNMMVSLRGSPIYP  150



>gb|KHG30243.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=347

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 162/229 (71%), Gaps = 39/229 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSVPG+ AYS    SVSS+E  + T G++Q+YGTS         
Sbjct  122  WQGPSSYAPLILPQGMVSVPGWNAYSA---SVSSSENLQQTNGNNQIYGTSNQNESVTGG  178

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A+ RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRER+ 
Sbjct  179  SQASFSQFRSGSVPIGFYALPRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVP  238

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+C FYSRYGICKFG SCKF+HPMG+F Y+ S S  + AP  
Sbjct  239  PAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGSSCKFNHPMGIFTYNYSISSPSGAPVH  298

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRR--------LPSGDNNIETE  584
             F LGSSSGT  L LSSEGLV++GST PRR        L S D NI+ E
Sbjct  299  HF-LGSSSGTSGLNLSSEGLVESGSTKPRRISLSENRQLSSSDENIDAE  346


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +3

Query  207  QFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPS  386
            ++Y+KTG CKFG+ C+FHHPRE+        L+ +G P RP E  C +Y R G CKFG +
Sbjct  10   RYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNETECAYYLRTGQCKFGST  69

Query  387  CKFDHP  404
            CKF HP
Sbjct  70   CKFHHP  75


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  46   YPFRPNETECAYYLRTGQCKFGSTCKFHHPQ-----PTNMMISLRGSPIYP  91



>gb|KJB26822.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=370

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 161/229 (70%), Gaps = 39/229 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSVPG+ AYS    SVSS+E  + T G++Q+YGTS         
Sbjct  145  WQGPSSYAPLILPQGMVSVPGWNAYSA---SVSSSENLQQTNGNNQIYGTSNQNESVTGG  201

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A+ RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRER+ 
Sbjct  202  SQASFSQFRSGSVPIGFYALPRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVP  261

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+C FYSRYGICKFGPSCKF+HPMG+F Y+ S S  + AP  
Sbjct  262  PAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGPSCKFNHPMGIFTYNYSISSPSGAPVH  321

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRR--------LPSGDNNIETE  584
               L SSSGT  L LSSEGLV++GST  RR        L S D NI+TE
Sbjct  322  HL-LESSSGTSGLNLSSEGLVESGSTKLRRISLSENRQLSSSDENIDTE  369


 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G P RP E
Sbjct  16   AARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNE  75

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  76   TECAYYLRTGQCKFGSTCKFHHP  98


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  69   YPFRPNETECAYYLRTGQCKFGSTCKFHHPQ-----PTNMMISLRGSPIYP  114



>gb|KJB26823.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=449

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 161/229 (70%), Gaps = 39/229 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSVPG+ AYS    SVSS+E  + T G++Q+YGTS         
Sbjct  224  WQGPSSYAPLILPQGMVSVPGWNAYSA---SVSSSENLQQTNGNNQIYGTSNQNESVTGG  280

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A+ RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHPRER+ 
Sbjct  281  SQASFSQFRSGSVPIGFYALPRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVP  340

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LSPIGLPLRPGEP+C FYSRYGICKFGPSCKF+HPMG+F Y+ S S  + AP  
Sbjct  341  PAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGPSCKFNHPMGIFTYNYSISSPSGAPVH  400

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRR--------LPSGDNNIETE  584
               L SSSGT  L LSSEGLV++GST  RR        L S D NI+TE
Sbjct  401  HL-LESSSGTSGLNLSSEGLVESGSTKLRRISLSENRQLSSSDENIDTE  448


 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  FPER GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G P RP E
Sbjct  95   AARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNE  154

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  155  TECAYYLRTGQCKFGSTCKFHHP  177


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  57   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMKG-EFPERVGQPECQYYL  115

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  116  KTGTCKFGATCKFHHP  131


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  148  YPFRPNETECAYYLRTGQCKFGSTCKFHHPQ-----PTNMMISLRGSPIYP  193



>gb|KDO47608.1| hypothetical protein CISIN_1g0472482mg, partial [Citrus sinensis]
Length=201

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 150/201 (75%), Gaps = 33/201 (16%)
 Frame = +3

Query  78   GQLGSVSSAEGQKLTAGSSQVYGTSR--------------------------AIERENVF  179
            GQLGSVSS+E  + T+G+SQ+YG SR                          A++RE+VF
Sbjct  1    GQLGSVSSSENLQQTSGNSQIYGASRQTEPSNSGSQGTMSSFRSGSVPVGFYALQRESVF  60

Query  180  PERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSR  359
            PERPGQPECQFYMKTGDCKFG+VCRFHHPRERL+P PDC+LSPIGLPLRPGEP+CIFYSR
Sbjct  61   PERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSR  120

Query  360  YGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllgsssgtgaltlsseglVDAGST  539
            YGICKFGPSCKFDHPMG+F Y+LS S S DAP  +F LGSSS TGAL LSSEGLV+AGS 
Sbjct  121  YGICKFGPSCKFDHPMGIFTYNLSASSSADAPVRRF-LGSSSATGALNLSSEGLVEAGSG  179

Query  540  ------NPRRLPSGDNNIETE  584
                    R++ SGD+ I+TE
Sbjct  180  RRLSLPETRQMSSGDDEIDTE  200



>sp|Q9SWF9.1|ZFNL_PEA RecName: Full=Zinc finger CCCH domain-containing protein ZFN-like 
[Pisum sativum]
 gb|AAD45720.1| zinc finger protein [Pisum sativum]
Length=417

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 166/225 (74%), Gaps = 33/225 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-------------SAEGQKLTAGSSQV  140
            WQGPS+Y+PL++PQG+VSVPG++ Y GQ+GS S             S +G+   AG    
Sbjct  194  WQGPSSYAPLILPQGVVSVPGWSTYGGQMGSESPQQTMRNDQTYGTSHQGELENAGLQGA  253

Query  141  YGTSR---------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPD  293
            Y   R         A++R+N+FPERP QPECQFYMKTGDCKFG+VCRFHHPRER IP PD
Sbjct  254  YSQYRSGSVPVGFYALQRDNIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERQIPAPD  313

Query  294  CMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFll  473
            C+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPMG+F Y+++ SP  D P G+ LL
Sbjct  314  CVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVA-SPLADTP-GRRLL  371

Query  474  gsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            GSSSGT AL+LSSEGLV++G+  PRRL        P GD+NI+ E
Sbjct  372  GSSSGTAALSLSSEGLVESGTAKPRRLSLSETRPIPPGDDNIDDE  416


 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ CRFHHP+++        L+ +G PLRP E    +Y 
Sbjct  72   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESERAYYL  131

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGNTCKFHHP  147


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 57/103 (55%), Gaps = 12/103 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE PG+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMKG-EFPERLGQPECQYYL  85

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPSPSTDA  452
            + G CKFG +C+F HP           + +  Y L P+ S  A
Sbjct  86   KTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESERA  128



>ref|XP_011077184.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077185.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077186.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
Length=417

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 157/224 (70%), Gaps = 33/224 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIE-----  164
            WQ PS+Y+PL + QG+ S PG+  YSGQ+  VS +E Q+   G+ Q  GTS  +E     
Sbjct  197  WQTPSSYAPLFMSQGVASAPGWNTYSGQVEPVSPSENQQ---GNIQNDGTSYQVEGLNVG  253

Query  165  ----------------RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                            R+NVFPERPGQP+CQFYMKTGDCKFG+VC+FHHPRERLIP PDC
Sbjct  254  SQFGSNTLPIGYYAFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDC  313

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllg  476
            +LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPM VFA++ + S STD  A +  + 
Sbjct  314  VLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFAHNAAASASTDGNAVRDFIA  373

Query  477  sssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             S GT A++ S +GLV AGSTN +RL        PSGDNNI TE
Sbjct  374  PSPGTLAISFSPDGLVGAGSTNNQRLSFSESRQKPSGDNNIVTE  417


 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPR+ L       L+ +G PLRP E  C +Y 
Sbjct  82   YPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCAYYI  141

Query  357  RYGICKFGPSCKFDHP  404
            R G+CKFG +CKF HP
Sbjct  142  RNGLCKFGRTCKFHHP  157


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 12/98 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P R G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  37   YPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARMKS-EYPERIGQPECQYYL  95

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
            + G CKFG +CKF HP           + V  Y L P+
Sbjct  96   KTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPN  133



>ref|XP_006848460.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
 gb|ERN10041.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
Length=467

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 150/227 (66%), Gaps = 35/227 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIE-----  164
            WQGPS+Y+ L++PQGMV VPG+  YSGQLGS SS++ Q+   G+ Q YGT R  E     
Sbjct  228  WQGPSSYAQLILPQGMVPVPGWNTYSGQLGSASSSDTQQ-PPGTGQSYGTPRQTETGGAS  286

Query  165  --------------------RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                                RENVFPERP QPECQFYMKTGDCKFG++C+FHHPRERL+P
Sbjct  287  SPGAFPFRSSSVPMGLFPLQRENVFPERPDQPECQFYMKTGDCKFGAMCKFHHPRERLLP  346

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+CMLSP+GLPLRPGEP+CIFYSRYGICKFGP+CKFDHPMG FAY+LS S S D P  +
Sbjct  347  VPNCMLSPMGLPLRPGEPLCIFYSRYGICKFGPTCKFDHPMGPFAYNLSTS-SADVPVRR  405

Query  465  FllgsssgtgaltlsseglVDAGS-------TNPRRLPSGDNNIETE  584
             L  SS               A         + PR++PSGD +IETE
Sbjct  406  LLGSSSGTPALSLSPEVSGEAAVGKSRRIPLSEPRQIPSGDESIETE  452


 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPR++       +L+ +G PLRP E  C +Y 
Sbjct  105  YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVLLNILGYPLRPNEKECAYYL  164

Query  357  RYGICKFGPSCKFDHPMGVFAYSLSPSP  440
            R G CKFG +CKF HP      SL  SP
Sbjct  165  RTGQCKFGSTCKFHHPQPNAMVSLRGSP  192


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+ +C +Y++TG C+FG  CRF+HP  R +      +   G P R G+P C +Y 
Sbjct  60   YPERPGEIDCAYYIRTGLCRFGMTCRFNHPPNRKLAVAAARIK-GGYPERVGQPECQYYL  118

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  119  KTGTCKFGATCKFHHP  134



>ref|XP_010673926.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 167/230 (73%), Gaps = 42/230 (18%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+P+++PQG+VSVPG+ AY      +  ++GQ+ T G+S  YGT+R        
Sbjct  235  WQGPSSYTPMILPQGVVSVPGWNAY------MMGSDGQQQTPGNSPGYGTARQSESPVSA  288

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++R+NVFPERPGQPECQ+YMKTGDCKFG+VCRFHHPRERLI
Sbjct  289  SQGAYSSYRSGSVPVGYYALQRDNVFPERPGQPECQYYMKTGDCKFGAVCRFHHPRERLI  348

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P PDC+LS +GLPLRPGEP+CIFYSRYGICKFGP+CKFDHPMG+FAY++SP+ +TDA A 
Sbjct  349  PAPDCLLSALGLPLRPGEPLCIFYSRYGICKFGPNCKFDHPMGIFAYNVSPT-ATDASAM  407

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRLP--------SGDNNIETEE  587
            +  LGSSS +G LTL+SEGLV++G    RRL         S D+NIET+ 
Sbjct  408  RRYLGSSSASGGLTLTSEGLVESGPGKNRRLTLSETRDIQSSDDNIETDR  457


 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+F+HP+++        L+ +G PLRP EP C +Y 
Sbjct  113  FPERTGQPECQYYLKTGTCKFGATCKFNHPKDKAGIAGRVPLNVLGYPLRPNEPECAYYL  172

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  173  RTGQCKFGSTCKFHHP  188


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 55/98 (56%), Gaps = 12/98 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+ +C FY++TG C+FGS CRF+HP  R +      +     P R G+P C +Y 
Sbjct  68   YPEREGEADCSFYLRTGLCRFGSTCRFNHPPNRKLALATARMKG-EFPERTGQPECQYYL  126

Query  357  RYGICKFGPSCKFDH-----------PMGVFAYSLSPS  437
            + G CKFG +CKF+H           P+ V  Y L P+
Sbjct  127  KTGTCKFGATCKFNHPKDKAGIAGRVPLNVLGYPLRPN  164


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            +P RP +PEC +Y++TG CKFGS C+FHHP+         +  P+  P  PG+
Sbjct  159  YPLRPNEPECAYYLRTGQCKFGSTCKFHHPQPSASFRGSSVYPPVQSPTTPGQ  211



>ref|XP_011077187.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Sesamum indicum]
Length=407

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 157/224 (70%), Gaps = 33/224 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIE-----  164
            WQ PS+Y+PL + QG+ S PG+  YSGQ+  VS +E Q+   G+ Q  GTS  +E     
Sbjct  187  WQTPSSYAPLFMSQGVASAPGWNTYSGQVEPVSPSENQQ---GNIQNDGTSYQVEGLNVG  243

Query  165  ----------------RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                            R+NVFPERPGQP+CQFYMKTGDCKFG+VC+FHHPRERLIP PDC
Sbjct  244  SQFGSNTLPIGYYAFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDC  303

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllg  476
            +LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPM VFA++ + S STD  A +  + 
Sbjct  304  VLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFAHNAAASASTDGNAVRDFIA  363

Query  477  sssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
             S GT A++ S +GLV AGSTN +RL        PSGDNNI TE
Sbjct  364  PSPGTLAISFSPDGLVGAGSTNNQRLSFSESRQKPSGDNNIVTE  407


 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPR+ L       L+ +G PLRP E  C +Y 
Sbjct  72   YPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCAYYI  131

Query  357  RYGICKFGPSCKFDHP  404
            R G+CKFG +CKF HP
Sbjct  132  RNGLCKFGRTCKFHHP  147


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 12/98 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P R G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  27   YPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARMKS-EYPERIGQPECQYYL  85

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
            + G CKFG +CKF HP           + V  Y L P+
Sbjct  86   KTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPN  123



>ref|XP_010245962.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Nelumbo nucifera]
Length=457

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 163/229 (71%), Gaps = 35/229 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQG S+Y+ L++PQG+VSVP + AY+GQLGSVSS+E Q+ T  SSQ YGTSR        
Sbjct  214  WQGLSSYAQLILPQGVVSVPNWNAYTGQLGSVSSSESQQQTVVSSQFYGTSRQSDTTSVG  273

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RE+VFPERP QPECQFYMKTGDCKFG+VCRFHHPRERLI
Sbjct  274  VQGTFPSYRSGSVPVGLYALQRESVFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERLI  333

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P P+C+LSP+GLPLRPGEP+CIFYSRYGICKFGP+CKFDHPMG F YSLS   STD P  
Sbjct  334  PVPNCVLSPLGLPLRPGEPLCIFYSRYGICKFGPNCKFDHPMGPFTYSLSAFSSTDVPVI  393

Query  462  QFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            +  LGSSSGT AL LSSEG ++AGS    RL         S D NI+ E
Sbjct  394  RRSLGSSSGTTALPLSSEGPLEAGSGKSXRLSLSKTQQMSSHDENIDAE  442


 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP E  C +Y 
Sbjct  90   YPERIGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVPLNILGYPLRPNERECAYYL  149

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  150  RTGQCKFGNTCKFHHP  165


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPICIFY  353
            +PERPG+ +C +Y++TG C+FG  CRF+HP  R +      +  IG  P R G+P C +Y
Sbjct  45   YPERPGELDCAYYVRTGLCRFGMTCRFNHPPNRKLAVVAARM--IGSYPERIGQPECQYY  102

Query  354  SRYGICKFGPSCKFDHP  404
             + G CKFG +CKF HP
Sbjct  103  LKTGTCKFGATCKFHHP  119


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + ++S  G P+ P
Sbjct  136  YPLRPNERECAYYLRTGQCKFGNTCKFHHPQ-----PSNTVVSLPGSPVYP  181



>ref|XP_010929828.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Elaeis guineensis]
Length=380

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 38/231 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+ L++PQG+V VPG+  Y GQ+GS SS + Q+ T G++Q Y T+         
Sbjct  136  WQDPSSYTQLILPQGLVQVPGWNPYPGQMGS-SSPDSQQQTPGAAQYYSTTHQSETSAGA  194

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++REN+FPERP QPECQFYMKTGDCKFG+VC+FHHPRERL+P
Sbjct  195  QGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVP  254

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C+LSP+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG F Y +S S + D P  +
Sbjct  255  VPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGTFTYGISTSSTADVPTVR  314

Query  465  FllgsssgtgaltlsseglVDAGSTNP-----------RRLPSGDNNIETE  584
             L+GSSSG  ALT SSEG  DAG   P           R++ +GD N+E E
Sbjct  315  RLIGSSSGPPALTSSSEGPADAGMGKPRDSRRLSLSESRQIGTGDENLEAE  365


 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP E  C +Y 
Sbjct  12   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYI  71

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  72   RTGQCKFGNTCKFHHP  87


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M++  G P+ P
Sbjct  58   YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQ-----PSNAMVALRGSPVYP  103



>gb|KCW84568.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=419

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/229 (54%), Positives = 151/229 (66%), Gaps = 51/229 (22%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTS----------  152
            WQGPS+Y+PL+VPQGM         GQLGSVSS++ Q +  G SQ++G+S          
Sbjct  208  WQGPSSYTPLIVPQGM---------GQLGSVSSSDSQLIMMGQSQIFGSSGQSDSVNTGS  258

Query  153  ----------------RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++R+N+FPERPGQPECQFYMKTGDCKFG+VCRFHHPRERL+P
Sbjct  259  PGAFSSYQSGSMPVGFYALQRDNIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLP  318

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             PDC+LSPIGLPLRPGEP+CIFYSRYGICKFGPSCKFDHPMG+   +LS S  + AP  +
Sbjct  319  APDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGILN-NLSASSPSGAPVRR  377

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETEE  587
             L  SS     +        ++G  NPRRL        PS D+NI+++E
Sbjct  378  MLASSSGTAALVLS------ESGPGNPRRLSLSETRQIPS-DDNIDSDE  419


 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G P RP E  C +Y 
Sbjct  87   YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYL  146

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  147  RTGQCKFGSTCKFHHP  162


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 3/105 (3%)
 Frame = +3

Query  96   SSAEGQKLTAGSSQVYGTSRAIE--RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            S A+G  L+   +    T R+ E      +PERPG+P+C +Y++TG C+FG+ CRF+HP 
Sbjct  13   SVADGPSLSPSDAMWQMTLRSNETIESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPS  72

Query  270  ERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            +R +   +  +     P R G+P C +Y + G CKFG +CKF HP
Sbjct  73   DRKLAIANARMKG-EYPERVGQPECQYYLKTGTCKFGATCKFHHP  116


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  133  YPFRPNEMECAYYLRTGQCKFGSTCKFHHPQ-----PTNMMVSLRGSPVYP  178



>ref|XP_010927660.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927662.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927663.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=467

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 165/232 (71%), Gaps = 38/232 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+ L++PQG+V VP + AY G LGSVSS+E Q+ T G+ Q+YG+SR        
Sbjct  221  WQGPSSYAQLILPQGLVQVPSWNAYPGHLGSVSSSESQQQTPGTVQMYGSSRPSETSVGV  280

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++R+NVFPERP QPECQFYMKTGDCKFG+ C+FHHP+ERL+P
Sbjct  281  QGTMSSYRSSSTPMGQYALQRDNVFPERPDQPECQFYMKTGDCKFGAACKFHHPKERLVP  340

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH----PMGVFAYSLSPSPSTDA  452
             P+C+LSP+GLPLRPGEP+C+FYSRYGICKFGP+CKFDH    PMG+FAYSLS S S DA
Sbjct  341  APNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMATPMGIFAYSLSTSLSADA  400

Query  453  PAGQFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            P  + LL SSSG  AL+LSSE  V+A + N RRL         SGD ++E E
Sbjct  401  PVVRRLLASSSGPPALSLSSEHPVEASTGNSRRLSMSESRQMASGDEDVEAE  452


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G P+RP E  C +Y 
Sbjct  98   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNNLGYPIRPNEKECAYYL  157

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  158  RTGQCKFGNTCKFHHP  173


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 59/92 (64%), Gaps = 5/92 (5%)
 Frame = +3

Query  150  SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            S ++E   ++PERPG+P+C +Y++TG C++G  CR++HP +R +      +   G P R 
Sbjct  45   SESVE-SGLYPERPGEPDCAYYLRTGLCRYGLTCRYNHPPDRKLAIAAARIRG-GYPERV  102

Query  330  GEPICIFYSRYGICKFGPSCKFDHP---MGVF  416
            G+P C +Y + G CKFG +CKF HP    G+F
Sbjct  103  GQPECQYYLKTGTCKFGATCKFHHPKDKAGIF  134


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M+S  G P+ P
Sbjct  144  YPIRPNEKECAYYLRTGQCKFGNTCKFHHPQ-----PSNAMVSLRGSPVYP  189



>ref|XP_010929826.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Elaeis guineensis]
Length=439

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 38/231 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+ L++PQG+V VPG+  Y GQ+GS SS + Q+ T G++Q Y T+         
Sbjct  195  WQDPSSYTQLILPQGLVQVPGWNPYPGQMGS-SSPDSQQQTPGAAQYYSTTHQSETSAGA  253

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++REN+FPERP QPECQFYMKTGDCKFG+VC+FHHPRERL+P
Sbjct  254  QGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVP  313

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C+LSP+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG F Y +S S + D P  +
Sbjct  314  VPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGTFTYGISTSSTADVPTVR  373

Query  465  FllgsssgtgaltlsseglVDAGSTNP-----------RRLPSGDNNIETE  584
             L+GSSSG  ALT SSEG  DAG   P           R++ +GD N+E E
Sbjct  374  RLIGSSSGPPALTSSSEGPADAGMGKPRDSRRLSLSESRQIGTGDENLEAE  424


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 24/100 (24%)
 Frame = +3

Query  177  FPERPGQPEC------------------------QFYMKTGDCKFGSVCRFHHPRERLIP  284
            +PERPG+ +C                         +Y+KTG CKFG+ C+FHHP+++   
Sbjct  47   YPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRLYYLKTGTCKFGATCKFHHPKDKAGI  106

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
                 L+ +G PLRP E  C +Y R G CKFG +CKF HP
Sbjct  107  AGRVQLNILGYPLRPNEKECAYYIRTGQCKFGNTCKFHHP  146


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M++  G P+ P
Sbjct  117  YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQ-----PSNAMVALRGSPVYP  162



>ref|XP_010929827.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Elaeis guineensis]
Length=430

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 38/231 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+ L++PQG+V VPG+  Y GQ+GS SS + Q+ T G++Q Y T+         
Sbjct  186  WQDPSSYTQLILPQGLVQVPGWNPYPGQMGS-SSPDSQQQTPGAAQYYSTTHQSETSAGA  244

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++REN+FPERP QPECQFYMKTGDCKFG+VC+FHHPRERL+P
Sbjct  245  QGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVP  304

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C+LSP+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG F Y +S S + D P  +
Sbjct  305  VPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGTFTYGISTSSTADVPTVR  364

Query  465  FllgsssgtgaltlsseglVDAGSTNP-----------RRLPSGDNNIETE  584
             L+GSSSG  ALT SSEG  DAG   P           R++ +GD N+E E
Sbjct  365  RLIGSSSGPPALTSSSEGPADAGMGKPRDSRRLSLSESRQIGTGDENLEAE  415


 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP E  C +Y 
Sbjct  62   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYI  121

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  122  RTGQCKFGNTCKFHHP  137


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+ +C +Y++TG C+FG  C+F+HP  R +      +   G P R G+P C +Y 
Sbjct  17   YPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRLAIAAARIKG-GYPERVGQPECQYYL  75

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGATCKFHHP  91


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M++  G P+ P
Sbjct  108  YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQ-----PSNAMVALRGSPVYP  153



>ref|XP_010929825.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Elaeis guineensis]
Length=460

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 126/231 (55%), Positives = 158/231 (68%), Gaps = 38/231 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+ L++PQG+V VPG+  Y GQ+GS SS + Q+ T G++Q Y T+         
Sbjct  216  WQDPSSYTQLILPQGLVQVPGWNPYPGQMGS-SSPDSQQQTPGAAQYYSTTHQSETSAGA  274

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++REN+FPERP QPECQFYMKTGDCKFG+VC+FHHPRERL+P
Sbjct  275  QGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVP  334

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C+LSP+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG F Y +S S + D P  +
Sbjct  335  VPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGTFTYGISTSSTADVPTVR  394

Query  465  FllgsssgtgaltlsseglVDAGSTNP-----------RRLPSGDNNIETE  584
             L+GSSSG  ALT SSEG  DAG   P           R++ +GD N+E E
Sbjct  395  RLIGSSSGPPALTSSSEGPADAGMGKPRDSRRLSLSESRQIGTGDENLEAE  445


 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP E  C +Y 
Sbjct  92   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYI  151

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  152  RTGQCKFGNTCKFHHP  167


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+ +C +Y++TG C+FG  C+F+HP  R +      +   G P R G+P C +Y 
Sbjct  47   YPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRLAIAAARIKG-GYPERVGQPECQYYL  105

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M++  G P+ P
Sbjct  138  YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQ-----PSNAMVALRGSPVYP  183



>ref|XP_009420319.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=429

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 129/180 (72%), Gaps = 30/180 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIE-----  164
            WQG S+Y+ ++VPQG+V VP +  YSGQLGSVSS+E Q     ++Q YGTSR  E     
Sbjct  225  WQGLSSYAQVIVPQGLVQVPSWNTYSGQLGSVSSSESQLHLPRTTQFYGTSRQNETIAGV  284

Query  165  --------------------RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                                RENVFPERP QPECQFYMKTGDCKFG+ C+FHHPRERL+P
Sbjct  285  QGTIPSYRSSAIPLGQYVLARENVFPERPDQPECQFYMKTGDCKFGAACKFHHPRERLLP  344

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPM----GVFAYSLSPSPSTDA  452
            PP+C+LSP+GLPLRPGEP+CIFYSRYGICKFGP CKFDHPM    GV+AYSL  S S DA
Sbjct  345  PPNCLLSPLGLPLRPGEPLCIFYSRYGICKFGPHCKFDHPMATPIGVYAYSLPTSSSADA  404


 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y++TG CKFG+ C+FHHPR++        L+ +G P+R  E  C +Y 
Sbjct  104  FPERVGQPECQYYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNALGYPIRLNETECAYYM  163

Query  357  RYGICKFGPSCKFDHP  404
            R G+CKFG +CKF HP
Sbjct  164  RNGVCKFGSTCKFHHP  179


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FG  CR++HP  R +      +   G P R G+P C +Y 
Sbjct  59   YPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNRQMAIAAARIKG-GFPERVGQPECQYYL  117

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  118  RTGTCKFGATCKFHHP  133



>ref|XP_009420318.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 129/180 (72%), Gaps = 30/180 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIE-----  164
            WQG S+Y+ ++VPQG+V VP +  YSGQLGSVSS+E Q     ++Q YGTSR  E     
Sbjct  227  WQGLSSYAQVIVPQGLVQVPSWNTYSGQLGSVSSSESQLHLPRTTQFYGTSRQNETIAGV  286

Query  165  --------------------RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                                RENVFPERP QPECQFYMKTGDCKFG+ C+FHHPRERL+P
Sbjct  287  QGTIPSYRSSAIPLGQYVLARENVFPERPDQPECQFYMKTGDCKFGAACKFHHPRERLLP  346

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPM----GVFAYSLSPSPSTDA  452
            PP+C+LSP+GLPLRPGEP+CIFYSRYGICKFGP CKFDHPM    GV+AYSL  S S DA
Sbjct  347  PPNCLLSPLGLPLRPGEPLCIFYSRYGICKFGPHCKFDHPMATPIGVYAYSLPTSSSADA  406


 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y++TG CKFG+ C+FHHPR++        L+ +G P+R  E  C +Y 
Sbjct  106  FPERVGQPECQYYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNALGYPIRLNETECAYYM  165

Query  357  RYGICKFGPSCKFDHP  404
            R G+CKFG +CKF HP
Sbjct  166  RNGVCKFGSTCKFHHP  181


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FG  CR++HP  R +      +   G P R G+P C +Y 
Sbjct  61   YPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNRQMAIAAARIKG-GFPERVGQPECQYYL  119

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  120  RTGTCKFGATCKFHHP  135



>ref|XP_008794629.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794630.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794631.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
Length=467

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 164/232 (71%), Gaps = 38/232 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+ L++PQG+V VP + AY G LGSVSS+E Q+ T G+ Q+YG+SR        
Sbjct  221  WQGPSSYAQLILPQGLVQVPSWNAYPGPLGSVSSSESQQQTPGTVQMYGSSRPSETSMGV  280

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++R++VFPERP QPECQFYMKTGDCKFG+ C+FHHP+ERL+P
Sbjct  281  QGTISSYRSSSTPMGQYALQRDSVFPERPDQPECQFYMKTGDCKFGAACKFHHPKERLVP  340

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH----PMGVFAYSLSPSPSTDA  452
             P+C+LSP+GLPLRPGEP+C+FYSRYGICKFGP+CKFDH    PMG+FAYSLS S S DA
Sbjct  341  APNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMATPMGIFAYSLSTSSSADA  400

Query  453  PAGQFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETE  584
            P  + LL SSSG  ALTLSSE  V+A + N RRL         SGD N E E
Sbjct  401  PVVRRLLASSSGPSALTLSSEHPVEASTGNSRRLSMSESRQMASGDENAEAE  452


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G P+RP E  C +Y 
Sbjct  98   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNVLGYPIRPNEKECAYYL  157

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  158  RTGQCKFGNTCKFHHP  173


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 5/92 (5%)
 Frame = +3

Query  150  SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            S ++E   ++PERPG P+C +Y++TG C++G  CR++HP +R +      +   G P R 
Sbjct  45   SESVE-SGLYPERPGVPDCAYYLRTGLCRYGLTCRYNHPPDRKLAIAAARIRG-GYPERV  102

Query  330  GEPICIFYSRYGICKFGPSCKFDHP---MGVF  416
            G+P C +Y + G CKFG +CKF HP    G+F
Sbjct  103  GQPECQYYLKTGTCKFGATCKFHHPKDKAGIF  134


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M+S  G P+ P
Sbjct  144  YPIRPNEKECAYYLRTGQCKFGNTCKFHHPQ-----PSNAMVSLRGSPVYP  189



>ref|XP_008812314.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=457

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 143/228 (63%), Gaps = 35/228 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+ L++PQG+V VPG+  Y GQ+GS SS + Q+ T G+ Q YGTSR        
Sbjct  216  WQDPSSYAQLILPQGLVQVPGWNPYPGQMGS-SSPDSQQQTPGAGQYYGTSRQSETGAGA  274

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++REN+FPERP QPECQFYMKTGDCKFG+VC+FHHPRERL+P
Sbjct  275  QGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVP  334

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C LSP+GLPLRPGEP+C+FY+RYGICKFGP+CKFDHPMG F Y +S S + DAP   
Sbjct  335  VPNCSLSPLGLPLRPGEPLCVFYARYGICKFGPNCKFDHPMGTFTYGISTSSTADAPRRL  394

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRLP--------SGDNNIETE  584
                S       +          S + RRL         SGD  +E E
Sbjct  395  IGSSSGPPALTSSSEGPADAGISSRDSRRLSLSESRQIGSGDETMEAE  442


 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP E  C +Y 
Sbjct  92   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYL  151

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  152  RTGQCKFGNTCKFHHP  167


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FG  C+F+HP  R +      +   G P R G+P C +Y 
Sbjct  47   YPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNRKLAIAAARIK-GGYPERVGQPECQYYL  105

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M+   G P+ P
Sbjct  138  YPLRPNEKECAYYLRTGQCKFGNTCKFHHPQ-----PSNAMVDLRGSPVYP  183



>gb|KHG12066.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=433

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 152/198 (77%), Gaps = 12/198 (6%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQGPS+Y+ L++PQGMVSVPG+      G+  S + +  TAGS   +   R         
Sbjct  225  WQGPSSYASLILPQGMVSVPGWNAYSIHGT--SRQNESATAGSQASFSELRSGSVPVGVY  282

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A++RENVFPERPG+PECQFYMKTGDCKFG+VC+FHHPRER++P PDC+LSPIGLPLRPGE
Sbjct  283  ALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPIGLPLRPGE  342

Query  336  PICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllgsssgtgaltlsse  515
            P+CIFYSRYGICKFGPSCKF+HPMG+F YS SPS  +DAP   F LGSSSGT  L LSSE
Sbjct  343  PLCIFYSRYGICKFGPSCKFNHPMGIFTYSYSPSSPSDAPVHCF-LGSSSGTAGLNLSSE  401

Query  516  glVDAGSTNPRRLPSGDN  569
            GLV+A  T PRRL   +N
Sbjct  402  GLVEAVPTKPRRLSLSEN  419


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 63/112 (56%), Gaps = 15/112 (13%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQ------FYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL  317
            A   +  FPER GQPECQ      +Y+KTG CKFG+ C+FHHPR++        L+ +G 
Sbjct  90   AARMKGEFPERVGQPECQACTYSSYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGY  149

Query  318  PLRPGEPICIFYSRYGICKFGPSCKFDHPM---------GVFAYSLSPSPST  446
            PLRP E  C +Y R G CKFG +CKF HP          G   Y   PSP+T
Sbjct  150  PLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPIYQTVPSPAT  201



>ref|XP_004157161.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Cucumis sativus]
Length=220

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 139/194 (72%), Gaps = 23/194 (12%)
 Frame = +3

Query  15   SNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIERENVFPERPG  194
            S ++  +    + S      + QLGSVSS+E  + T              RENVFPERPG
Sbjct  38   SKFAATLSSATLFSTFAIRSTDQLGSVSSSESPQQT--------------RENVFPERPG  83

Query  195  QPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICK  374
            QPECQFYMKTGDCKFG+VCRFHHPRER++P PDC+LSPIGLPLRPGEP+CIFYSRYGICK
Sbjct  84   QPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICK  143

Query  375  FGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllgsssgtgaltlsseglVDAGSTNPRRL  554
            FGPSCKFDHPMG+F Y+LS + S +AP  Q L G+SSGT AL LSSEGLV+AGS  PRRL
Sbjct  144  FGPSCKFDHPMGIFTYNLSAASSANAPV-QHLFGTSSGTTALNLSSEGLVEAGSAKPRRL  202

Query  555  --------PSGDNN  572
                    PS D N
Sbjct  203  SISESREMPSDDEN  216



>ref|XP_008810537.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=472

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/249 (53%), Positives = 162/249 (65%), Gaps = 44/249 (18%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+Y+ L++PQG+V VPG+  Y GQ+GS SS + Q+   G ++ Y TSR        
Sbjct  216  WQSPSSYAQLILPQGLVQVPGWNPYPGQMGS-SSPKSQQEILGVAEYYSTSRQSETSAGA  274

Query  156  ---------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRE  272
                                 A++REN+FPERP QPECQFYMKTGDCKFG  CRFHHPRE
Sbjct  275  QGTLGDRFSSYRLGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGPACRFHHPRE  334

Query  273  RLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            RL+P P+C+LSP+GLPLRPGEP+CIFYSRYGICKFGP+CKFDHPMG FAY L+ S + D 
Sbjct  335  RLMPVPNCILSPLGLPLRPGEPLCIFYSRYGICKFGPNCKFDHPMGTFAYGLATSSTADV  394

Query  453  PAGQFllgsssgtgaltlsseglVDAGSTNPRRL--------PSGDNNIETEE*LFPHIQ  608
            P  + L+GSSSG  ALTLSSEG  D+G+   R L         +GD N+  +        
Sbjct  395  PTIRHLMGSSSGPPALTLSSEGPADSGTGKSRXLXLSESRQTTTGDENVGAKA-----SH  449

Query  609  SASTIFNFL  635
            ++STI  FL
Sbjct  450  TSSTIGQFL  458


 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 60/95 (63%), Gaps = 8/95 (8%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        LS +G PLRP E  C +Y 
Sbjct  92   YPERVGQPECQYYLKTGSCKFGATCKFHHPKDKAGIVGRVKLSILGYPLRPNEKECAYYL  151

Query  357  RYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            R G CKFG +CKF HP         PS + DA  G
Sbjct  152  RTGQCKFGNTCKFHHPQ--------PSNAMDALCG  178



>ref|XP_004495537.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Cicer arietinum]
Length=389

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 149/184 (81%), Gaps = 16/184 (9%)
 Frame = +3

Query  9    GPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIERENVFPE  185
            GPS+Y+PL++PQG++SVPG+ AYSGQ+GSV S        GS         ++REN+FP+
Sbjct  196  GPSSYTPLVMPQGVISVPGWSAYSGQMGSVISTP-----PGS--------PLQRENIFPD  242

Query  186  RPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP-PPDCMLSPIGLPLRPGEPICIFYSRY  362
            RPGQPECQFYMKTGDCKFG+VCRFHHP +RLIP PPDC+LS +GLPLR GEP+C+FYSRY
Sbjct  243  RPGQPECQFYMKTGDCKFGAVCRFHHPHQRLIPVPPDCLLSSLGLPLRHGEPLCVFYSRY  302

Query  363  GICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllgsssgtgaltlsseglVDAGSTN  542
            GICKFGPSCKFDHPMG+F+Y+LS SP  D+  G+ LLGSSS T AL LSS+GLV++ S  
Sbjct  303  GICKFGPSCKFDHPMGIFSYNLSASPLADS-TGRHLLGSSSATAALNLSSQGLVESSSAK  361

Query  543  PRRL  554
            PRRL
Sbjct  362  PRRL  365


 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQFY+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  82   FPERIGQPECQFYLKTGTCKFGATCKFHHPRDQAGISGRVALNILGYPLRPTEAECSYYL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  142  RTGECKFGNTCKFHHP  157


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 13/92 (14%)
 Frame = +3

Query  147  TSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG----  314
            +++       +P RPG+P+C +Y++TG C+FG+ CRF+H       PP+  L+ +     
Sbjct  27   STQTFMDSQFYPHRPGEPDCSYYIRTGLCRFGATCRFNH-------PPNANLAIVTARMI  79

Query  315  --LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
               P R G+P C FY + G CKFG +CKF HP
Sbjct  80   GEFPERIGQPECQFYLKTGTCKFGATCKFHHP  111


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            +P RP + EC +Y++TG+CKFG+ C+FHHP+
Sbjct  128  YPLRPTEAECSYYLRTGECKFGNTCKFHHPQ  158



>ref|XP_009392482.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=362

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/228 (53%), Positives = 146/228 (64%), Gaps = 37/228 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+ L++PQG+V VPG+ +YSGQLGS   + G + TAG +Q Y  S+        
Sbjct  137  WQASSSYAQLILPQGVVQVPGWTSYSGQLGS---SPGSQQTAGVAQFYSPSQQGETNIGA  193

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+ REN+FPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  194  QGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIP  253

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C+L+P+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG   Y LS S   D P  Q
Sbjct  254  TPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVTYGLSESSMADVPTVQ  313

Query  465  Fllgsss--------gtgaltlsseglVDAGSTNPRRLPSGDNNIETE  584
             LLGSS                SS   + A +++ RR  S D N E +
Sbjct  314  HLLGSSLDPPTLTLPSEETANGSSGVSIRAPTSDSRRATSVDENDEAD  361


 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFGS C+FHHP+E+        L+ +G PLRP E  C +Y 
Sbjct  13   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYI  72

Query  357  RYGICKFGPSCKFDHPM  407
            R G CKFG +CK+ HP 
Sbjct  73   RTGECKFGSTCKYHHPQ  89


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG+CKFGS C++HHP+     P + +L+  G P+ P
Sbjct  59   YPLRPNEQECAYYIRTGECKFGSTCKYHHPQ-----PSNTILALRGSPIYP  104



>ref|XP_009392481.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=371

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 127/180 (71%), Gaps = 29/180 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+ L++PQG+V VPG+ +YSGQLGS   + G + TAG +Q Y  S+        
Sbjct  146  WQASSSYAQLILPQGVVQVPGWTSYSGQLGS---SPGSQQTAGVAQFYSPSQQGETNIGA  202

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+ REN+FPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  203  QGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIP  262

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C+L+P+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG   Y LS S   D P  Q
Sbjct  263  TPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVTYGLSESSMADVPTVQ  322


 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFGS C+FHHP+E+        L+ +G PLRP E  C +Y 
Sbjct  22   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYI  81

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CK+ HP
Sbjct  82   RTGECKFGSTCKYHHP  97


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG+CKFGS C++HHP+     P + +L+  G P+ P
Sbjct  68   YPLRPNEQECAYYIRTGECKFGSTCKYHHPQ-----PSNTILALRGSPIYP  113



>ref|XP_009392483.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=359

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 127/180 (71%), Gaps = 29/180 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+ L++PQG+V VPG+ +YSGQLGS   + G + TAG +Q Y  S+        
Sbjct  134  WQASSSYAQLILPQGVVQVPGWTSYSGQLGS---SPGSQQTAGVAQFYSPSQQGETNIGA  190

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+ REN+FPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  191  QGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIP  250

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C+L+P+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG   Y LS S   D P  Q
Sbjct  251  TPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVTYGLSESSMADVPTVQ  310


 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 12/98 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P+RPG+P+C +Y++TG C+FG  C+F+HP+ R++      +   G P R G+P C +Y 
Sbjct  17   YPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNRMLAIAAARIRG-GYPERVGQPECQYYL  75

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
            + G CKFG +CKF HP           + +  Y L PS
Sbjct  76   KTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPS  113


 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEP  338
            +PER GQPECQ+Y+KTG CKFGS C+FHHP+E+        L+ +G PLRP  P
Sbjct  62   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPSYP  115



>ref|XP_009416576.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=368

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 130/178 (73%), Gaps = 29/178 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+ L++PQG+V VPG+ +YSGQLGS  S E Q+ T G++Q YG S+        
Sbjct  142  WQASSSYAQLILPQGVVQVPGWTSYSGQLGS--SPESQR-TTGTAQFYGPSQQGETSIGA  198

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+  EN+FPERPGQPECQFYMKTGDCKFG+VC+FHHP+ERL+P
Sbjct  199  QGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVP  258

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
             P+C+LSP+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG FAY +S S +T  P 
Sbjct  259  VPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHPMGTFAYGVSASSATGVPT  316


 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG++C+FHHP+E+        L+ +G PLR  E  C +Y 
Sbjct  18   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYI  77

Query  357  RYGICKFGPSCKFDHPM  407
            R G CKFG +CKF HP 
Sbjct  78   RTGECKFGGTCKFHHPQ  94



>ref|XP_010525082.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Tarenaya hassleriana]
Length=429

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 121/168 (72%), Gaps = 27/168 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+++ L++PQGMVSV G+  YSGQLGSVSS+   +   G+   YG           
Sbjct  193  WQDPSSFASLILPQGMVSVQGWNTYSGQLGSVSSSGSPQQVTGNDHNYGNLMQNEAKDTG  252

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R I
Sbjct  253  SPGSFSGFHSGSAQLGIYALPRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQI  312

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYS  425
            PPPDC+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPM VF Y+
Sbjct  313  PPPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYN  360


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +PER GQPECQ+Y+KTG CKFG  C+FHHPR +        L+ +G P+RP E
Sbjct  70   AARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNVLGYPIRPNE  129

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF+HP
Sbjct  130  VECSYYLRTGHCKFGSTCKFNHP  152


 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
             +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y
Sbjct  31   TYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRNLAIAAARMKG-EYPERIGQPECQYY  89

Query  354  SRYGICKFGPSCKFDHP  404
             + G CKFG +CKF HP
Sbjct  90   LKTGTCKFGVTCKFHHP  106



>ref|XP_010525081.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 121/168 (72%), Gaps = 27/168 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PS+++ L++PQGMVSV G+  YSGQLGSVSS+   +   G+   YG           
Sbjct  204  WQDPSSFASLILPQGMVSVQGWNTYSGQLGSVSSSGSPQQVTGNDHNYGNLMQNEAKDTG  263

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R I
Sbjct  264  SPGSFSGFHSGSAQLGIYALPRENVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQI  323

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYS  425
            PPPDC+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKFDHPM VF Y+
Sbjct  324  PPPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYN  371


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +PER GQPECQ+Y+KTG CKFG  C+FHHPR +        L+ +G P+RP E
Sbjct  81   AARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNVLGYPIRPNE  140

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF+HP
Sbjct  141  VECSYYLRTGHCKFGSTCKFNHP  163


 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
             +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y
Sbjct  42   TYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRNLAIAAARMKG-EYPERIGQPECQYY  100

Query  354  SRYGICKFGPSCKFDHP  404
             + G CKFG +CKF HP
Sbjct  101  LKTGTCKFGVTCKFHHP  117



>ref|XP_009416575.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=393

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 130/178 (73%), Gaps = 29/178 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+ L++PQG+V VPG+ +YSGQLGS  S E Q+ T G++Q YG S+        
Sbjct  167  WQASSSYAQLILPQGVVQVPGWTSYSGQLGS--SPESQR-TTGTAQFYGPSQQGETSIGA  223

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+  EN+FPERPGQPECQFYMKTGDCKFG+VC+FHHP+ERL+P
Sbjct  224  QGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVP  283

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
             P+C+LSP+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG FAY +S S +T  P 
Sbjct  284  VPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHPMGTFAYGVSASSATGVPT  341


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 7/121 (6%)
 Frame = +3

Query  63   GYAYSGQLGSVSSAEGQKLTA--GSSQVYGTSRAIERENV----FPERPGQPECQFYMKT  224
            G  +S +  + +  EG  L++  G+ +     R  E +++    +PERPG+P+C +Y++T
Sbjct  3    GDGWSTRAPARTVTEGPSLSSQPGTDEEAMWKRMRESDSMETGPYPERPGEPDCAYYIRT  62

Query  225  GDCKFGSVCRFHHPRERLIPPPDCMLSPI-GLPLRPGEPICIFYSRYGICKFGPSCKFDH  401
            G C+FG  C+F+HP  R++           G P R G+P C +Y + G CKFG  CKF H
Sbjct  63   GLCRFGRTCKFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHH  122

Query  402  P  404
            P
Sbjct  123  P  123


 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLR  326
            +PER GQPECQ+Y+KTG CKFG++C+FHHP+E+        L+ +G PLR
Sbjct  94   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLR  143



>ref|XP_009392477.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392478.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392479.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392480.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 127/180 (71%), Gaps = 29/180 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+ L++PQG+V VPG+ +YSGQLGS   + G + TAG +Q Y  S+        
Sbjct  186  WQASSSYAQLILPQGVVQVPGWTSYSGQLGS---SPGSQQTAGVAQFYSPSQQGETNIGA  242

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+ REN+FPERPGQPECQFYMKTGDCKFG+VCRFHHPRERLIP
Sbjct  243  QGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIP  302

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C+L+P+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG   Y LS S   D P  Q
Sbjct  303  TPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVTYGLSESSMADVPTVQ  362


 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFGS C+FHHP+E+        L+ +G PLRP E  C +Y 
Sbjct  62   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYI  121

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CK+ HP
Sbjct  122  RTGECKFGSTCKYHHP  137


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P+RPG+P+C +Y++TG C+FG  C+F+HP+ R++      +   G P R G+P C +Y 
Sbjct  17   YPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNRMLAIAAARIRG-GYPERVGQPECQYYL  75

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGSTCKFHHP  91


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG+CKFGS C++HHP+     P + +L+  G P+ P
Sbjct  108  YPLRPNEQECAYYIRTGECKFGSTCKYHHPQ-----PSNTILALRGSPIYP  153



>ref|XP_009416573.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 130/178 (73%), Gaps = 29/178 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+ L++PQG+V VPG+ +YSGQLGS  S E Q+ T G++Q YG S+        
Sbjct  218  WQASSSYAQLILPQGVVQVPGWTSYSGQLGS--SPESQR-TTGTAQFYGPSQQGETSIGA  274

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+  EN+FPERPGQPECQFYMKTGDCKFG+VC+FHHP+ERL+P
Sbjct  275  QGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVP  334

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
             P+C+LSP+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG FAY +S S +T  P 
Sbjct  335  VPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHPMGTFAYGVSASSATGVPT  392


 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG++C+FHHP+E+        L+ +G PLR  E  C +Y 
Sbjct  94   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYI  153

Query  357  RYGICKFGPSCKFDHPM  407
            R G CKFG +CKF HP 
Sbjct  154  RTGECKFGGTCKFHHPQ  170


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 7/121 (6%)
 Frame = +3

Query  63   GYAYSGQLGSVSSAEGQKLTA--GSSQVYGTSRAIERENV----FPERPGQPECQFYMKT  224
            G  +S +  + +  EG  L++  G+ +     R  E +++    +PERPG+P+C +Y++T
Sbjct  3    GDGWSTRAPARTVTEGPSLSSQPGTDEEAMWKRMRESDSMETGPYPERPGEPDCAYYIRT  62

Query  225  GDCKFGSVCRFHHPRERLIPPPDCMLSPI-GLPLRPGEPICIFYSRYGICKFGPSCKFDH  401
            G C+FG  C+F+HP  R++           G P R G+P C +Y + G CKFG  CKF H
Sbjct  63   GLCRFGRTCKFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHH  122

Query  402  P  404
            P
Sbjct  123  P  123



>ref|XP_008676804.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|AFW60817.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=407

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 130/178 (73%), Gaps = 27/178 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG++ Y+ Q+GS SS+E Q+ T G++Q Y  SR        
Sbjct  184  WPGHSSYAQVIVPPGLVQVPGWSPYTAQIGS-SSSEDQQRTPGAAQYYTGSRQSGTSIGD  242

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++REN+FPERP QPECQFYMKTGDCKFG+VC+FHHPRER+IP
Sbjct  243  QGMFSSYQAGSVPVGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIP  302

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
             P+C LSP+GLPLRPGEPIC FY+RYG+CKFGP+CKFDHPMG   Y  +PSP+++APA
Sbjct  303  TPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGNAMYGQAPSPASEAPA  360


 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  53   AARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNE  112

Query  336  PICIFYSRYGICKFGPSCKFDH  401
              C +Y R G CKFG +CKF H
Sbjct  113  KECAYYLRTGQCKFGSTCKFHH  134


 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP +R +      +     P R G+P C +Y 
Sbjct  15   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARMKG-EYPQRIGQPECQYYL  73

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  74   KTGTCKFGATCKFHHP  89



>ref|XP_008792914.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Phoenix dactylifera]
Length=452

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 160/232 (69%), Gaps = 38/232 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+ + +++PQG+V VP + AY G LGSVSS+E Q+   G+ Q++G+SR        
Sbjct  200  WQGPSSCAQVVLPQGLVQVPSWNAYPGPLGSVSSSESQQQAPGTVQIHGSSRPSETSAGA  259

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++++NVFPER  QPECQFYMKTGDCKFG+ C+FHHP+ERLI 
Sbjct  260  QGIVSSYRSSSITMGQHALQKDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLIT  319

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP----MGVFAYSLSPSPSTDA  452
             P+C+LSP GLPLRPGEP+C+FYSRYGICKFGP+CKFDHP    MG+FAYSLS S S D 
Sbjct  320  APNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPVVTSMGIFAYSLSTSASADI  379

Query  453  PAGQFllgsssgtgaltlsseglVDAGSTNPRR--------LPSGDNNIETE  584
            P  + LL SSS   ALTLSSEG V+AG+  PRR        + SGD ++E E
Sbjct  380  PIVRHLLASSSVPPALTLSSEGPVEAGTGKPRRVLMSEPQQMSSGDEHVEAE  431


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 24/100 (24%)
 Frame = +3

Query  177  FPERPGQPECQ------------------------FYMKTGDCKFGSVCRFHHPRERLIP  284
            +P+R G+P+C                         +Y+KTG CKFG+ C+FHHP+++   
Sbjct  53   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLYYLKTGTCKFGATCKFHHPKDKAGI  112

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
                 L+ +G P+RP E  C +Y R G CKFG +CKF HP
Sbjct  113  LGRAELNILGYPIRPNEEECAYYLRTGQCKFGNTCKFHHP  152


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M+S  G P  P
Sbjct  123  YPIRPNEEECAYYLRTGQCKFGNTCKFHHPQ-----PSNVMVSLRGSPFYP  168



>dbj|BAG99488.1| unnamed protein product [Oryza sativa Japonica Group]
Length=237

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 127/182 (70%), Gaps = 34/182 (19%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++VPQG+V VP + +Y+GQ+  VSS+E +  + G+ Q YGTS+        
Sbjct  43   WQNPSNYAPMIVPQGLVQVPSWNSYTGQMMPVSSSESRLQSPGAQQTYGTSQQVDASAGN  102

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPECQ+YMKTGDCKFG+VC+FHHPR R +P
Sbjct  103  QGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMP  162

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH-----PMGVFAYSLSPSPSTD  449
             PDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDH     PMGV+AY    S ST+
Sbjct  163  TPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG---SASTN  219

Query  450  AP  455
             P
Sbjct  220  VP  221



>ref|NP_001141157.1| hypothetical protein [Zea mays]
 gb|ACF85576.1| unknown [Zea mays]
 gb|ACN34349.1| unknown [Zea mays]
 gb|AFT82654.1| C3H11 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW60815.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=443

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 130/178 (73%), Gaps = 27/178 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG++ Y+ Q+GS SS+E Q+ T G++Q Y  SR        
Sbjct  220  WPGHSSYAQVIVPPGLVQVPGWSPYTAQIGS-SSSEDQQRTPGAAQYYTGSRQSGTSIGD  278

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++REN+FPERP QPECQFYMKTGDCKFG+VC+FHHPRER+IP
Sbjct  279  QGMFSSYQAGSVPVGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIP  338

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
             P+C LSP+GLPLRPGEPIC FY+RYG+CKFGP+CKFDHPMG   Y  +PSP+++APA
Sbjct  339  TPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGNAMYGQAPSPASEAPA  396


 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  89   AARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNE  148

Query  336  PICIFYSRYGICKFGPSCKFDH  401
              C +Y R G CKFG +CKF H
Sbjct  149  KECAYYLRTGQCKFGSTCKFHH  170


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP +R +      +     P R G+P C +Y 
Sbjct  51   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARMKG-EYPQRIGQPECQYYL  109

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  110  KTGTCKFGATCKFHHP  125



>ref|XP_008792915.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Phoenix dactylifera]
Length=434

 Score =   207 bits (528),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 160/232 (69%), Gaps = 38/232 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+ + +++PQG+V VP + AY G LGSVSS+E Q+   G+ Q++G+SR        
Sbjct  182  WQGPSSCAQVVLPQGLVQVPSWNAYPGPLGSVSSSESQQQAPGTVQIHGSSRPSETSAGA  241

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++++NVFPER  QPECQFYMKTGDCKFG+ C+FHHP+ERLI 
Sbjct  242  QGIVSSYRSSSITMGQHALQKDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLIT  301

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP----MGVFAYSLSPSPSTDA  452
             P+C+LSP GLPLRPGEP+C+FYSRYGICKFGP+CKFDHP    MG+FAYSLS S S D 
Sbjct  302  APNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPVVTSMGIFAYSLSTSASADI  361

Query  453  PAGQFllgsssgtgaltlsseglVDAGSTNPRR--------LPSGDNNIETE  584
            P  + LL SSS   ALTLSSEG V+AG+  PRR        + SGD ++E E
Sbjct  362  PIVRHLLASSSVPPALTLSSEGPVEAGTGKPRRVLMSEPQQMSSGDEHVEAE  413


 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE  GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G P+RP E  C +Y 
Sbjct  59   YPEIVGQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPIRPNEEECAYYL  118

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  119  RTGQCKFGNTCKFHHP  134


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P+R G+P+C +Y++TG C++G  CR++HP  R +      L   G P   G+P C +Y 
Sbjct  14   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLKG-GYPEIVGQPECQYYL  72

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  73   KTGTCKFGATCKFHHP  88


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M+S  G P  P
Sbjct  105  YPIRPNEEECAYYLRTGQCKFGNTCKFHHPQ-----PSNVMVSLRGSPFYP  150



>ref|XP_008676803.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28340.1| unknown [Zea mays]
 gb|AFW60816.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=441

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 130/178 (73%), Gaps = 27/178 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG++ Y+ Q+GS SS+E Q+ T G++Q Y  SR        
Sbjct  218  WPGHSSYAQVIVPPGLVQVPGWSPYTAQIGS-SSSEDQQRTPGAAQYYTGSRQSGTSIGD  276

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++REN+FPERP QPECQFYMKTGDCKFG+VC+FHHPRER+IP
Sbjct  277  QGMFSSYQAGSVPVGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIP  336

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
             P+C LSP+GLPLRPGEPIC FY+RYG+CKFGP+CKFDHPMG   Y  +PSP+++APA
Sbjct  337  TPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGNAMYGQAPSPASEAPA  394


 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  87   AARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNE  146

Query  336  PICIFYSRYGICKFGPSCKFDH  401
              C +Y R G CKFG +CKF H
Sbjct  147  KECAYYLRTGQCKFGSTCKFHH  168


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP +R +      +     P R G+P C +Y 
Sbjct  49   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARMKG-EYPQRIGQPECQYYL  107

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  108  KTGTCKFGATCKFHHP  123



>ref|XP_008792910.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792911.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792912.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
Length=473

 Score =   208 bits (530),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 160/232 (69%), Gaps = 38/232 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+ + +++PQG+V VP + AY G LGSVSS+E Q+   G+ Q++G+SR        
Sbjct  221  WQGPSSCAQVVLPQGLVQVPSWNAYPGPLGSVSSSESQQQAPGTVQIHGSSRPSETSAGA  280

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++++NVFPER  QPECQFYMKTGDCKFG+ C+FHHP+ERLI 
Sbjct  281  QGIVSSYRSSSITMGQHALQKDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKERLIT  340

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP----MGVFAYSLSPSPSTDA  452
             P+C+LSP GLPLRPGEP+C+FYSRYGICKFGP+CKFDHP    MG+FAYSLS S S D 
Sbjct  341  APNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPVVTSMGIFAYSLSTSASADI  400

Query  453  PAGQFllgsssgtgaltlsseglVDAGSTNPRR--------LPSGDNNIETE  584
            P  + LL SSS   ALTLSSEG V+AG+  PRR        + SGD ++E E
Sbjct  401  PIVRHLLASSSVPPALTLSSEGPVEAGTGKPRRVLMSEPQQMSSGDEHVEAE  452


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE  GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G P+RP E  C +Y 
Sbjct  98   YPEIVGQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPIRPNEEECAYYL  157

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  158  RTGQCKFGNTCKFHHP  173


 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P+R G+P+C +Y++TG C++G  CR++HP  R +      L   G P   G+P C +Y 
Sbjct  53   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLKG-GYPEIVGQPECQYYL  111

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  112  KTGTCKFGATCKFHHP  127


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M+S  G P  P
Sbjct  144  YPIRPNEEECAYYLRTGQCKFGNTCKFHHPQ-----PSNVMVSLRGSPFYP  189



>ref|XP_006296584.1| hypothetical protein CARUB_v100138730mg, partial [Capsella rubella]
 gb|EOA29482.1| hypothetical protein CARUB_v100138730mg, partial [Capsella rubella]
Length=329

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 121/176 (69%), Gaps = 26/176 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQKLTA-----------------  125
            WQ PS+Y+ L++PQG+V V G+  YSGQLGSVS S  G  L                   
Sbjct  116  WQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDLNYRSLQQSETKESSTQSQG  175

Query  126  -------GSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                   GSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P
Sbjct  176  SFSGFNPGSSVPLGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAP  235

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPDC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VF Y  + S S + 
Sbjct  236  PPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASESDEV  291


 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  11   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  70

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  71   RTGHCKFGGTCKFNHP  86



>emb|CDX74233.1| BnaA03g28140D [Brassica napus]
Length=365

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 120/160 (75%), Gaps = 13/160 (8%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSA----------EGQKLTAGSSQVYGTS  152
            WQ PS ++PLM+PQG+V  P   Y+GQLGSVS +          E Q+  +GSS   G  
Sbjct  175  WQDPSGFTPLMMPQGVVWNP---YTGQLGSVSPSGTGNDHNNYRELQQNESGSSVPQGGI  231

Query  153  RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPG  332
             A+  E+VFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  PPPDC+LSPIGLPLRPG
Sbjct  232  YALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPG  291

Query  333  EPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            EP+C+FYSRY ICKFGPSCKF HPMGVF Y  + S + + 
Sbjct  292  EPLCVFYSRYRICKFGPSCKFHHPMGVFTYDNTASETDEV  331


 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  68   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFL  127

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  128  RTGHCKFGATCKFNHP  143


 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+  TS        +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +    
Sbjct  9    QMNMTSDETMEPGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-E  67

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFG +CKF HP
Sbjct  68   YPERIGQPECEYYLKTGTCKFGVTCKFHHP  97



>dbj|BAD87736.1| putative zinc finger protein [Oryza sativa Japonica Group]
Length=322

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 127/182 (70%), Gaps = 34/182 (19%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++VPQG+V VP + +Y+GQ+  VSS+E +  + G+ Q YGTS+        
Sbjct  128  WQNPSNYAPMIVPQGLVQVPSWNSYTGQMMPVSSSESRLQSPGAQQTYGTSQQVDASAGN  187

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPECQ+YMKTGDCKFG+VC+FHHPR R +P
Sbjct  188  QGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMP  247

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH-----PMGVFAYSLSPSPSTD  449
             PDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDH     PMGV+AY    S ST+
Sbjct  248  TPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG---SASTN  304

Query  450  AP  455
             P
Sbjct  305  VP  306


 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  5    YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  64

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+G +CKF HP
Sbjct  65   KTGQCKYGNTCKFHHP  80



>ref|XP_006408378.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49831.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=385

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 122/176 (69%), Gaps = 26/176 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQKLTAGSSQVYGTSR-------  155
            WQ PS+++PL++PQG+V V G+  YSGQLGSVS S  G      + Q   T         
Sbjct  184  WQDPSSFTPLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDHNYRNLQQNETIESGSQSQG  243

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R +P
Sbjct  244  SFSGFNSGSSVPLRGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVP  303

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPDC+LSPIGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VF Y  + S + + 
Sbjct  304  PPDCLLSPIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYENTASETDEV  359


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC+    TG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECE----TGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  137

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  138  RTGHCKFGGTCKFNHP  153



>ref|XP_006408377.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49830.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=369

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 122/176 (69%), Gaps = 26/176 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQKLTAGSSQVYGTSR-------  155
            WQ PS+++PL++PQG+V V G+  YSGQLGSVS S  G      + Q   T         
Sbjct  168  WQDPSSFTPLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDHNYRNLQQNETIESGSQSQG  227

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R +P
Sbjct  228  SFSGFNSGSSVPLRGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVP  287

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPDC+LSPIGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VF Y  + S + + 
Sbjct  288  PPDCLLSPIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYENTASETDEV  343


 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  62   YPERIGQPECEYYLKTGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  121

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  122  RTGHCKFGGTCKFNHP  137


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P C ++++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  17   YPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  75

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG SCKF HP
Sbjct  76   KTGTCKFGVSCKFHHP  91



>ref|XP_006408379.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49832.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=389

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 122/176 (69%), Gaps = 26/176 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQKLTAGSSQVYGTSR-------  155
            WQ PS+++PL++PQG+V V G+  YSGQLGSVS S  G      + Q   T         
Sbjct  188  WQDPSSFTPLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDHNYRNLQQNETIESGSQSQG  247

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R +P
Sbjct  248  SFSGFNSGSSVPLRGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVP  307

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPDC+LSPIGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VF Y  + S + + 
Sbjct  308  PPDCLLSPIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYENTASETDEV  363


 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGGTCKFNHP  157


 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P C ++++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG SCKF HP
Sbjct  96   KTGTCKFGVSCKFHHP  111



>ref|XP_002882253.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58512.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 122/176 (69%), Gaps = 26/176 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQK--------------------  116
            WQ PS+Y+ L++PQG+V V G+  YSGQLGSVS S  G                      
Sbjct  187  WQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDQNYRNLQQNETIESGSQSQG  246

Query  117  ----LTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                   GSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P
Sbjct  247  SFSGFNPGSSVPIGGYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAP  306

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPDC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VFAY  + S + +A
Sbjct  307  PPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYENTASETDEA  362


 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGGTCKFNHP  157


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+  +S  I     +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +    
Sbjct  23   QMNLSSDEIMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-E  81

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFG +CKF HP
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHP  111



>ref|XP_002450713.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
 gb|EES09701.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
Length=446

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 128/179 (72%), Gaps = 28/179 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG++ Y+ Q+GS SS++ Q+ T G++Q Y  SR        
Sbjct  223  WPGHSSYAQVIVPPGLVQVPGWSPYTAQIGS-SSSDDQQRTPGAAQYYTGSRQSGTAGIG  281

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERP QPECQFYMKTGDCKFG+VC+FHHPRER+I
Sbjct  282  DQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERII  341

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
            P P+C LSP+GLPLRPGEPIC FY+RYG+CKFGP+CKFDHPMG   Y  + SP+++AP 
Sbjct  342  PTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGSAMYGHASSPTSEAPT  400


 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLR  E
Sbjct  92   AARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRANE  151

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  152  KECAYYLRTGQCKFGSTCKFHHP  174


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP +R +      +     P R G+P C +Y 
Sbjct  54   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARMKG-EYPQRIGQPECQYYL  112

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  113  KTGTCKFGATCKFHHP  128



>gb|KFK37691.1| hypothetical protein AALP_AA3G016100 [Arabis alpina]
Length=389

 Score =   201 bits (511),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 121/174 (70%), Gaps = 24/174 (14%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQK---------------------  116
            WQ PS+Y+ L++PQG+V V G+  YSGQLGSVS +   +                     
Sbjct  187  WQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGNDQNYRNLQQSETNEPGSQSQGSY  246

Query  117  --LTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPP  290
                AGSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P P
Sbjct  247  SGYNAGSSVPVGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPSP  306

Query  291  DCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            DC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VFAY  + S + + 
Sbjct  307  DCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTGSETDEV  360


 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLRP E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRPNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGGTCKFNHP  157


 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  37   YPERQGEPNCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_010501847.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=402

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 120/177 (68%), Gaps = 27/177 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQKLTA-----------------  125
            WQ PS Y  L++PQG+V V G+  YSGQLGSVS S  G  L                   
Sbjct  187  WQDPSTYPSLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDLNYNRSLQQSETKESGSPSQ  246

Query  126  --------GSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                    GSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  
Sbjct  247  GSFSGFNPGSSVPLGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQA  306

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPPDC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VFAY  + S + + 
Sbjct  307  PPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASETDEV  363


 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGGTCKFNHP  157


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>gb|EEE55890.1| hypothetical protein OsJ_04549 [Oryza sativa Japonica Group]
Length=380

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 127/182 (70%), Gaps = 34/182 (19%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++VPQG+V VP + +Y+GQ+  VSS+E +  + G+ Q YGTS+        
Sbjct  186  WQNPSNYAPMIVPQGLVQVPSWNSYTGQMMPVSSSESRLQSPGAQQTYGTSQQVDASAGN  245

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPECQ+YMKTGDCKFG+VC+FHHPR R +P
Sbjct  246  QGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMP  305

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH-----PMGVFAYSLSPSPSTD  449
             PDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDH     PMGV+AY    S ST+
Sbjct  306  TPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG---SASTN  362

Query  450  AP  455
             P
Sbjct  363  VP  364


 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  63   YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  122

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+G +CKF HP
Sbjct  123  KTGQCKYGNTCKFHHP  138


 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG  CRF+HP++R +      +     P R G+P C +Y 
Sbjct  18   YPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAIASARMK-GEYPERMGQPECQYYL  76

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFGP+CKF HP
Sbjct  77   KTGTCKFGPTCKFHHP  92



>emb|CDY53749.1| BnaAnng12770D [Brassica napus]
Length=374

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 115/153 (75%), Gaps = 6/153 (4%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVS-SAEGQKLTA--GSSQVYGTSRAIEREN  173
            WQ PS ++PLM+PQG+V  P   YSGQLGSVS S  G +        Q    S     EN
Sbjct  190  WQDPSGFTPLMMPQGVVWNP---YSGQLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSEN  246

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
            VFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P PDC+LSPIGLPLRPGEP+C+FY
Sbjct  247  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFY  306

Query  354  SRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            SRYGICKFGPSCKF+HPM VFAY  + S + + 
Sbjct  307  SRYGICKFGPSCKFNHPMEVFAYDNTASETDEV  339


 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  143  RTGHCKFGATCKFNHP  158


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  96

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>emb|CDY67901.1| BnaCnng56860D [Brassica napus]
Length=374

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 115/153 (75%), Gaps = 6/153 (4%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVS-SAEGQKLTA--GSSQVYGTSRAIEREN  173
            WQ PS ++PLM+PQG+V  P   YSGQLGSVS S  G +        Q    S     EN
Sbjct  190  WQDPSGFTPLMMPQGVVWNP---YSGQLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSEN  246

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
            VFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P PDC+LSPIGLPLRPGEP+C+FY
Sbjct  247  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFY  306

Query  354  SRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            SRYGICKFGPSCKF+HPM +FAY  + S + + 
Sbjct  307  SRYGICKFGPSCKFNHPMEIFAYDNTASETDEV  339


 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  143  RTGHCKFGATCKFNHP  158


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  96

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>ref|XP_009118604.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=374

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 115/153 (75%), Gaps = 6/153 (4%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVS-SAEGQKLTA--GSSQVYGTSRAIEREN  173
            WQ PS ++PLM+PQG+V  P   YSGQLGSVS S  G +        Q    S     EN
Sbjct  190  WQDPSGFTPLMMPQGVVWNP---YSGQLGSVSPSGTGNEHNNYRNMQQNESGSSVQPSEN  246

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
            VFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P PDC+LSPIGLPLRPGEP+C+FY
Sbjct  247  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFY  306

Query  354  SRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            SRYGICKFGPSCKF+HPM +FAY  + S + + 
Sbjct  307  SRYGICKFGPSCKFNHPMEIFAYDNTASETDEV  339


 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  143  RTGHCKFGATCKFNHP  158


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  96

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>gb|EAY76977.1| hypothetical protein OsI_04935 [Oryza sativa Indica Group]
Length=440

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 127/182 (70%), Gaps = 34/182 (19%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++VPQG+V VP + +Y+GQ+  VSS+E +  + G+ Q YGTS+        
Sbjct  246  WQNPSNYAPMIVPQGLVQVPSWNSYTGQMMPVSSSESRLQSPGAQQTYGTSQQVDASAGN  305

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPECQ+YMKTGDCKFG+VC+FHHPR R +P
Sbjct  306  QGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMP  365

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH-----PMGVFAYSLSPSPSTD  449
             PDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDH     PMGV+AY    S ST+
Sbjct  366  TPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG---SASTN  422

Query  450  AP  455
             P
Sbjct  423  VP  424


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  122  YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  181

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+G +CKF HP
Sbjct  182  KTGQCKYGNTCKFHHP  197


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG  CRF+HP++R +      +     P R G+P C +Y 
Sbjct  77   YPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAIASARMK-GEYPERMGQPECQYYL  135

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFGP+CKF HP
Sbjct  136  KTGTCKFGPTCKFHHP  151



>emb|CDY28712.1| BnaCnng05980D [Brassica napus]
Length=390

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 120/174 (69%), Gaps = 24/174 (14%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQK--------------------  116
            WQ PS Y+PL++PQG+V V G+  Y+GQLGSVS S  G                      
Sbjct  189  WQDPSGYTPLLMPQGVVPVQGWNPYTGQLGSVSPSGTGNDHTNYRNMQQNEAGSQSQGSV  248

Query  117  --LTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPP  290
              L   SS   G   A+  E+VFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  PPP
Sbjct  249  SGLNTASSVPLGGFFALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPP  308

Query  291  DCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            DC+LSPIGLPLRPGEP+C+FYSRYGICKFGPSCKF HPM VFAY  + S + + 
Sbjct  309  DCLLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFHHPMEVFAYDNTASETDEV  362


 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P C +Y++TG C+FGS CRF+HP +R +      +     P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_010463709.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=404

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 120/178 (67%), Gaps = 28/178 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQKLTA-----------------  125
            WQ PS Y  L++PQG+V V G+  YSGQLGSVS S  G  L                   
Sbjct  187  WQDPSTYPSLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDLNYNRSLQQQSETKESGSQS  246

Query  126  ---------GSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERL  278
                     GSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R 
Sbjct  247  QGSFSGFNPGSSVPLGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  306

Query  279  IPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
             PPPDC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VFAY  + S + + 
Sbjct  307  APPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASETDEV  364


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFI  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGGTCKFNHP  157


 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|NP_001045201.2| Os01g0917400 [Oryza sativa Japonica Group]
 sp|Q5JLB5.2|C3H12_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 12; 
Short=OsC3H12; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 2 [Oryza sativa Japonica Group]
 dbj|BAD87735.1| putative zinc finger protein [Oryza sativa Japonica Group]
 dbj|BAG93826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07115.2| Os01g0917400 [Oryza sativa Japonica Group]
 gb|AEM43044.1| CCCH-type zinc finger protein [Oryza sativa Indica Group]
Length=439

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 127/182 (70%), Gaps = 34/182 (19%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++VPQG+V VP + +Y+GQ+  VSS+E +  + G+ Q YGTS+        
Sbjct  245  WQNPSNYAPMIVPQGLVQVPSWNSYTGQMMPVSSSESRLQSPGAQQTYGTSQQVDASAGN  304

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPECQ+YMKTGDCKFG+VC+FHHPR R +P
Sbjct  305  QGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMP  364

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH-----PMGVFAYSLSPSPSTD  449
             PDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDH     PMGV+AY    S ST+
Sbjct  365  TPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG---SASTN  421

Query  450  AP  455
             P
Sbjct  422  VP  423


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  122  YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  181

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+G +CKF HP
Sbjct  182  KTGQCKYGNTCKFHHP  197


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG  CRF+HP++R +      +     P R G+P C +Y 
Sbjct  77   YPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAIASARMK-GEYPERMGQPECQYYL  135

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFGP+CKF HP
Sbjct  136  KTGTCKFGPTCKFHHP  151



>ref|XP_009416574.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=442

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 126/177 (71%), Gaps = 29/177 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQ  S+Y+ L++PQG+V VPG+  S  LGS  S E Q+ T G++Q YG S+         
Sbjct  218  WQASSSYAQLILPQGVVQVPGWT-SYSLGS--SPESQR-TTGTAQFYGPSQQGETSIGAQ  273

Query  156  ----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPP  287
                            A+  EN+FPERPGQPECQFYMKTGDCKFG+VC+FHHP+ERL+P 
Sbjct  274  GKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVPV  333

Query  288  PDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
            P+C+LSP+GLPLRPGEP+C+FYSRYGICKFGP+CKFDHPMG FAY +S S +T  P 
Sbjct  334  PNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHPMGTFAYGVSASSATGVPT  390


 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG++C+FHHP+E+        L+ +G PLR  E  C +Y 
Sbjct  94   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYI  153

Query  357  RYGICKFGPSCKFDHPM  407
            R G CKFG +CKF HP 
Sbjct  154  RTGECKFGGTCKFHHPQ  170


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 7/121 (6%)
 Frame = +3

Query  63   GYAYSGQLGSVSSAEGQKLTA--GSSQVYGTSRAIERENV----FPERPGQPECQFYMKT  224
            G  +S +  + +  EG  L++  G+ +     R  E +++    +PERPG+P+C +Y++T
Sbjct  3    GDGWSTRAPARTVTEGPSLSSQPGTDEEAMWKRMRESDSMETGPYPERPGEPDCAYYIRT  62

Query  225  GDCKFGSVCRFHHPRERLIPPPDCMLSPI-GLPLRPGEPICIFYSRYGICKFGPSCKFDH  401
            G C+FG  C+F+HP  R++           G P R G+P C +Y + G CKFG  CKF H
Sbjct  63   GLCRFGRTCKFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHH  122

Query  402  P  404
            P
Sbjct  123  P  123



>gb|AAF26977.1|AC018363_22 zinc finger protein 1 (zfn1) [Arabidopsis thaliana]
Length=377

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 120/176 (68%), Gaps = 26/176 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQK--------------------  116
            WQ PS+Y+ L++PQG+V V G+  YSGQLGSVS S  G                      
Sbjct  167  WQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDQNYRNLQQNETIESGSQSQG  226

Query  117  ----LTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                   GSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P
Sbjct  227  SFSGYNPGSSVPLGGYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAP  286

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPDC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VF Y  + S + + 
Sbjct  287  PPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASETDEV  342


 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  62   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  121

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  122  RTGHCKFGGTCKFNHP  137


 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  17   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  75

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGVTCKFHHP  91



>ref|NP_566183.1| zinc finger protein 1 [Arabidopsis thaliana]
 sp|Q8GXX7.1|C3H33_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 33; 
Short=AtC3H33; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN1 [Arabidopsis thaliana]
 dbj|BAC42614.1| putative zinc finger protein 1 zfn1 [Arabidopsis thaliana]
 gb|ABG25055.1| At3g02830 [Arabidopsis thaliana]
 gb|AEE73864.1| zinc finger protein 1 [Arabidopsis thaliana]
Length=397

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 120/176 (68%), Gaps = 26/176 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQK--------------------  116
            WQ PS+Y+ L++PQG+V V G+  YSGQLGSVS S  G                      
Sbjct  187  WQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDQNYRNLQQNETIESGSQSQG  246

Query  117  ----LTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                   GSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P
Sbjct  247  SFSGYNPGSSVPLGGYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAP  306

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPDC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VF Y  + S + + 
Sbjct  307  PPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASETDEV  362


 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGGTCKFNHP  157


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>gb|ABG22481.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EEC68139.1| hypothetical protein OsI_36059 [Oryza sativa Indica Group]
Length=406

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 28/179 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG+  Y+ Q+GS SS++ Q+ TAG +Q Y  SR        
Sbjct  184  WPGHSSYAQVIVPPGLVQVPGWNPYAAQIGS-SSSDDQQRTAGGAQYYTGSRHSETPNMG  242

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                               ++RE++FPERP QPECQFYMKTGDCKFG+VC+FHHP+ER+I
Sbjct  243  DQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERII  302

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
            P P+C LS +GLPLRPGEPIC FYSRYGICKFGP+CKFDHPMG   Y L+ SP+ D  A
Sbjct  303  PTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPTGDVSA  361


 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  53   AARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNE  112

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  113  KECAYYLRTGQCKFGSTCKFHHP  135



>gb|EMS50271.1| Zinc finger CCCH domain-containing protein 12 [Triticum urartu]
Length=406

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 126/184 (68%), Gaps = 30/184 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++VPQG+V VP + +Y GQ+  VSS E +  + G+ Q YGTSR        
Sbjct  210  WQSPSNYTPMIVPQGLVQVPSWNSYPGQMVPVSSPESRLQSPGAQQYYGTSRQGEASAGN  269

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPEC +Y+KTGDCKFG+VC+FHHPR R  P
Sbjct  270  QGMQSSYRSSSFPAPQYALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSQP  329

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH----PMGVFAYSLSPSPSTDA  452
            PPDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDH    PMGV+AY  S S S +A
Sbjct  330  PPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNCKFDHPMAAPMGVYAYGYSASASPNA  389

Query  453  PAGQ  464
            P  +
Sbjct  390  PMAR  393


 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  86   YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNERECAYYL  145

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+G +CKF+HP
Sbjct  146  KTGQCKYGNTCKFNHP  161


 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 1/100 (1%)
 Frame = +3

Query  105  EGQKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
            +  K+     Q+  +S A  +   +P RPG+P+C +Y++TG C+FG  CRF+HP++R   
Sbjct  17   QDMKVEGMWQQMAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTA  76

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
                 +     P R G+P C +Y + G CKFGP+CKF HP
Sbjct  77   IASARMKG-EYPERVGQPECQYYLKTGTCKFGPTCKFHHP  115



>dbj|BAJ99149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 126/184 (68%), Gaps = 30/184 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++VPQG+V VP + +Y GQ+  VSS E +  + G+ Q YGTSR        
Sbjct  187  WQSPSNYTPMIVPQGLVQVPSWNSYPGQMVPVSSPESRLQSPGAQQYYGTSRQGEGSAGN  246

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPEC +Y+KTGDCKFG+VC+FHHPR R  P
Sbjct  247  QGMQSPYRSSSFPVPQYALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSQP  306

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH----PMGVFAYSLSPSPSTDA  452
            PPDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDH    PMGV+AY  S S S +A
Sbjct  307  PPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNCKFDHPMAAPMGVYAYGYSASASPNA  366

Query  453  PAGQ  464
            P  +
Sbjct  367  PMAR  370


 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  63   YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNALGYPLRPNERECAYYL  122

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+G +CKF+HP
Sbjct  123  KTGQCKYGNTCKFNHP  138


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P RPG+P+C +Y++TG C+FG  CRF+HP++R        +     P R G+P C +Y 
Sbjct  18   YPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIASARMK-GEYPERVGQPECQYYL  76

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFGP+CKF HP
Sbjct  77   KTGTCKFGPTCKFHHP  92



>gb|AAD33769.1|AF138743_1 zinc finger protein 1 [Arabidopsis thaliana]
Length=424

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 120/176 (68%), Gaps = 26/176 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQK--------------------  116
            WQ PS+Y+ L++PQG+V V G+  YSGQLGSVS S  G                      
Sbjct  187  WQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDQNYRNLQQNETIESGSQSQG  246

Query  117  ----LTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                   GSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P
Sbjct  247  SFSGYNPGSSVPLGGYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAP  306

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPDC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VF Y  + S + + 
Sbjct  307  PPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASETDEV  362


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G PEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGHPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGGTCKFNHP  157


 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CR +HPR+R +      +     P R G P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRVNHPRDRELVIATARMRG-EYPERIGHPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_006662931.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Oryza brachyantha]
Length=407

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 124/176 (70%), Gaps = 28/176 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG+  Y+ Q+GS SS++ Q+ TAG +Q Y +SR        
Sbjct  184  WPGHSSYAQVIVPPGLVQVPGWNPYAAQIGS-SSSDDQQRTAGGAQYYTSSRHSETPTMG  242

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                               ++RE++FPERP QPECQFYMKTGDCKFG+VC+FHHP+ER++
Sbjct  243  DQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIV  302

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTD  449
            P P+C LS +GLPLRPGEPIC FYSRYGICKFGP+CKFDHPMG   Y L+ SP+ D
Sbjct  303  PTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPTGD  358


 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  53   AARMKGEYPQRIGQPECQYYLKTGACKFGATCKFHHPREKAAMATRVQLNALGYPLRPNE  112

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  113  KECAYYLRTGQCKFGSTCKFHHP  135



>ref|XP_009134712.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=379

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 119/160 (74%), Gaps = 13/160 (8%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSA----------EGQKLTAGSSQVYGTS  152
            WQ PS ++PLM+PQG+V  P   Y+GQLGSVS +          E Q+  +GSS   G  
Sbjct  189  WQDPSGFTPLMMPQGVVWNP---YTGQLGSVSPSGTGNDHNNYRELQQNESGSSVPQGGI  245

Query  153  RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPG  332
             A+  E+VFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  PPPDC+LSPIGLPLRPG
Sbjct  246  YALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPG  305

Query  333  EPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            EP+C+FYSRY ICKFGPSCKF  PMGVF Y  + S + + 
Sbjct  306  EPLCVFYSRYRICKFGPSCKFHPPMGVFTYDNTASETDEV  345


 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +     M      P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATAMRGE--YPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|NP_001067878.1| Os11g0472000 [Oryza sativa Japonica Group]
 dbj|BAF28241.1| Os11g0472000, partial [Oryza sativa Japonica Group]
Length=414

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 28/179 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG+  Y+ Q+GS SS++ Q+ TAG +Q Y  SR        
Sbjct  192  WPGHSSYAQVIVPPGLVQVPGWNPYAAQIGS-SSSDDQQRTAGGAQYYTGSRHSETPNMG  250

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                               ++RE++FPERP QPECQFYMKTGDCKFG+VC+FHHP+ER+I
Sbjct  251  DQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERII  310

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
            P P+C LS +GLPLRPGEPIC FYSRYGICKFGP+CKFDHPMG   Y L+ SP+ D  A
Sbjct  311  PTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPTGDVSA  369


 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  61   AARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNE  120

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  121  KECAYYLRTGQCKFGSTCKFHHP  143



>gb|ACU21592.1| Zinc finger protein [Triticum aestivum]
 emb|CDM85631.1| unnamed protein product [Triticum aestivum]
Length=435

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 126/184 (68%), Gaps = 30/184 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++VPQG+V VP + +Y GQ+  VSS E +  + G+ Q YGTSR        
Sbjct  239  WQSPSNYTPMIVPQGLVQVPNWNSYPGQMVPVSSPESRLQSPGAQQYYGTSRQGEASAGN  298

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPEC +Y+KTGDCKFG+VC+FHHPR R  P
Sbjct  299  QGMQSPYRSSSFPAPQYALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSQP  358

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH----PMGVFAYSLSPSPSTDA  452
            PPDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDH    PMGV+AY  S S S +A
Sbjct  359  PPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNCKFDHPMAAPMGVYAYGYSASASPNA  418

Query  453  PAGQ  464
            P  +
Sbjct  419  PMAR  422


 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  115  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNERECAYYL  174

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+G +CKF+HP
Sbjct  175  KTGQCKYGNTCKFNHP  190


 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+  +S A  +   +P RPG+P+C +Y++TG C+FG  CRF+HP++R        +    
Sbjct  56   QMAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIASARMK-GE  114

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFGP+CKF HP
Sbjct  115  YPERVGQPECQYYLKTGTCKFGPTCKFHHP  144



>sp|Q2R4J4.2|C3H63_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 63; 
Short=OsC3H63 [Oryza sativa Japonica Group]
 gb|ABA93650.2| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|AGT38442.1| zinc finger protein [Oryza sativa Japonica Group]
Length=444

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 28/179 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG+  Y+ Q+GS SS++ Q+ TAG +Q Y  SR        
Sbjct  222  WPGHSSYAQVIVPPGLVQVPGWNPYAAQIGS-SSSDDQQRTAGGAQYYTGSRHSETPNMG  280

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                               ++RE++FPERP QPECQFYMKTGDCKFG+VC+FHHP+ER+I
Sbjct  281  DQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERII  340

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
            P P+C LS +GLPLRPGEPIC FYSRYGICKFGP+CKFDHPMG   Y L+ SP+ D  A
Sbjct  341  PTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPTGDVSA  399


 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  91   AARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNE  150

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  151  KECAYYLRTGQCKFGSTCKFHHP  173



>ref|XP_009406323.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 125/179 (70%), Gaps = 29/179 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ  S+Y+ L++PQG+V VPG+ +YSGQLGS  S E Q+ T G++Q Y   +        
Sbjct  186  WQASSSYAQLILPQGVVQVPGWTSYSGQLGS--SPESQQ-TIGTAQFYSAPQQGETSTGA  242

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A+ REN+FPERPGQPECQFYMKTGDCKFG+VC+FHHPRERL+P
Sbjct  243  HGKFPSYRPGPVPVGMYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLVP  302

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
             P+C+LSP+GLPLRPGEP+C FYSRYGICKFGP+CK+DHP+  + Y LS S   + P  
Sbjct  303  VPNCVLSPLGLPLRPGEPLCDFYSRYGICKFGPNCKYDHPIRTYTYGLSASSMAEVPTA  361


 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 62/98 (63%), Gaps = 4/98 (4%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  62   YPERVGQPECQYYLKTGTCKFGATCKFHHPREKAGISEQVQLNILGYPLRPNEKECAYYL  121

Query  357  RYGICKFGPSCKFDHPM---GVFAYSLSPS-PSTDAPA  458
            R G CKFG +CKF HP     V A   SP  PS  +P 
Sbjct  122  RTGECKFGSTCKFHHPQPSNAVLALHGSPVYPSAHSPT  159



>dbj|BAJ86320.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=442

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 122/177 (69%), Gaps = 27/177 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W GPS Y  ++VPQG+V VPG+  Y+ Q+GS SS +GQ+ T G++  YGT +        
Sbjct  220  WPGPSGYEQVIVPQGLVQVPGWNPYAAQMGS-SSLDGQQRTPGTAHYYGTHQRETTGMGE  278

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++ EN FPERP QPECQFYMKTGDCKFG+VC+F+HP++R++P
Sbjct  279  HGMFTSHKAGSAPLGVYAVQGENTFPERPEQPECQFYMKTGDCKFGAVCKFNHPKKRMVP  338

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAP  455
             P+C LSP+GLPLRPGEPIC FYSRYGICKFGP+CKFDHPMG   Y    SP+ D P
Sbjct  339  APNCALSPLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTILYGSPTSPTGDVP  395


 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 63/106 (59%), Gaps = 6/106 (6%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLR  E
Sbjct  89   AARMKGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIAISAQLNVLGYPLRLNE  148

Query  336  PICIFYSRYGICKFGPSCKFDHP------MGVFAYSLSPSPSTDAP  455
              C++Y R G CKF  +CKF HP      + + +   SP  ST +P
Sbjct  149  KECVYYLRTGQCKFASTCKFHHPQPSSTMVAIRSSICSPGQSTTSP  194


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+ +C +YM+TG C+FG  C+F+HP +R +      +     P R G+P C +Y 
Sbjct  51   YPERIGERDCSYYMRTGFCRFGVTCKFNHPADRKLAVAAARMKGE-YPYRVGQPECQYYL  109

Query  357  RYGICKFGPSCKFDHPMGVFAYSLS  431
            + G CKFG +CKF HP    A ++S
Sbjct  110  KTGTCKFGATCKFHHPREKAAIAIS  134



>ref|XP_008389043.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Malus domestica]
Length=195

 Score =   192 bits (489),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 126/153 (82%), Gaps = 10/153 (7%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A++RENVFPERPGQPECQFYMKTGDCKFG+VCRFHHP ERLIP PDC+LSPIGLPLRPGE
Sbjct  44   ALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPGE  103

Query  336  PICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllgsssgtgaltlsse  515
            P+CIFYSRYGICKFGPSCKF+HPMG+F Y LS S S DAPA +  LGS+SG  +L L+S 
Sbjct  104  PMCIFYSRYGICKFGPSCKFBHPMGIFTYGLSASSSADAPARRL-LGSTSGAASLNLASS  162

Query  516  glVDAGSTNPRR--------LPSG-DNNIETEE  587
            GLV AGS NPRR        +PS  +NNI+ EE
Sbjct  163  GLVXAGSANPRRVSLSEPRQMPSAEBNNIDREE  195



>ref|XP_010485612.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Camelina 
sativa]
Length=401

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 119/177 (67%), Gaps = 27/177 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQKLTA-----------------  125
            WQ PS Y  L++PQG+V V G+  YSGQLGSVS S     L                   
Sbjct  187  WQDPSTYPSLIMPQGVVPVQGWNPYSGQLGSVSPSGTRNDLNNYRSLQQSETKESGSQSQ  246

Query  126  --------GSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                    GSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  
Sbjct  247  GSFSGFNPGSSVPLGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQA  306

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPPDC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VFAY  + S + + 
Sbjct  307  PPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASETDEV  363


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGGTCKFNHP  157


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_003564925.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Brachypodium distachyon]
Length=442

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 127/184 (69%), Gaps = 30/184 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++V QG+V VP + +Y GQ+  VSS+E +  + G+ Q YGT R        
Sbjct  246  WQSPSNYAPMIVQQGLVQVPSWNSYPGQMLPVSSSESRLQSPGAQQNYGTYRQGEASSGN  305

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPEC +Y+KTGDCKFG+VC+FHHPR R +P
Sbjct  306  QGMLSPYRPSSFPVPQYALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSLP  365

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH----PMGVFAYSLSPSPSTDA  452
            PPDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDH    PMGV+AY  S S ST+A
Sbjct  366  PPDCVLSPMGLPLRPGEELCKFYSRYGICKFGINCKFDHPMASPMGVYAYGFSASASTNA  425

Query  453  PAGQ  464
            P  +
Sbjct  426  PMAR  429


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 62/101 (61%), Gaps = 6/101 (6%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PLR  E  C +Y 
Sbjct  122  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRLNEKECAYYL  181

Query  357  RYGICKFGPSCKFDHPMGVFAYSLS------PSPSTDAPAG  461
            + G CK+G +CKF+HP    A + S      PS  T A AG
Sbjct  182  KTGQCKYGNTCKFNHPELFNAVASSRGSPIYPSLHTSASAG  222


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FG  CRF+HP +R +      +     P R G+P C +Y 
Sbjct  77   YPERPGEPDCTYYLRTGLCRFGISCRFNHPPDRNLAIASARMK-GEYPERVGQPECQYYL  135

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFGP+CKF HP
Sbjct  136  KTGTCKFGPTCKFHHP  151



>gb|EEE52080.1| hypothetical protein OsJ_33853 [Oryza sativa Japonica Group]
Length=529

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 124/179 (69%), Gaps = 28/179 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG+  Y+ Q+GS SS++ Q+ TAG +Q Y  SR        
Sbjct  307  WPGHSSYAQVIVPPGLVQVPGWNPYAAQIGS-SSSDDQQRTAGGAQYYTGSRHSETPNMG  365

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                               ++RE++FPERP QPECQFYMKTGDCKFG+VC+FHHP+ER+I
Sbjct  366  DQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERII  425

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
            P P+C LS +GLPLRPGEPIC FYSRYGICKFGP+CKFDHPMG   Y L+ SP+ D  A
Sbjct  426  PTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPTGDVSA  484


 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  176  AARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNE  235

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  236  KECAYYLRTGQCKFGSTCKFHHP  258



>ref|XP_003577562.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Brachypodium distachyon]
Length=445

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 126/181 (70%), Gaps = 28/181 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG++ Y+ QLGS SS++ Q  ++G++Q Y  SR        
Sbjct  222  WPGHSSYAQVIVPPGLVQVPGWSPYAAQLGS-SSSDDQGRSSGAAQYYTGSRQSETQGMS  280

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RE +FP+RP QPECQFYMKTGDCKFG+VC+FHHP+ER+I
Sbjct  281  DHGMISSYQHGSVPAGLYAVQREYIFPDRPDQPECQFYMKTGDCKFGAVCKFHHPKERII  340

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P P C LSP+GLPLR GEPIC FYSRYGICKFGP+CKFDHPMG   Y L+ SP+ + P G
Sbjct  341  PSPSCALSPLGLPLRSGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSPTGEVPTG  400

Query  462  Q  464
            +
Sbjct  401  R  401


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  91   AARMKGEYPQRIGQPECQYYLKTGMCKFGATCKFHHPREKAAMATRVQLNVLGYPLRPNE  150

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF+HP
Sbjct  151  KECSYYLRTGQCKFGSTCKFNHP  173


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 57/99 (58%), Gaps = 12/99 (12%)
 Frame = +3

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
            ++PER G+P+C +YM+TG C+FG  C+F+HP +R +      +     P R G+P C +Y
Sbjct  52   LYPERVGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARMKG-EYPQRIGQPECQYY  110

Query  354  SRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
             + G+CKFG +CKF HP           + V  Y L P+
Sbjct  111  LKTGMCKFGATCKFHHPREKAAMATRVQLNVLGYPLRPN  149


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 5/53 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            +P RP + EC +Y++TG CKFGS C+F+HP+     P + M++  G    PG+
Sbjct  144  YPLRPNEKECSYYLRTGQCKFGSTCKFNHPQ-----PSNTMVALRGSVFSPGQ  191



>emb|CDY51531.1| BnaA05g33310D [Brassica napus]
Length=395

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 120/177 (68%), Gaps = 27/177 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQK--------------------  116
            WQ PS Y+PL++PQG+V V G+  Y+GQLG+VS S  G                      
Sbjct  191  WQDPSGYTPLLMPQGVVPVQGWNPYTGQLGAVSPSGTGNDQTSYRNMQQSEIKESGSHSQ  250

Query  117  -----LTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                 L  GSS   G   A+  E+VFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  
Sbjct  251  GSFSGLNTGSSVPLGGFYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQA  310

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPPDC+LS IGLPLRPGEP+C+FYSRYGICKFGPSCKF HPM VFAY  + S + + 
Sbjct  311  PPPDCLLSTIGLPLRPGEPLCVFYSRYGICKFGPSCKFHHPMEVFAYDNTASETDEV  367


 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P C +Y++TG C+FGS CRF+HP +R +      +     P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_006645228.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Oryza brachyantha]
Length=381

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 121/171 (71%), Gaps = 31/171 (18%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++VPQG+V VP + +Y GQ+  VSS+E +  + G+ Q YGTS+        
Sbjct  187  WQNPSNYAPVIVPQGLVQVPSWNSYPGQMLPVSSSESRLQSPGAQQTYGTSQQADASAGN  246

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPECQ+YMKTGDCKFG+VC+FHHPR R +P
Sbjct  247  QGMLSPYRSSSYPGPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMP  306

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH-----PMGVFAY  422
             PDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDH     PMGV+AY
Sbjct  307  TPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPSMAPPMGVYAY  357


 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  63   YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  122

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+G +CKF HP
Sbjct  123  KTGQCKYGNTCKFHHP  138


 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERP +P+C +Y++TG C+FG  CRF+HP +R +      +     P R G+P C +Y 
Sbjct  18   YPERPEEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK-GEYPERMGQPECQYYL  76

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFGP+CKF HP
Sbjct  77   KTGTCKFGPTCKFHHP  92



>ref|XP_009382899.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 123/184 (67%), Gaps = 30/184 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIE-----  164
            WQG S+Y+ ++ PQG+V VP +  +SGQL SVSS+E Q     ++  YGTSR  E     
Sbjct  226  WQGLSSYAQVIFPQGLVQVPSWNTFSGQLRSVSSSESQLHMPQTTPFYGTSRQSETTTGV  285

Query  165  --------------------RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                                R+NVFP RPGQPEC+FY+KTGDCK+G+ C+FHHPRERLIP
Sbjct  286  QGMIHSYRSGAIPLGQYVLARDNVFPVRPGQPECEFYLKTGDCKYGAACKFHHPRERLIP  345

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH----PMGVFAYSLSPSPSTDA  452
             PDC+LSP+GLPLRP EPICIFYSRYGICKFG  CKFDH    PMG++AYSL+ S   D 
Sbjct  346  IPDCVLSPLGLPLRPEEPICIFYSRYGICKFGTHCKFDHPMAAPMGIYAYSLATSSLADV  405

Query  453  PAGQ  464
               +
Sbjct  406  AVAR  409


 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC+FY++TG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  104  YPERVGQPECEFYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNVLGYPLRPDEAECAYYM  163

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  164  KNGECKFGNTCKFHHP  179


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 54/88 (61%), Gaps = 5/88 (6%)
 Frame = +3

Query  153  RAIERENV----FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLP  320
            R  E E+V    FPERP +P+C +Y++TG C+FG  CR++HP  R +      +   G P
Sbjct  47   RMREIESVESGPFPERPREPDCTYYLRTGLCRFGITCRYNHPPNRQMAIAAARIKG-GYP  105

Query  321  LRPGEPICIFYSRYGICKFGPSCKFDHP  404
             R G+P C FY R G CKFG +CKF HP
Sbjct  106  ERVGQPECEFYLRTGTCKFGATCKFHHP  133


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 6/52 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPG  332
            +P RP + EC +YMK G+CKFG+ C+FHHP+      P+ M+S  G  + PG
Sbjct  150  YPLRPDEAECAYYMKNGECKFGNTCKFHHPQ------PNTMVSLCGSTVYPG  195



>ref|XP_010558591.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
[Tarenaya hassleriana]
Length=397

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 116/157 (74%), Gaps = 13/157 (8%)
 Frame = +3

Query  3    WQGPSN--YSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR------  155
            WQ PS+  ++ L++PQGMVSV G+  YSGQLGSV S+  +   AG+   Y          
Sbjct  203  WQDPSSSSFASLVLPQGMVSVQGWNTYSGQLGSVYSSGSRNQVAGNDHNYRDLLQNEAKE  262

Query  156  ----AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPL  323
                A+ RENVFPE+PGQPECQFYMKTGDCKFGSVC+FHHPR R  P PDC+LSPIGLPL
Sbjct  263  SGFYALPRENVFPEKPGQPECQFYMKTGDCKFGSVCKFHHPRNRQNPAPDCVLSPIGLPL  322

Query  324  RPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSP  434
            RPGEP+C FYSRYGICKFGPSCKFDHPM     S++P
Sbjct  323  RPGEPLCGFYSRYGICKFGPSCKFDHPMQRVFTSMNP  359


 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPR ++    +  L+ +G P+RP E  C +Y 
Sbjct  87   YPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKVGIAGNVSLNALGYPIRPNEVDCAYYL  146

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  147  RTGHCKFGSTCKFNHP  162


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
             +P+RPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y
Sbjct  41   AYPDRPGEPDCAYYIRTGLCRFGSTCRFNHPRDRNLAIATARMKG-EYPERIGQPECQYY  99

Query  354  SRYGICKFGPSCKFDHP  404
             + G CKFG +CKF HP
Sbjct  100  LKTGTCKFGVTCKFHHP  116



>ref|XP_009147316.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Brassica 
rapa]
Length=392

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 119/174 (68%), Gaps = 24/174 (14%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQK--------------------  116
            WQ PS Y+PL++PQG+V V G+  Y+GQLG+VS S  G                      
Sbjct  191  WQDPSGYTPLLMPQGVVPVQGWNPYTGQLGAVSPSGTGNDHNSYRNMQQNEAGSQSQGSV  250

Query  117  --LTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPP  290
              L   SS   G   A+  E+VFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  PPP
Sbjct  251  SGLNTASSVPLGGFYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPP  310

Query  291  DCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            DC+LSPIGLPLRPGEP+C+FYSRY ICKFGPSCKF HPM VFAY  + S + + 
Sbjct  311  DCLLSPIGLPLRPGEPLCVFYSRYRICKFGPSCKFHHPMEVFAYDNTASETDEV  364


 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P C +Y++TG C+FGS CRF+HP +R +      +     P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_006663970.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Oryza brachyantha]
Length=409

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 141/228 (62%), Gaps = 41/228 (18%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSRA-------  158
            W G S Y+ ++VPQG+V VPG+  Y+ Q+GS SS + Q+ T  ++Q YG+ ++       
Sbjct  187  WPGHSGYAQVIVPQGLVQVPGWNPYAAQMGS-SSPDDQQRTPVTTQYYGSRQSETAGMGD  245

Query  159  ------------------IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                              ++ EN+FPERP QPECQFYMKTGDCKFG+VC+FHHP+ERL+P
Sbjct  246  HGMFQSYQGSSVPIGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVP  305

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C L+ +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y  + SP+ D  +  
Sbjct  306  APNCALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLMYGSATSPTGDVSSLH  365

Query  465  FllgsssgtgaltlsseglVDAGS--------TNPRRLPSGDNNIETE  584
            +              S  L+D GS        ++ +++PSGD N E E
Sbjct  366  Y------QLSPSPGHSGILLDGGSGRSHRVPQSDSQQIPSGDGNTERE  407


 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A      +P R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G P+RP E
Sbjct  56   AARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVLGYPMRPNE  115

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKF  +CKF HP
Sbjct  116  KECAYYLRTGQCKFASTCKFHHP  138


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP  R +      ++    P R G+P C +Y 
Sbjct  18   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMNGE-YPYRVGQPECQYYL  76

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  77   KTGTCKFGATCKFHHP  92


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 5/53 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            +P RP + EC +Y++TG CKF S C+FHHP+     P + M+S  G    PG+
Sbjct  109  YPMRPNEKECAYYLRTGQCKFASTCKFHHPQ-----PSNTMVSMRGSMYSPGQ  156



>ref|XP_006663969.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Oryza brachyantha]
Length=448

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 141/228 (62%), Gaps = 41/228 (18%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSRA-------  158
            W G S Y+ ++VPQG+V VPG+  Y+ Q+GS SS + Q+ T  ++Q YG+ ++       
Sbjct  226  WPGHSGYAQVIVPQGLVQVPGWNPYAAQMGS-SSPDDQQRTPVTTQYYGSRQSETAGMGD  284

Query  159  ------------------IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                              ++ EN+FPERP QPECQFYMKTGDCKFG+VC+FHHP+ERL+P
Sbjct  285  HGMFQSYQGSSVPIGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVP  344

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C L+ +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y  + SP+ D  +  
Sbjct  345  APNCALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLMYGSATSPTGDVSSLH  404

Query  465  FllgsssgtgaltlsseglVDAGS--------TNPRRLPSGDNNIETE  584
            +              S  L+D GS        ++ +++PSGD N E E
Sbjct  405  Y------QLSPSPGHSGILLDGGSGRSHRVPQSDSQQIPSGDGNTERE  446


 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A      +P R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G P+RP E
Sbjct  95   AARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVLGYPMRPNE  154

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKF  +CKF HP
Sbjct  155  KECAYYLRTGQCKFASTCKFHHP  177


 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP  R +      ++    P R G+P C +Y 
Sbjct  57   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMNG-EYPYRVGQPECQYYL  115

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  116  KTGTCKFGATCKFHHP  131


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 5/53 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            +P RP + EC +Y++TG CKF S C+FHHP+     P + M+S  G    PG+
Sbjct  148  YPMRPNEKECAYYLRTGQCKFASTCKFHHPQ-----PSNTMVSMRGSMYSPGQ  195



>ref|XP_004979251.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X1 [Setaria italica]
Length=450

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 126/181 (70%), Gaps = 28/181 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG++ Y+ Q+GS SS++ Q+ T G++Q Y  SR        
Sbjct  227  WPGHSSYAQVIVPPGLVQVPGWSPYTAQIGS-SSSDDQQQTPGAAQYYTGSRQSGTPGMG  285

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERP QPECQFYMKTGDCKFG+VC+FHHPRER+I
Sbjct  286  DQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERII  345

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P P+C LS +GLPLRPGEPIC FYSRYG+CKFGP+CKFDHP+G   +  + SP+ + P  
Sbjct  346  PTPNCALSSLGLPLRPGEPICSFYSRYGMCKFGPNCKFDHPLGTVMFGHASSPTGEVPTS  405

Query  462  Q  464
            +
Sbjct  406  R  406


 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G P RP E
Sbjct  96   AARMKGEYPQRSGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPFRPNE  155

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  156  KECAYYLRTGQCKFGSTCKFHHP  178


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP +R +      +     P R G+P C +Y 
Sbjct  58   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARMKG-EYPQRSGQPECQYYL  116

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  117  KTGTCKFGATCKFHHP  132



>ref|XP_004979252.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X2 [Setaria italica]
Length=448

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 126/181 (70%), Gaps = 28/181 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG++ Y+ Q+GS SS++ Q+ T G++Q Y  SR        
Sbjct  225  WPGHSSYAQVIVPPGLVQVPGWSPYTAQIGS-SSSDDQQQTPGAAQYYTGSRQSGTPGMG  283

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERP QPECQFYMKTGDCKFG+VC+FHHPRER+I
Sbjct  284  DQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCKFHHPRERII  343

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P P+C LS +GLPLRPGEPIC FYSRYG+CKFGP+CKFDHP+G   +  + SP+ + P  
Sbjct  344  PTPNCALSSLGLPLRPGEPICSFYSRYGMCKFGPNCKFDHPLGTVMFGHASSPTGEVPTS  403

Query  462  Q  464
            +
Sbjct  404  R  404


 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G P RP E
Sbjct  94   AARMKGEYPQRSGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPFRPNE  153

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  154  KECAYYLRTGQCKFGSTCKFHHP  176


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP +R +      +     P R G+P C +Y 
Sbjct  56   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARMKGE-YPQRSGQPECQYYL  114

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  115  KTGTCKFGATCKFHHP  130



>emb|CDX92015.1| BnaC03g33170D [Brassica napus]
Length=371

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 117/160 (73%), Gaps = 13/160 (8%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVS-SAEG---------QKLTAGSSQVYGTS  152
            WQ  S ++ LM+PQG++  P   Y+ QLGSVS S  G         Q+  +GSS   G  
Sbjct  181  WQDTSGFTALMMPQGVIWNP---YTSQLGSVSPSGTGNDHNNYRKLQQNESGSSVPQGGI  237

Query  153  RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPG  332
             A+  E+VFPERPGQPECQFY+KTGDCKFG+VC+FHHPR+R  PPPDC+LSPIGLPLRPG
Sbjct  238  YALPSESVFPERPGQPECQFYVKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPG  297

Query  333  EPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            EP C+FYSRYGICKFGPSCKF HPMGVF Y  + S + + 
Sbjct  298  EPSCVFYSRYGICKFGPSCKFHHPMGVFTYDNTASETDEV  337


 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  75   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLR-NEVDCAYFL  133

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  134  RTGHCKFGATCKFNHP  149


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+  TS        +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +    
Sbjct  16   QMNMTSDETMEPGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-E  74

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFG +CKF HP
Sbjct  75   YPERIGQPECEYYLKTGTCKFGVTCKFHHP  104



>ref|NP_001066624.1| Os12g0405100 [Oryza sativa Japonica Group]
 sp|Q2QT65.1|C3H66_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 66; 
Short=OsC3H66 [Oryza sativa Japonica Group]
 gb|ABA97542.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29643.1| Os12g0405100 [Oryza sativa Japonica Group]
 dbj|BAG99287.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53085.1| hypothetical protein OsJ_35844 [Oryza sativa Japonica Group]
Length=454

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 139/228 (61%), Gaps = 41/228 (18%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSRA-------  158
            W G S Y+ ++VPQG+V VPG+  Y+ Q+GS SS + Q+ T  ++Q YG+ ++       
Sbjct  232  WPGHSGYAQVIVPQGLVQVPGWNPYAAQMGS-SSPDDQQRTPVTTQYYGSRQSETGGMGD  290

Query  159  ------------------IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                              ++ EN+FPERP QPECQFYMKTGDCKFG+VC+FHHP+ERL+P
Sbjct  291  HGMYQSYQGGSVPVGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVP  350

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQ  464
             P+C L+ +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y  + SP  D  +  
Sbjct  351  APNCALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLMYGSATSPRGDVSSMH  410

Query  465  FllgsssgtgaltlsseglVDAGS--------TNPRRLPSGDNNIETE  584
            +                 L+D GS        ++ +++PSGD N E E
Sbjct  411  Y------QLSPSPGHPGILLDGGSGRSHRVPQSDSQQIPSGDGNAERE  452


 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A      +P R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G P+RP E
Sbjct  101  AARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPMRPNE  160

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKF  +CKF HP
Sbjct  161  KECAYYLRTGQCKFASTCKFHHP  183


 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP  R +      ++    P R G+P C +Y 
Sbjct  63   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMNGE-YPYRVGQPECQYYL  121

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  122  KTGTCKFGATCKFHHP  137


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (4%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPR--ERLIPPPDCMLSPIGLPLRPGE  335
            +P RP + EC +Y++TG CKF S C+FHHP+    ++   + M SP      PG+
Sbjct  154  YPMRPNEKECAYYLRTGQCKFASTCKFHHPQPSNTMVAVRNSMYSPGQSATSPGQ  208



>ref|NP_001130819.1| uncharacterized protein LOC100191923 [Zea mays]
 gb|ACF79183.1| unknown [Zea mays]
 gb|ACG29102.1| zinc finger CCCH type domain-containing protein ZFN-like [Zea 
mays]
 gb|ACN25540.1| unknown [Zea mays]
 gb|ACN28916.1| unknown [Zea mays]
 gb|ACR36098.1| unknown [Zea mays]
 gb|AFT82657.1| C3H19 transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA38868.1| TPA: putative Zinc finger CCCH type domain-containing protein 
ZFN [Zea mays]
Length=443

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 125/177 (71%), Gaps = 28/177 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S+Y+ ++VP G+V VPG++ Y+ Q+GS SS++ Q+ T G++Q Y  SR        
Sbjct  220  WPGHSSYAQVIVPPGLVQVPGWSPYAAQIGS-SSSDDQQRTPGAAQYYTGSRQSGTPGIG  278

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++ ENVFPERP QPECQFYMKTGDCKFGSVC+FHHPRER+I
Sbjct  279  DRGMFSSYQAGSVPVGLYAVQTENVFPERPDQPECQFYMKTGDCKFGSVCKFHHPRERII  338

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            P P+C LSP+GLPLRPGEPIC FY+RYG+CKFGP+CKF HPMG   Y  + SP+++A
Sbjct  339  PTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFHHPMGNPMYGHASSPTSEA  395


 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +P+R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLR  E
Sbjct  89   AARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRLNE  148

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKFG +CKF HP
Sbjct  149  KECAYYLRTGQCKFGSTCKFHHP  171


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 9/104 (9%)
 Frame = +3

Query  117  LTAGSSQVYGTSRAIERENV--------FPERPGQPECQFYMKTGDCKFGSVCRFHHPRE  272
            +T G+  V   + A+ + N+        +PER G P+C +YM+TG C+FG  C+F+HP +
Sbjct  23   MTIGAHGVDQVTEAMWQMNLGDAMELGPYPERVGDPDCSYYMRTGMCRFGMTCKFNHPAD  82

Query  273  RLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            R +      +     P R G+P C +Y + G CKFG +CKF HP
Sbjct  83   RKLAVAAARMKG-EYPQRIGQPECQYYLKTGTCKFGATCKFHHP  125



>ref|XP_003576637.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Brachypodium distachyon]
Length=442

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 122/182 (67%), Gaps = 28/182 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S Y+ ++VPQ +V VPG+  Y+ Q+GS SS + Q+ T G++  Y  SR        
Sbjct  218  WPGHSGYAQVIVPQSIVQVPGWNPYAAQIGS-SSPDDQQRTPGTTHYYSGSRQSETTGMG  276

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++ +NVFPERP QPECQFYMKTGDCKFG+VC+F+HP+ER+I
Sbjct  277  DHGMFPSYQAGSVPLGVYAVQGDNVFPERPDQPECQFYMKTGDCKFGAVCKFNHPKERMI  336

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P P+C LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y    SP++D P  
Sbjct  337  PAPNCALSPLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTVMYGSVTSPTSDVPTL  396

Query  462  QF  467
             +
Sbjct  397  HY  398


 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A      +P R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  87   AARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPNE  146

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKF  +CKF HP
Sbjct  147  KECAYYLRTGQCKFASTCKFHHP  169


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 12/98 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP  R +      ++    P R G+P C +Y 
Sbjct  49   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMNGE-YPYRVGQPECQYYL  107

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
            + G CKFG +CKF HP           + V  Y L P+
Sbjct  108  KTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPN  145



>ref|XP_010237293.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Brachypodium distachyon]
Length=445

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 122/182 (67%), Gaps = 28/182 (15%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            W G S Y+ ++VPQ +V VPG+  Y+ Q+GS SS + Q+ T G++  Y  SR        
Sbjct  221  WPGHSGYAQVIVPQSIVQVPGWNPYAAQIGS-SSPDDQQRTPGTTHYYSGSRQSETTGMG  279

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++ +NVFPERP QPECQFYMKTGDCKFG+VC+F+HP+ER+I
Sbjct  280  DHGMFPSYQAGSVPLGVYAVQGDNVFPERPDQPECQFYMKTGDCKFGAVCKFNHPKERMI  339

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            P P+C LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y    SP++D P  
Sbjct  340  PAPNCALSPLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTVMYGSVTSPTSDVPTL  399

Query  462  QF  467
             +
Sbjct  400  HY  401


 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A      +P R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G PLRP E
Sbjct  90   AARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPNE  149

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y R G CKF  +CKF HP
Sbjct  150  KECAYYLRTGQCKFASTCKFHHP  172


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 12/98 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP  R +      ++    P R G+P C +Y 
Sbjct  52   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMNGE-YPYRVGQPECQYYL  110

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
            + G CKFG +CKF HP           + V  Y L P+
Sbjct  111  KTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPN  148



>ref|XP_010501886.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=400

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 118/177 (67%), Gaps = 29/177 (16%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQKLTA-----------------  125
            WQ PS Y  L++PQG+V V G+  YS  LGSVS S  G  L                   
Sbjct  187  WQDPSTYPSLIMPQGVVPVQGWNPYS--LGSVSPSGTGNDLNYNRSLQQSETKESGSPSQ  244

Query  126  --------GSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                    GSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  
Sbjct  245  GSFSGFNPGSSVPLGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQA  304

Query  282  PPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            PPPDC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VFAY  + S + + 
Sbjct  305  PPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASETDEV  361


 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGGTCKFNHP  157


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_009118612.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=372

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 113/153 (74%), Gaps = 8/153 (5%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVS-SAEGQKLTA--GSSQVYGTSRAIEREN  173
            WQ PS ++PLM+PQG+V  P   YS  LGSVS S  G +        Q    S     EN
Sbjct  190  WQDPSGFTPLMMPQGVVWNP---YS--LGSVSPSGTGNEHNNYRNMQQNESGSSVQPSEN  244

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
            VFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P PDC+LSPIGLPLRPGEP+C+FY
Sbjct  245  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFY  304

Query  354  SRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            SRYGICKFGPSCKF+HPM +FAY  + S + + 
Sbjct  305  SRYGICKFGPSCKFNHPMEIFAYDNTASETDEV  337


 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  143  RTGHCKFGATCKFNHP  158


 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  96

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>ref|XP_010463710.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=402

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 118/178 (66%), Gaps = 30/178 (17%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVS-SAEGQKLTA-----------------  125
            WQ PS Y  L++PQG+V V G+  YS  LGSVS S  G  L                   
Sbjct  187  WQDPSTYPSLIMPQGVVPVQGWNPYS--LGSVSPSGTGNDLNYNRSLQQQSETKESGSQS  244

Query  126  ---------GSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERL  278
                     GSS   G   A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R 
Sbjct  245  QGSFSGFNPGSSVPLGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  304

Query  279  IPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
             PPPDC+LS IGLPLRPGEP+C+FY+RYGICKFGPSCKFDHPM VFAY  + S + + 
Sbjct  305  APPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASETDEV  362


 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFI  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGGTCKFNHP  157


 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +     P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_009134713.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=377

 Score =   190 bits (483),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 117/160 (73%), Gaps = 15/160 (9%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSA----------EGQKLTAGSSQVYGTS  152
            WQ PS ++PLM+PQG+V  P   Y+  LGSVS +          E Q+  +GSS   G  
Sbjct  189  WQDPSGFTPLMMPQGVVWNP---YT--LGSVSPSGTGNDHNNYRELQQNESGSSVPQGGI  243

Query  153  RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPG  332
             A+  E+VFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  PPPDC+LSPIGLPLRPG
Sbjct  244  YALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPG  303

Query  333  EPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDA  452
            EP+C+FYSRY ICKFGPSCKF  PMGVF Y  + S + + 
Sbjct  304  EPLCVFYSRYRICKFGPSCKFHPPMGVFTYDNTASETDEV  343


 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC++Y+KTG CKFG  C+FHHPR +        L+ +G PLR  E  C ++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFL  141

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HPR+R +     M      P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATAMRGE--YPERIGQPECEYYL  95

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>gb|EEC69137.1| hypothetical protein OsI_38063 [Oryza sativa Indica Group]
Length=395

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 137/222 (62%), Gaps = 41/222 (18%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSRA-------------  158
            Y+ ++VPQG+V VPG+  Y+ Q+GS SS + Q+ T  ++Q YG+ ++             
Sbjct  179  YAQVIVPQGLVQVPGWNPYAAQMGS-SSPDDQQRTPVTTQYYGSRQSETGGMGDHGMYQS  237

Query  159  ------------IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCML  302
                        ++ EN+FPERP QPECQFYMKTGDCKFG+VC+FHHP+ERL+P P+C L
Sbjct  238  YQGGSVPVGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPNCAL  297

Query  303  SPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllgss  482
            + +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y  + SP+ D  +  +     
Sbjct  298  NSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLMYGSATSPTGDVSSMHY-----  352

Query  483  sgtgaltlsseglVDAGS--------TNPRRLPSGDNNIETE  584
                        L+D GS        ++ +++PSGD N E E
Sbjct  353  -QLSPSPGHPGILLDGGSGRSHRVPQSDSQQIPSGDGNAERE  393


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A      +P R GQPECQ+Y+KTG CKFG+ C+FHHPRE+        L+ +G P+RP E
Sbjct  101  AARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPMRPNE  160

Query  336  PICIFYSRYGICKFGPSC  389
              C +Y R G CKF  +C
Sbjct  161  KECAYYLRTGQCKFASTC  178


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +YM+TG C+FG  C+F+HP  R +      ++    P R G+P C +Y 
Sbjct  63   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMNGE-YPYRVGQPECQYYL  121

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  122  KTGTCKFGATCKFHHP  137



>ref|XP_004971057.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Setaria italica]
Length=425

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 116/172 (67%), Gaps = 40/172 (23%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQ PSNY+P++VPQG+V VP + +Y GQL S           G+ Q YGTS+        
Sbjct  234  WQSPSNYAPMIVPQGLVQVPSWNSYPGQLQS----------PGAQQTYGTSQQGEPSAGN  283

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++RENVFPERP QPECQ+YMKTGDCKFG+VC+FHHPR R +P
Sbjct  284  QGMLSPYRSSSFPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSLP  343

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDH----PMGVFAYSL  428
            PPDC+LSP+GLP+RPGE +C FYSRYGICKFG +CKFDH    PMGV+AY  
Sbjct  344  PPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCKFDHPMTAPMGVYAYGF  395


 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PLRP E  C +Y 
Sbjct  110  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPNEKECAYYL  169

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+  +CKF HP
Sbjct  170  KTGQCKYANTCKFHHP  185


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   S A  +   +PERPG+P+C +Y++TG C+FG  CRF+HP +R +      +    
Sbjct  51   QMAMNSGATMQPGPYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK-GE  109

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFGP+CKF HP
Sbjct  110  YPERVGQPECQYYLKTGTCKFGPTCKFHHP  139



>gb|AFW84181.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=375

 Score =   185 bits (469),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 118/173 (68%), Gaps = 22/173 (13%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQL---------GSVSSAEGQKLTAGSSQVYGTS  152
            WQ PSNY+P++VP G+V VP + +Y GQL         GS    E      G    Y +S
Sbjct  183  WQSPSNYAPMVVPHGLVQVPSWNSYPGQLQSPGAQQTYGSSQQGEASAGNQGMLSPYRSS  242

Query  153  R------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
                   A++R+NVFPERP +PECQ+YMKTGDCKFG+VC+FHHPR R  PPPDC+LSP+G
Sbjct  243  SFPVPQYALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMG  302

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDH-----PMGVFAYSLSPSPSTDAPA  458
            LP+RPGE +C FYSRYGICKFG +CKFDH     PMGV+AY  S S S  APA
Sbjct  303  LPIRPGEELCKFYSRYGICKFGANCKFDHPTMAAPMGVYAYGFSGSASV-APA  354


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   S A  +   +PERPG+P+C +Y++TG C+FG  CRF+HP +R +      +    
Sbjct  52   QMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK-GE  110

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFGP+CKF HP
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHP  140


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 53/101 (52%), Gaps = 4/101 (4%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PL P     +   
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPSYTGTMSSW  170

Query  357  RYGICKFGPSCKFDHPMG----VFAYSLSPSPSTDAPAGQF  467
             +    F PS ++  P      V  + L   PS ++  GQ 
Sbjct  171  TFPRASFIPSPRWQSPSNYAPMVVPHGLVQVPSWNSYPGQL  211



>gb|ACN33948.1| unknown [Zea mays]
 gb|AFW84182.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=377

 Score =   185 bits (469),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 118/173 (68%), Gaps = 22/173 (13%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQL---------GSVSSAEGQKLTAGSSQVYGTS  152
            WQ PSNY+P++VP G+V VP + +Y GQL         GS    E      G    Y +S
Sbjct  185  WQSPSNYAPMVVPHGLVQVPSWNSYPGQLQSPGAQQTYGSSQQGEASAGNQGMLSPYRSS  244

Query  153  R------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
                   A++R+NVFPERP +PECQ+YMKTGDCKFG+VC+FHHPR R  PPPDC+LSP+G
Sbjct  245  SFPVPQYALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMG  304

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDH-----PMGVFAYSLSPSPSTDAPA  458
            LP+RPGE +C FYSRYGICKFG +CKFDH     PMGV+AY  S S S  APA
Sbjct  305  LPIRPGEELCKFYSRYGICKFGANCKFDHPTMAAPMGVYAYGFSGSASV-APA  356


 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PL P E  C +Y 
Sbjct  61   YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYL  120

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+  +CKF HP
Sbjct  121  KTGQCKYANTCKFHHP  136


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  147  TSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLR  326
             S A  +   +PERPG+P+C +Y++TG C+FG  CRF+HP +R +      +     P R
Sbjct  6    NSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK-GEYPER  64

Query  327  PGEPICIFYSRYGICKFGPSCKFDHP  404
             G+P C +Y + G CKFGP+CKF HP
Sbjct  65   VGQPECQYYLKTGTCKFGPTCKFHHP  90



>ref|NP_001150019.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
 gb|ACG37517.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 118/173 (68%), Gaps = 22/173 (13%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQL---------GSVSSAEGQKLTAGSSQVYGTS  152
            WQ PSNY+P++VP G+V VP + +Y GQL         GS    E      G    Y +S
Sbjct  235  WQSPSNYAPMVVPHGLVQVPSWNSYPGQLQSPGAQQTYGSSQQGEASAGNQGMLSPYRSS  294

Query  153  R------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
                   A++R+NVFPERP +PECQ+YMKTGDCKFG+VC+FHHPR R  PPPDC+LSP+G
Sbjct  295  SFPVPQYALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMG  354

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDH-----PMGVFAYSLSPSPSTDAPA  458
            LP+RPGE +C FYSRYGICKFG +CKFDH     PMGV+AY  S S S  APA
Sbjct  355  LPIRPGEELCKFYSRYGICKFGANCKFDHPTMAAPMGVYAYGFSGSASV-APA  406


 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PL P E  C +Y 
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYL  170

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+  +CKF HP
Sbjct  171  KTGQCKYANTCKFHHP  186


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   S A  +   +PERPG+P+C +Y++TG C+FG  CRF+HP +R +      +    
Sbjct  52   QMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK-GE  110

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFGP+CKF HP
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHP  140



>gb|ACF82040.1| unknown [Zea mays]
 gb|AFT82648.1| C3H49 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW84180.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 118/173 (68%), Gaps = 22/173 (13%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQL---------GSVSSAEGQKLTAGSSQVYGTS  152
            WQ PSNY+P++VP G+V VP + +Y GQL         GS    E      G    Y +S
Sbjct  235  WQSPSNYAPMVVPHGLVQVPSWNSYPGQLQSPGAQQTYGSSQQGEASAGNQGMLSPYRSS  294

Query  153  R------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
                   A++R+NVFPERP +PECQ+YMKTGDCKFG+VC+FHHPR R  PPPDC+LSP+G
Sbjct  295  SFPVPQYALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMG  354

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDH-----PMGVFAYSLSPSPSTDAPA  458
            LP+RPGE +C FYSRYGICKFG +CKFDH     PMGV+AY  S S S  APA
Sbjct  355  LPIRPGEELCKFYSRYGICKFGANCKFDHPTMAAPMGVYAYGFSGSASV-APA  406


 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+ +G PL P E  C +Y 
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYL  170

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+  +CKF HP
Sbjct  171  KTGQCKYANTCKFHHP  186


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   S A  +   +PERPG+P+C +Y++TG C+FG  CRF+HP +R +      +    
Sbjct  52   QMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK-GE  110

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFGP+CKF HP
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHP  140



>ref|NP_001132883.1| uncharacterized protein LOC100194377 [Zea mays]
 gb|ACF81912.1| unknown [Zea mays]
Length=430

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 110/153 (72%), Gaps = 16/153 (10%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQL---------GSVSSAEGQKLTAGSSQVYGTS  152
            WQ PSNY+P++VPQG+V +P + +Y+GQL         GS    E      G    Y +S
Sbjct  239  WQSPSNYAPMIVPQGLVQMPSWNSYTGQLQSPGAQQTYGSSQQGEASTGNQGMLSPYRSS  298

Query  153  R------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
                   A++RENVFPERP +PECQ+YMKTGDCKFG+VC+FHHPR R +PPPDC+LSP+G
Sbjct  299  SFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMG  358

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHPMGV  413
            LPLRPGE +C FYSRYGICKFG +CKFDHP  V
Sbjct  359  LPLRPGEELCKFYSRYGICKFGANCKFDHPTVV  391


 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+  G PLRP E  C +Y 
Sbjct  115  YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  174

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+  +CKF HP
Sbjct  175  KTGHCKYANTCKFHHP  190


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   S A  +   +PERPG+P+C +Y++TG C+FG  CRF+HP +R +      +    
Sbjct  56   QMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK-GE  114

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFGP+CKF HP
Sbjct  115  YPERAGQPECQYYLKTGTCKFGPTCKFHHP  144



>gb|ACF80171.1| unknown [Zea mays]
 tpg|DAA56153.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=320

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 110/162 (68%), Gaps = 34/162 (21%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQ PSNY+P++VPQG+V         Q+ S +S  GQ  + G+ Q YG+S+         
Sbjct  129  WQSPSNYAPMIVPQGLV---------QMQSWNSYTGQLQSPGAQQTYGSSQQGEASTGNQ  179

Query  156  ----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPP  287
                            A++RENVFPERP +PECQ+YMKTGDCKFG+VC+FHHPR R +PP
Sbjct  180  GMLSPYRPSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSLPP  239

Query  288  PDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGV  413
            PDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDHP  V
Sbjct  240  PDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCKFDHPTVV  281


 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+  G PLRP E  C +Y 
Sbjct  5    YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  64

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+  +CKF HP
Sbjct  65   KTGHCKYANTCKFHHP  80



>ref|XP_006400193.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
 gb|ESQ41646.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
Length=395

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 112/161 (70%), Gaps = 21/161 (13%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQG-MVSVPGYAYSGQLGSVSSAEG--------QKLTAGSS-------  134
            WQ PS+++ L++PQG +VS  G+   G L    S +          K T+GS        
Sbjct  179  WQDPSSFASLLLPQGGVVSAQGWNTYGSLSPSGSDQAYRNHQQSDAKETSGSRGGLFSSG  238

Query  135  QVYGTS-----RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCM  299
            +  G S      A+ RENVFPERPGQPEC+FYMKTGDCKFG+VC+FHHPR+R  P PDC+
Sbjct  239  EHSGNSVPFGYYALPRENVFPERPGQPECEFYMKTGDCKFGTVCKFHHPRDRQTPAPDCL  298

Query  300  LSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAY  422
            LSP+GLPLR GEP+C+FYSRYGICKFGPSCKFDHPM +F Y
Sbjct  299  LSPVGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMRIFTY  339


 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 56/84 (67%), Gaps = 4/84 (5%)
 Frame = +3

Query  156  AIER-ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPG  332
            A ER +  FPER GQPEC+FY+KTG CKFG  C+FHHPR +         S +G PLRP 
Sbjct  56   ATERIKGEFPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKA---GRVSHSVLGYPLRPN  112

Query  333  EPICIFYSRYGICKFGPSCKFDHP  404
            E  C ++ R G CKFG +CKF+HP
Sbjct  113  EDDCSYFLRTGHCKFGGTCKFNHP  136


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 56/95 (59%), Gaps = 9/95 (9%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C+FGS CRF+HP +R +      +     P R G+P C FY 
Sbjct  19   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATERIKG-EFPERIGQPECEFYL  77

Query  357  RYGICKFGPSCKFDHPMG--------VFAYSLSPS  437
            + G CKFG +CKF HP          V  Y L P+
Sbjct  78   KTGTCKFGVTCKFHHPRNKAGRVSHSVLGYPLRPN  112



>gb|KFK25872.1| hypothetical protein AALP_AA8G173100 [Arabis alpina]
Length=410

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 113/160 (71%), Gaps = 26/160 (16%)
 Frame = +3

Query  21   YSPLMVPQGM-VSVPGY-AYSGQLGSVS-SAEGQ-----------------------KLT  122
            ++ L++PQG  VSV G+ AY+GQLGS+S S   Q                       +  
Sbjct  195  FASLILPQGGGVSVQGWNAYNGQLGSLSPSGSDQNYRNQQQNDAKESSVSQGALFSSRFH  254

Query  123  AGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCML  302
            +G+S   G   ++ RE++FPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P PDC+L
Sbjct  255  SGNSVPLGYYASLAREDLFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPAPDCVL  314

Query  303  SPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAY  422
            SP+ LPLRPGEP+C+FYSRYGICKFGPSCKFDHPM VF Y
Sbjct  315  SPVDLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTY  354


 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 61/102 (60%), Gaps = 6/102 (6%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER  QP+CQFY+KTG CKFG  C+FHHPR          ++ +G PLRP E  C ++ 
Sbjct  77   YPERIDQPDCQFYLKTGTCKFGVTCKFHHPRNNADIAGSVSVNALGYPLRPEEDDCSYFL  136

Query  357  RYGICKFGPSCKFDHPMGV---FAYSLSPSP---STDAPAGQ  464
            R G CKFG +CKF+HP         SLS SP   +  +P GQ
Sbjct  137  RTGHCKFGGTCKFNHPQSQSSNLMVSLSGSPVYSALQSPTGQ  178


 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            S +   +  I    ++PERPG+P+C +Y++TG C+FGS CRF+HPR+R +      +   
Sbjct  17   SHLLNQNEIIGGVGLYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRKLVIATARIRG-  75

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
              P R  +P C FY + G CKFG +CKF HP
Sbjct  76   EYPERIDQPDCQFYLKTGTCKFGVTCKFHHP  106



>tpg|DAA56151.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=430

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 110/162 (68%), Gaps = 34/162 (21%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------  155
            WQ PSNY+P++VPQG+V         Q+ S +S  GQ  + G+ Q YG+S+         
Sbjct  239  WQSPSNYAPMIVPQGLV---------QMQSWNSYTGQLQSPGAQQTYGSSQQGEASTGNQ  289

Query  156  ----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPP  287
                            A++RENVFPERP +PECQ+YMKTGDCKFG+VC+FHHPR R +PP
Sbjct  290  GMLSPYRPSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSLPP  349

Query  288  PDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGV  413
            PDC+LSP+GLPLRPGE +C FYSRYGICKFG +CKFDHP  V
Sbjct  350  PDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCKFDHPTVV  391


 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG  C+FHHPRE+        L+  G PLRP E  C +Y 
Sbjct  115  YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  174

Query  357  RYGICKFGPSCKFDHP  404
            + G CK+  +CKF HP
Sbjct  175  KTGHCKYANTCKFHHP  190


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  135  QVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            Q+   S A  +   +PERPG+P+C +Y++TG C+FG  CRF+HP +R +      +    
Sbjct  56   QMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK-GE  114

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             P R G+P C +Y + G CKFGP+CKF HP
Sbjct  115  YPERAGQPECQYYLKTGTCKFGPTCKFHHP  144



>ref|NP_974790.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAM61197.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92307.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=354

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 3/100 (3%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  PPPDC+LS +GLPLRPGE
Sbjct  212  ALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGE  271

Query  336  PICIFYSRYGICKFGPSCKFDHPMGVFAY---SLSPSPST  446
            P+C+FYSRYGICKFGPSCKFDHPM VF Y   + SPSPS+
Sbjct  272  PLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNTASPSPSS  311


 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = +3

Query  111  QKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPP  290
            +KL   ++++ G          +PER GQPEC+FY+KTG CKFG  C+FHHPR +     
Sbjct  50   RKLVIATARIKGE---------YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDG  100

Query  291  DCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
               ++ +  PLRP E  C ++ R G CKFG +CKF+HP
Sbjct  101  SVSVNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHP  138


 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 12/109 (11%)
 Frame = +3

Query  144  GTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPL  323
            G+   +  +  +PER G+P+C +Y++TG C+FGS CRF+HP +R +      +     P 
Sbjct  7    GSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIKG-EYPE  65

Query  324  RPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
            R G+P C FY + G CKFG +CKF HP           + V +Y L P+
Sbjct  66   RIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPN  114



>ref|NP_851041.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 sp|Q8L7N8.2|C3H57_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 57; 
Short=AtC3H57; AltName: Full=Zinc finger type domain-containing 
protein ZFN3 [Arabidopsis thaliana]
 gb|AED92308.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=375

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 90/100 (90%), Gaps = 3/100 (3%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  PPPDC+LS +GLPLRPGE
Sbjct  233  ALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGE  292

Query  336  PICIFYSRYGICKFGPSCKFDHPMGVFAY---SLSPSPST  446
            P+C+FYSRYGICKFGPSCKFDHPM VF Y   + SPSPS+
Sbjct  293  PLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNTASPSPSS  332


 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = +3

Query  111  QKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPP  290
            +KL   ++++ G          +PER GQPEC+FY+KTG CKFG  C+FHHPR +     
Sbjct  71   RKLVIATARIKGE---------YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDG  121

Query  291  DCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
               ++ +  PLRP E  C ++ R G CKFG +CKF+HP
Sbjct  122  SVSVNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHP  159


 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 12/109 (11%)
 Frame = +3

Query  144  GTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPL  323
            G+   +  +  +PER G+P+C +Y++TG C+FGS CRF+HP +R +      +     P 
Sbjct  28   GSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIKG-EYPE  86

Query  324  RPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
            R G+P C FY + G CKFG +CKF HP           + V +Y L P+
Sbjct  87   RIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPN  135



>gb|ACN40302.1| unknown [Picea sitchensis]
Length=468

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 115/171 (67%), Gaps = 35/171 (20%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYAY--SGQLGSVSSAEGQKLTAGSSQVYGTSR-------  155
            WQGPS+Y+PL++PQG++ VP ++    GQ+GS+SS++GQ+   G+  VYG S        
Sbjct  229  WQGPSSYAPLILPQGIMPVPSWSTYPPGQVGSISSSDGQQQAMGAGLVYGPSSQTDPMAS  288

Query  156  --------------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRF  257
                                      + +RE++FPERPGQ ECQFYMKTGDCKFG  CR+
Sbjct  289  GIQGTLSHFPPGSPGMGPPTLQLPSSSAQRESMFPERPGQQECQFYMKTGDCKFGMTCRY  348

Query  258  HHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMG  410
            HHP+ER+IP P+C+L+ +GLPLRPG P C F++RYGICKFG +CKFDHPMG
Sbjct  349  HHPKERIIPVPNCVLNSLGLPLRPGAPACTFFTRYGICKFGATCKFDHPMG  399


 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A   +  +PER GQPECQ+Y+KTG CKFG+ C+FHHPR++       +++  G PLRP E
Sbjct  98   AARNKGEYPERLGQPECQYYLKTGSCKFGATCKFHHPRDKAGSTGRAVINVYGYPLRPNE  157

Query  336  PICIFYSRYGICKFGPSCKFDHPMGV  413
              C +Y R G CK+G +CKF HP  V
Sbjct  158  KECAYYMRTGQCKYGATCKFHHPQPV  183


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = +3

Query  147  TSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPR--ERLIPPP-DCMLSPIGL  317
            T RA+     +P RP + EC +YM+TG CK+G+ C+FHHP+    L+P     + +P+  
Sbjct  141  TGRAVINVYGYPLRPNEKECAYYMRTGQCKYGATCKFHHPQPVSTLVPVRGSSLFTPVHS  200

Query  318  PLRPG  332
            P  PG
Sbjct  201  PTTPG  205



>ref|XP_010492565.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
[Camelina sativa]
Length=418

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 110/167 (66%), Gaps = 33/167 (20%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQG-MVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIEREN-  173
            +Q PS+ + L++PQG +VSV G+  Y GQLGS+S +       GS Q Y   R  + E  
Sbjct  203  FQDPSSIASLVLPQGGVVSVQGWNGYGGQLGSLSPS-------GSDQNYRNQRQNDAEES  255

Query  174  -----------------------VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                                    FPERPGQ ECQFYMKTGDCKFG+VC+FHHPR+R  P
Sbjct  256  SGSQGGLFSSEFHSGSSVPLCLYAFPERPGQLECQFYMKTGDCKFGTVCKFHHPRDRQTP  315

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYS  425
             PDC+LS +GLPLR GEP+C+FYSRYGICKFGPSCKFDHPMGVF Y+
Sbjct  316  APDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYN  362


 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 57/89 (64%), Gaps = 6/89 (7%)
 Frame = +3

Query  138  VYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL  317
            V  T+RA   +  +PER GQPEC+FYMKTG CKFG  C+FHHPR       D  +S    
Sbjct  78   VIATARA---KGEYPERIGQPECEFYMKTGTCKFGVTCKFHHPRNN-AGTDDGRVSVY--  131

Query  318  PLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            PLRP E  C ++ R G CKFG +CKF+HP
Sbjct  132  PLRPNEDDCSYFLRTGHCKFGGTCKFNHP  160


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICI  347
            +  +PER G+P+C +Y++TG C+FGS CRF+HP +R +       +    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATAR-AKGEYPERIGQPECE  98

Query  348  FYSRYGICKFGPSCKFDHP  404
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>gb|KCW84570.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=345

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 102/136 (75%), Gaps = 27/136 (20%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTS---------  152
            WQGPS+Y+PL+VPQGMVS+PG+ AYSGQLGSVSS++ Q +  G SQ++G+S         
Sbjct  208  WQGPSSYTPLIVPQGMVSIPGWNAYSGQLGSVSSSDSQLIMMGQSQIFGSSGQSDSVNTG  267

Query  153  -----------------RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++R+N+FPERPGQPECQFYMKTGDCKFG+VCRFHHPRERL+
Sbjct  268  SPGAFSSYQSGSMPVGFYALQRDNIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLL  327

Query  282  PPPDCMLSPIGLPLRP  329
            P PDC+LSPIGLPLRP
Sbjct  328  PAPDCLLSPIGLPLRP  343


 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G P RP E  C +Y 
Sbjct  87   YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYL  146

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  147  RTGQCKFGSTCKFHHP  162


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 3/105 (3%)
 Frame = +3

Query  96   SSAEGQKLTAGSSQVYGTSRAIE--RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            S A+G  L+   +    T R+ E      +PERPG+P+C +Y++TG C+FG+ CRF+HP 
Sbjct  13   SVADGPSLSPSDAMWQMTLRSNETIESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPS  72

Query  270  ERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            +R +   +  +     P R G+P C +Y + G CKFG +CKF HP
Sbjct  73   DRKLAIANARMKG-EYPERVGQPECQYYLKTGTCKFGATCKFHHP  116


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +P RP + EC +Y++TG CKFGS C+FHHP+     P + M+S  G P+ P
Sbjct  133  YPFRPNEMECAYYLRTGQCKFGSTCKFHHPQ-----PTNMMVSLRGSPVYP  178



>ref|XP_002871723.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47982.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 3/100 (3%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  P PDC LS +GLPLR GE
Sbjct  202  ALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCALSSVGLPLRQGE  261

Query  336  PICIFYSRYGICKFGPSCKFDHPMGVFAYS---LSPSPST  446
            P+C+FYSRYGICKFGPSCKFDHPM VF Y+    SPSPS+
Sbjct  262  PLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNDASPSPSS  301


 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 61/99 (62%), Gaps = 9/99 (9%)
 Frame = +3

Query  111  QKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPP  290
            +KL   ++++ G          +PER GQPEC+FY+KTG CKFG  C+FHHPR +     
Sbjct  39   RKLVIATARIKGE---------YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGNDG  89

Query  291  DCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPM  407
               ++ +G PLRP E  C ++ R G CKFG +CKF+HP 
Sbjct  90   RVSVNVLGYPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQ  128


 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P+C +Y++TG C+FG  CRF+HP +R +      +     P R G+P C FY 
Sbjct  7    YPERHGEPDCAYYIRTGLCRFGFTCRFNHPHDRKLVIATARIKG-EYPERIGQPECEFYL  65

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  66   KTGTCKFGVTCKFHHP  81



>ref|XP_010453818.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 57-like [Camelina sativa]
Length=420

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 109/167 (65%), Gaps = 33/167 (20%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQG-MVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIEREN-  173
            +Q PS+ + L++PQG +VSV G+ +Y GQLGS+       L  GS Q Y   +  + E  
Sbjct  206  FQDPSSIASLVLPQGGVVSVQGWNSYGGQLGSL-------LPXGSDQNYRNQQQNDAEES  258

Query  174  -----------------------VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                                    FPERPGQ ECQFYMKTGDCKFG+VC+FHHPR+R  P
Sbjct  259  SGSQGGLFSSEFHSGSYVPLGLYAFPERPGQLECQFYMKTGDCKFGTVCKFHHPRDRQTP  318

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYS  425
             PDC+LS +GLPLR GEP+C+FYSRYGICKFGPSCKFDHPMGV  Y+
Sbjct  319  APDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMGVLTYN  365


 Score = 96.3 bits (238),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC+FYMKTG CKFG  C+FHHP  +        ++ +G PLRP E  C ++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPSNKAGIDGRVSINVLGYPLRPNEDDCSYFL  147

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  148  RTGHCKFGGTCKFNHP  163


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 6/97 (6%)
 Frame = +3

Query  114  KLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPD  293
            ++  GS ++   S     +  +PER G+P+C +Y++TG C+FGS CRF+HP +R +    
Sbjct  27   QMNMGSDEIMSGS-----DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIAT  81

Query  294  CMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             M +    P R G+P C FY + G CKFG +CKF HP
Sbjct  82   AM-TKGEYPERIGQPECEFYMKTGTCKFGVTCKFHHP  117



>ref|XP_006287837.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
 gb|EOA20735.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
Length=418

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 102/150 (68%), Gaps = 24/150 (16%)
 Frame = +3

Query  45   GMVSVPGY-AYSGQLGSVS------------SAEGQKLTAGSSQVYGT-----------S  152
            G+VSV G+ AY GQLGS+S              + ++ +     V+ +            
Sbjct  214  GLVSVQGWNAYGGQLGSLSPSGSDQDYRNQQQNDAEESSGSQGGVFSSGFHSGNSVPLGQ  273

Query  153  RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPG  332
             A+  ENVFPERPGQ EC+FYMKTGDCKFG+VC+FHHPR R  P PDC+LS +GLPLRPG
Sbjct  274  YALPSENVFPERPGQLECEFYMKTGDCKFGTVCKFHHPRNRQTPAPDCVLSTVGLPLRPG  333

Query  333  EPICIFYSRYGICKFGPSCKFDHPMGVFAY  422
            EP+C+FYSRYGICKFGPSCKFDHPM VF Y
Sbjct  334  EPLCVFYSRYGICKFGPSCKFDHPMRVFTY  363


 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC+FY+KTG CKFG  C+FHHPR +        ++ +G PLRP E  C ++ 
Sbjct  87   YPERIGQPECEFYIKTGTCKFGVTCKFHHPRNKAGIDERVSVNVLGYPLRPNEDDCSYFL  146

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG SCKF+HP
Sbjct  147  RTGHCKFGGSCKFNHP  162


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +3

Query  144  GTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPL  323
            G+   +  + ++PERPG+P+C +Y++TG C+FGS CRF+HP +R +       +    P 
Sbjct  31   GSDETMGGDGLYPERPGEPDCSYYIRTGLCRFGSTCRFNHPYDRKLVIATAR-TKGEYPE  89

Query  324  RPGEPICIFYSRYGICKFGPSCKFDHP  404
            R G+P C FY + G CKFG +CKF HP
Sbjct  90   RIGQPECEFYIKTGTCKFGVTCKFHHP  116



>gb|KJB75169.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=361

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 100/136 (74%), Gaps = 27/136 (20%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+PL++PQGMVSVP + AY GQL SVSS+E  + T G++Q+YGTSR        
Sbjct  216  WQGPSSYAPLILPQGMVSVPSWNAYGGQLASVSSSENLQQTNGNNQIYGTSRPNESASAG  275

Query  156  ------------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI  281
                              A++RENVFPERPG+ ECQFYMKTGDCKFG+VCRFHHPRER++
Sbjct  276  SQALFSQFRSGSAPVGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFHHPRERVL  335

Query  282  PPPDCMLSPIGLPLRP  329
            P PDC+LSPIGLPLRP
Sbjct  336  PAPDCILSPIGLPLRP  351


 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQPECQ+Y+KTG CKFG+ C+FHHPR++        L+ +G PLRP E  C +Y 
Sbjct  94   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYL  153

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  154  RTGQCKFGSTCKFHHP  169


 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query  126  GSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
            G+ Q+   S        +PERPG+P+C +Y++TG C+FG+ CRF+HP  R +      + 
Sbjct  32   GTWQINLRSSETMEPGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAITTARMK  91

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
                P R G+P C +Y + G CKFG +CKF HP
Sbjct  92   G-EFPERVGQPECQYYLKTGTCKFGATCKFHHP  123



>ref|NP_568332.2| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAD27875.1|AF138872_1 zinc finger protein 3 [Arabidopsis thaliana]
 dbj|BAB09623.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92306.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=368

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 83/100 (83%), Gaps = 10/100 (10%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A+ RENVFPERPGQPECQFYMKTGDCKFG+VC+FHHPR+R  PPPDC+LS        GE
Sbjct  233  ALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLS-------SGE  285

Query  336  PICIFYSRYGICKFGPSCKFDHPMGVFAY---SLSPSPST  446
            P+C+FYSRYGICKFGPSCKFDHPM VF Y   + SPSPS+
Sbjct  286  PLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNTASPSPSS  325


 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = +3

Query  111  QKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPP  290
            +KL   ++++ G          +PER GQPEC+FY+KTG CKFG  C+FHHPR +     
Sbjct  71   RKLVIATARIKGE---------YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDG  121

Query  291  DCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
               ++ +  PLRP E  C ++ R G CKFG +CKF+HP
Sbjct  122  SVSVNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHP  159


 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 12/109 (11%)
 Frame = +3

Query  144  GTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPL  323
            G+   +  +  +PER G+P+C +Y++TG C+FGS CRF+HP +R +      +     P 
Sbjct  28   GSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIKG-EYPE  86

Query  324  RPGEPICIFYSRYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
            R G+P C FY + G CKFG +CKF HP           + V +Y L P+
Sbjct  87   RIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPN  135



>ref|XP_010420349.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X1 [Camelina sativa]
Length=415

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 104/167 (62%), Gaps = 39/167 (23%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQG-MVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIEREN-  173
            +Q PS+ + L++PQG +VSV G+  + GQLGS+S +       GS Q Y   R  + E  
Sbjct  206  FQDPSSIASLVLPQGGVVSVQGWNGFGGQLGSLSPS-------GSDQNYRNQRQNDAEES  258

Query  174  -----------------------VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                                    FPERPGQ ECQFYMKTGDCKF      HHPR+R  P
Sbjct  259  SGSQGGVFSSGFHSGSSVPLGLYAFPERPGQLECQFYMKTGDCKF------HHPRDRQTP  312

Query  285  PPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYS  425
             PDC+LS +GLPLR GEP+C+FYSRYGICKFGPSCKFDHPMGVF Y+
Sbjct  313  APDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYN  359


 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC+FYMKTG CKFG  C+FHHPR  +       +  +G PLRP E  C ++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFL  147

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  148  RTGHCKFGGTCKFNHP  163


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICI  347
            +  +PER G+P+C +Y++TG C+FGS CRF+HP +R +       +    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATAR-TKGEYPERIGQPECE  98

Query  348  FYSRYGICKFGPSCKFDHP  404
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>ref|XP_001768387.1| predicted protein [Physcomitrella patens]
 gb|EDQ66749.1| predicted protein, partial [Physcomitrella patens]
Length=332

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 103/159 (65%), Gaps = 25/159 (16%)
 Frame = +3

Query  6    QGPSNYSPLM-VPQGMVSVPGYAYSGQLGSVSSAEGQK-------------------LTA  125
            Q PS+Y  +M + QG++S+ G+ Y    G V  AEG +                      
Sbjct  174  QAPSSYGTMMPLQQGIMSMAGWNYQVSQGPVGPAEGHQQGYVFGGAPQGEHVSGYGPYMQ  233

Query  126  GSSQV----YGTSRAIE-RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPP  290
            GSS V    +  ++A+  +E VFPERPGQPECQ+YMKTGDCKFGS CR+HHP++R  P P
Sbjct  234  GSSAVGLPAHQATQAVGGQETVFPERPGQPECQYYMKTGDCKFGSTCRYHHPKDRATPSP  293

Query  291  DCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPM  407
             C LSP+GLPLRPG P C FYSRYGICKFGP+CKFDHP+
Sbjct  294  TCHLSPMGLPLRPGNPPCSFYSRYGICKFGPTCKFDHPL  332


 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 60/98 (61%), Gaps = 0/98 (0%)
 Frame = +3

Query  147  TSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLR  326
             + A   +  +PER G PECQ+Y+KTG CKFG+ C++HHPRE+        L+ +GLPLR
Sbjct  56   AAAATRGKGEYPERVGHPECQYYLKTGTCKFGATCKYHHPREKAGSTGRVHLNVLGLPLR  115

Query  327  PGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSP  440
             GE  C +Y R G CK+G +CKF HP       + P P
Sbjct  116  LGEKECAYYMRTGSCKYGVTCKFHHPQPATVGGMVPLP  153



>ref|XP_002276435.1| PREDICTED: zinc finger CCCH domain-containing protein 34 isoform 
X1 [Vitis vinifera]
 emb|CBI26091.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 106/172 (62%), Gaps = 23/172 (13%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTS----------------  152
            YSP+++P GMV  PG+++     S  ++   + T GS Q+YG +                
Sbjct  225  YSPVLIPPGMVPFPGWSHYPAPVSPVASPSTQPTVGSGQMYGLTPLSPSAPAYTGPYTPL  284

Query  153  -------RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
                    + ++E +FPERPGQPECQ+YM+TGDCKFGS C++HHP E   P  +C+LSP+
Sbjct  285  PSSVGPSSSSQKEQIFPERPGQPECQYYMRTGDCKFGSSCKYHHPPEWDTPKTNCVLSPM  344

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            GLPLRPG P C  Y++ GICKFGP+CKFDHPMG  +YS S S   D P   +
Sbjct  345  GLPLRPGAPQCTHYAQRGICKFGPTCKFDHPMGTLSYSPSASSLADMPVAPY  396


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQP CQFYMKTG CKFG+ C++HHPR+         L+  G PLRPGE  C +Y 
Sbjct  92   FPERVGQPVCQFYMKTGTCKFGASCKYHHPRQGGGTVSPVTLNYFGYPLRPGEKECSYYV  151

Query  357  RYGICKFGPSCKFDHP  404
            + G+CKFG +CKF HP
Sbjct  152  KTGLCKFGETCKFHHP  167


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  171  NVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIF  350
              +PERP + +C +Y+KTG C +G+ CRF+HPR+R              P R G+P+C F
Sbjct  44   EAYPERPDEADCIYYLKTGFCGYGARCRFNHPRDRGGVGGTVRPGGGEFPERVGQPVCQF  103

Query  351  YSRYGICKFGPSCKFDHP  404
            Y + G CKFG SCK+ HP
Sbjct  104  YMKTGTCKFGASCKYHHP  121



>emb|CAN78551.1| hypothetical protein VITISV_003243 [Vitis vinifera]
Length=518

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 106/172 (62%), Gaps = 23/172 (13%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTS----------------  152
            YSP+++P GMV  PG+++     S  ++   + T GS Q+YG +                
Sbjct  265  YSPVLIPPGMVPFPGWSHYPAPVSPVASPSTQPTVGSGQMYGLTPLSPSAPAYTGPYTPL  324

Query  153  -------RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
                    + ++E +FPERPGQPECQ+YM+TGDCKFGS C++HHP E   P  +C+LSP+
Sbjct  325  PSSVGPSSSSQKEQIFPERPGQPECQYYMRTGDCKFGSSCKYHHPPEWDTPKTNCVLSPM  384

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            GLPLRPG P C  Y++ GICKFGP+CKFDHPMG  +YS S S   D P   +
Sbjct  385  GLPLRPGAPQCTHYAQRGICKFGPTCKFDHPMGTLSYSPSASSLADMPVAPY  436


 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQP CQFYMKTG CKFG+ C++HHPR+         L+  G PLRPGE  C +Y 
Sbjct  132  FPERVGQPVCQFYMKTGTCKFGASCKYHHPRQGGGTVSPVTLNYFGYPLRPGEKECSYYV  191

Query  357  RYGICKFGPSCKFDHP  404
            + G+CKFG +CKF HP
Sbjct  192  KTGLCKFGETCKFHHP  207


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +3

Query  171  NVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIF  350
              +PERP + +C +Y+KTG C +G+ CRF+HPR+R              P R G+P+C F
Sbjct  84   EAYPERPDEADCIYYLKTGFCGYGARCRFNHPRDRGGVGGTVRPGGGEFPERVGQPVCQF  143

Query  351  YSRYGICKFGPSCKFDHP  404
            Y + G CKFG SCK+ HP
Sbjct  144  YMKTGTCKFGASCKYHHP  161



>ref|XP_010420350.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X2 [Camelina sativa]
Length=413

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 102/166 (61%), Gaps = 39/166 (23%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQG-MVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIEREN--  173
            +Q PS+ + L++PQG +VSV G+   G LGS+S +       GS Q Y   R  + E   
Sbjct  206  FQDPSSIASLVLPQGGVVSVQGWNGFG-LGSLSPS-------GSDQNYRNQRQNDAEESS  257

Query  174  ----------------------VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPP  287
                                   FPERPGQ ECQFYMKTGDCKF      HHPR+R  P 
Sbjct  258  GSQGGVFSSGFHSGSSVPLGLYAFPERPGQLECQFYMKTGDCKF------HHPRDRQTPA  311

Query  288  PDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYS  425
            PDC+LS +GLPLR GEP+C+FYSRYGICKFGPSCKFDHPMGVF Y+
Sbjct  312  PDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYN  357


 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPEC+FYMKTG CKFG  C+FHHPR  +       +  +G PLRP E  C ++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFL  147

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF+HP
Sbjct  148  RTGHCKFGGTCKFNHP  163


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICI  347
            +  +PER G+P+C +Y++TG C+FGS CRF+HP +R +       +    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATAR-TKGEYPERIGQPECE  98

Query  348  FYSRYGICKFGPSCKFDHP  404
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>ref|NP_001078077.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 gb|AEC10898.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
Length=442

 Score =   152 bits (384),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 104/169 (62%), Gaps = 20/169 (12%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P+++  G+V +PG++      S + + G +   G++ +YG ++               
Sbjct  188  YGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQHAVGATSLYGVTQLTSTTPSLPGVYPSL  247

Query  156  -----AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLP  320
                  I++E  FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P  +C+LSPIGLP
Sbjct  248  SSPTGVIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLP  307

Query  321  LRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            LRPG   C FY + G CKFG +CKFDHPMG   Y+ S S   DAP   +
Sbjct  308  LRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVAPY  356


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 65/118 (55%), Gaps = 8/118 (7%)
 Frame = +3

Query  66   YAYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIER----ENVFPERPGQPECQFYMKTGDC  233
            YA +  L    SA+    T   +   G   ++ R     + +PERPG P+C +YM+TG C
Sbjct  2    YARNPPLNGSQSAQAPDWTPADADT-GLQESMWRLGLGSDSYPERPGAPDCAYYMRTGVC  60

Query  234  KFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             +G+ CR++HPR+R     +  +   G  P R GEP C FY + G CKFG SCKF HP
Sbjct  61   GYGNRCRYNHPRDRAS--VEATVRATGQYPERFGEPPCQFYLKTGTCKFGASCKFHHP  116


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRE  272
            + V  T RA  +   +PER G+P CQFY+KTG CKFG+ C+FHHP+ 
Sbjct  75   ASVEATVRATGQ---YPERFGEPPCQFYLKTGTCKFGASCKFHHPKN  118



>ref|XP_002880326.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56585.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 104/169 (62%), Gaps = 20/169 (12%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P+++  G+V +PG++      S + + G +   G++ +YG ++               
Sbjct  217  YGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQHAVGATSLYGVTQLSSTTPSLPGVYPSL  276

Query  156  -----AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLP  320
                  I++E  FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P  +C+LSPIGLP
Sbjct  277  SSPTGVIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLP  336

Query  321  LRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            LRPG   C FY + G CKFG +CKFDHPMG   Y+ S S   DAP   +
Sbjct  337  LRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVAPY  385


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A+     +PER G+P CQFY+KTG CKFG+ C+FHHP+          L+  G P+R G+
Sbjct  82   AVRATGQYPERLGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMTHVPLNIYGYPVREGD  141

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y + G CKFG +CKF HP
Sbjct  142  NECSYYLKTGQCKFGITCKFHHP  164


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 63/111 (57%), Gaps = 7/111 (6%)
 Frame = +3

Query  87   GSVSSAEGQKLTAGSSQVYGTSRAIERENV----FPERPGQPECQFYMKTGDCKFGSVCR  254
            GS S+      T G +   G   ++ R  +    +PERPG P+C +YM+TG C +G+ CR
Sbjct  10   GSQSAQAPDWTTPGDADTTGLEESMWRLGLGCESYPERPGAPDCAYYMRTGVCGYGNRCR  69

Query  255  FHHPRERLIPPPDCMLSPIG-LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            ++HPR+R     +  +   G  P R GEP C FY + G CKFG SCKF HP
Sbjct  70   YNHPRDRA--SVEAAVRATGQYPERLGEPPCQFYLKTGTCKFGASCKFHHP  118



>ref|NP_182306.2| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 ref|NP_001078078.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 sp|Q84W91.2|C3H32_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 32; 
Short=AtC3H32; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 1 [Arabidopsis thaliana]
 gb|ABO45694.1| At2g47850 [Arabidopsis thaliana]
 gb|AEC10897.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 gb|AEC10899.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
Length=468

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 104/169 (62%), Gaps = 20/169 (12%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P+++  G+V +PG++      S + + G +   G++ +YG ++               
Sbjct  214  YGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQHAVGATSLYGVTQLTSTTPSLPGVYPSL  273

Query  156  -----AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLP  320
                  I++E  FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P  +C+LSPIGLP
Sbjct  274  SSPTGVIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLP  333

Query  321  LRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            LRPG   C FY + G CKFG +CKFDHPMG   Y+ S S   DAP   +
Sbjct  334  LRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVAPY  382


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            + V  T RA  +   +PER G+P CQFY+KTG CKFG+ C+FHHP+          L+  
Sbjct  75   ASVEATVRATGQ---YPERFGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIY  131

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            G P+R G+  C +Y + G CKFG +CKF HP
Sbjct  132  GYPVREGDNECSYYLKTGQCKFGITCKFHHP  162


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 65/118 (55%), Gaps = 8/118 (7%)
 Frame = +3

Query  66   YAYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIER----ENVFPERPGQPECQFYMKTGDC  233
            YA +  L    SA+    T   +   G   ++ R     + +PERPG P+C +YM+TG C
Sbjct  2    YARNPPLNGSQSAQAPDWTPADADT-GLQESMWRLGLGSDSYPERPGAPDCAYYMRTGVC  60

Query  234  KFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             +G+ CR++HPR+R     +  +   G  P R GEP C FY + G CKFG SCKF HP
Sbjct  61   GYGNRCRYNHPRDRAS--VEATVRATGQYPERFGEPPCQFYLKTGTCKFGASCKFHHP  116



>ref|XP_006294140.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
 gb|EOA27038.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
Length=445

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 104/169 (62%), Gaps = 20/169 (12%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P+++  G+V +PG++      S + + G +   G++ +YG ++               
Sbjct  190  YGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQHAVGATSLYGVTQLSSTTPSLPGVYPSL  249

Query  156  -----AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLP  320
                  I++E  FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P  +C+LSPIGLP
Sbjct  250  SSPTGVIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLP  309

Query  321  LRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            LRPG   C FY + G CKFG +CKFDHPMG   Y+ S S   DAP   +
Sbjct  310  LRPGVQRCTFYVQNGFCKFGSTCKFDHPMGNIRYNPSASSLADAPVAPY  358


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPIC  344
               +PERPG P+C +YM+TG C +G+ CR++HPR+R     +  +   G  P R GEP C
Sbjct  41   SETYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRAS--VEATVRATGQYPERIGEPPC  98

Query  345  IFYSRYGICKFGPSCKFDHP  404
             FY + G CKFG SCKF HP
Sbjct  99   QFYLKTGTCKFGASCKFHHP  118


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRE  272
            + V  T RA  +   +PER G+P CQFY+KTG CKFG+ C+FHHP+ 
Sbjct  77   ASVEATVRATGQ---YPERIGEPPCQFYLKTGTCKFGASCKFHHPKN  120



>ref|XP_006419655.1| hypothetical protein CICLE_v10004882mg [Citrus clementina]
 ref|XP_006489144.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Citrus sinensis]
 gb|ESR32895.1| hypothetical protein CICLE_v10004882mg [Citrus clementina]
Length=476

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 108/179 (60%), Gaps = 27/179 (15%)
 Frame = +3

Query  6    QGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSS-AEGQKLTAGSSQVYGTSR--------  155
            QGP  Y P++V   M S+ G++ Y+  L  +SS   G + + GSS +YG ++        
Sbjct  218  QGP--YGPVLVSPSMFSLQGWSPYATSLNPISSPGTGTQSSVGSSSIYGITQLSASAPAY  275

Query  156  ---------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPP  290
                           + ++E+ FPERPGQ ECQ+YMKTGDCKFGS CRFHHPRE ++P  
Sbjct  276  TGTYQSLPSSVGPSSSSQKEHPFPERPGQQECQYYMKTGDCKFGSSCRFHHPRELIVPKM  335

Query  291  DCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            D  LSP GLPLRPG   C  Y + G+CKFGP+CKFDHPMG+ +YS S S   D P   +
Sbjct  336  DVTLSPFGLPLRPGAAPCTHYVQRGVCKFGPACKFDHPMGMLSYSPSASSLADMPVAPY  394


 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +3

Query  138  VYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL  317
            V G +RA   E  FPER GQP CQ+YM+TG CK+G+ C++HHPR+      +  L+  G 
Sbjct  73   VMGAARAGGGE--FPERVGQPVCQYYMRTGTCKYGASCKYHHPRQGAGSVSNVSLNYYGY  130

Query  318  PLRPGEPICIFYSRYGICKFGPSCKFDHPM--GVFAYSLSPSPSTDA  452
            PLRPGE  C +Y +   CKFG +CKF HP   GV A + SP+P   A
Sbjct  131  PLRPGEKECSYYMKTRQCKFGATCKFHHPQPAGVPAPTPSPAPQVAA  177


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERP + +C  Y++TG C +GS CRF+HPR+R              P R G+P+C +Y 
Sbjct  38   YPERPDEADCIHYVRTGFCAYGSRCRFNHPRDRGSVMGAARAGGGEFPERVGQPVCQYYM  97

Query  357  RYGICKFGPSCKFDHP  404
            R G CK+G SCK+ HP
Sbjct  98   RTGTCKYGASCKYHHP  113



>gb|EYU22370.1| hypothetical protein MIMGU_mgv1a005385mg [Erythranthe guttata]
Length=485

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 105/174 (60%), Gaps = 22/174 (13%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGT--------------  149
            P NY P+++P G+V VPG+       S  ++   +   G +Q+YG               
Sbjct  230  PGNYGPMLLPPGVVHVPGWTPYQTPASPLASSSNQPPVGGAQIYGITQLSSSATAYAGPY  289

Query  150  --------SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
                    S + ++E+ FPERPGQPECQ+Y++TGDCKFG+ C++HHP E  +P  + +LS
Sbjct  290  MPITSAGQSSSSQKEHAFPERPGQPECQYYLRTGDCKFGATCKYHHPSEWSVPRGNFVLS  349

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
             +GLPLRPG P+C  Y++ G+CKFGPSCKFDHPM   +YS S S  TD P   +
Sbjct  350  AMGLPLRPGAPLCSHYAQNGMCKFGPSCKFDHPMKTLSYSPSASSLTDMPVAPY  403


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            S V G  RA   E  +PER GQP CQ+YM+TG CKFG+ C++ HP+  L       L+  
Sbjct  79   SMVMGALRAGGGE--YPERVGQPICQYYMRTGMCKFGTSCKYDHPKHGLGSSAPAGLNFY  136

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            G PLRPGE  C +Y++ G CKFG +CK+ HP
Sbjct  137  GYPLRPGEKECSYYAKTGQCKFGVTCKYHHP  167


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERP +P+  +Y++ G C++G+ CRF+HPR R +            P R G+PIC +Y 
Sbjct  46   YPERPDEPDRMYYLRIGFCRYGNRCRFNHPRVRSMVMGALRAGGGEYPERVGQPICQYYM  105

Query  357  RYGICKFGPSCKFDHP  404
            R G+CKFG SCK+DHP
Sbjct  106  RTGMCKFGTSCKYDHP  121



>ref|XP_006294141.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
 gb|EOA27039.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
Length=471

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 104/169 (62%), Gaps = 20/169 (12%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P+++  G+V +PG++      S + + G +   G++ +YG ++               
Sbjct  216  YGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQHAVGATSLYGVTQLSSTTPSLPGVYPSL  275

Query  156  -----AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLP  320
                  I++E  FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P  +C+LSPIGLP
Sbjct  276  SSPTGVIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLP  335

Query  321  LRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            LRPG   C FY + G CKFG +CKFDHPMG   Y+ S S   DAP   +
Sbjct  336  LRPGVQRCTFYVQNGFCKFGSTCKFDHPMGNIRYNPSASSLADAPVAPY  384


 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            + V  T RA  +   +PER G+P CQFY+KTG CKFG+ C+FHHP+          L+  
Sbjct  77   ASVEATVRATGQ---YPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIY  133

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            G P+R GE  C +Y + G CKFG +CKF HP
Sbjct  134  GYPVREGENECSYYLKTGQCKFGITCKFHHP  164


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 3/79 (4%)
 Frame = +3

Query  171  NVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPICI  347
              +PERPG P+C +YM+TG C +G+ CR++HPR+R     +  +   G  P R GEP C 
Sbjct  42   ETYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRAS--VEATVRATGQYPERIGEPPCQ  99

Query  348  FYSRYGICKFGPSCKFDHP  404
            FY + G CKFG SCKF HP
Sbjct  100  FYLKTGTCKFGASCKFHHP  118



>ref|XP_010938478.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
[Elaeis guineensis]
Length=463

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 110/177 (62%), Gaps = 26/177 (15%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSRAI---------  161
            P +Y P+++  G+V V G+  Y   L SV S  GQ+ T  +  +YG S  +         
Sbjct  206  PGSYGPMLLSPGVVPVQGWGPYPAPLSSVVSPGGQQ-TVQTGPLYGPSNQVNTSVPAYQV  264

Query  162  ---------------ERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                           ERE +FPERPGQPECQFYM+TGDCK+G  C++HHPR+  IP  +C
Sbjct  265  PYTSFSSSAGPSSSSEREQMFPERPGQPECQFYMRTGDCKYGVTCKYHHPRDWSIPKTNC  324

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            +LSP+GLPLRPG  IC FY+++G+CKFGP+CKFDHP+G  +YS S S  +D P   +
Sbjct  325  VLSPLGLPLRPGAQICAFYAQHGVCKFGPTCKFDHPVGTLSYSPSASSLSDMPVAPY  381


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PE  GQP C++YMKTG CKFGS C++HHPR+        +L+  G PLRPGE  C +Y 
Sbjct  83   YPEHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYCGYPLRPGEKECSYYM  142

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  143  KTGQCKFGSTCKFHHP  158


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +Y++TG C +G  CR++HP +R           +  P   G+P+C +Y 
Sbjct  37   YPERPGEPDCAYYIRTGSCGYGERCRYNHPPDRGALARSGRTGVVEYPEHVGQPVCEYYM  96

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CK+ HP
Sbjct  97   KTGTCKFGSTCKYHHP  112


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            +P RPG+ EC +YMKTG CKFGS C+FHHP+
Sbjct  129  YPLRPGEKECSYYMKTGQCKFGSTCKFHHPQ  159



>ref|XP_007200997.1| hypothetical protein PRUPE_ppa005229mg [Prunus persica]
 gb|EMJ02196.1| hypothetical protein PRUPE_ppa005229mg [Prunus persica]
Length=471

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 24/169 (14%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR------AIER-----  167
            Y P+++P G+V + G++YS  L  V S  G + T G++ +YG ++       + R     
Sbjct  214  YGPVLIPPGVVPIQGWSYSAPLSPVLSP-GAQPTVGATSLYGVTQLSSPTHGLARPYTSV  272

Query  168  ------------ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
                        E VFPERPG+PECQ+Y+KTGDCK+G  CR+HHPR+R+IP  +C+LSPI
Sbjct  273  PSAVGPSSSSPSEQVFPERPGEPECQYYLKTGDCKYGPSCRYHHPRDRVIPRTNCLLSPI  332

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
            GLPLRPG   C FY + G CKFG +CKFDHP+G   Y+ S S   D P 
Sbjct  333  GLPLRPGVQPCTFYLQNGHCKFGSTCKFDHPIGTMRYNPSASSLVDMPV  381


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P CQ+Y+KTG CKFG+ C+FHHP+          L+  GLPLRPGE  C +Y 
Sbjct  86   YPERVGEPICQYYLKTGTCKFGASCKFHHPKHGGGSLSRAPLNIYGLPLRPGENECSYYL  145

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  146  KTGQCKFGITCKFHHP  161


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
             +     +PERPG P C +YM+TG C +G  CR++HPR+R         +    P R GE
Sbjct  34   GLTSSESYPERPGVPNCVYYMRTGFCGYGIRCRYNHPRDRAAVVAAVRAT-GDYPERVGE  92

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            PIC +Y + G CKFG SCKF HP
Sbjct  93   PICQYYLKTGTCKFGASCKFHHP  115



>ref|XP_006855486.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
 gb|ERN16953.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
Length=458

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 110/174 (63%), Gaps = 23/174 (13%)
 Frame = +3

Query  6    QGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIE------  164
            QGP  YSP+++  G+V +PG+ AY   +  V+S   Q+   G+  +YG S          
Sbjct  216  QGP--YSPVILHPGVVPLPGWSAYPPPVTPVASPGAQQ-PVGTGSLYGLSPTATPYPGFF  272

Query  165  -------------RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
                         +EN FPERPGQPECQFYM+TGDCK+GS CR+HHP +R++P  +C LS
Sbjct  273  SPVSSSVAGPSGTKENTFPERPGQPECQFYMRTGDCKYGSTCRYHHPPDRIVPQTNCTLS  332

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            PIG PLRPG P C FY+++G+CKFGP+CKFDHP+G  +YS S S   D P   +
Sbjct  333  PIGFPLRPGAPTCSFYAQHGVCKFGPTCKFDHPLGSLSYSPSASSLADMPVAPY  386


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 10/84 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL-----PLRPGEPI  341
            +PER GQP CQ+++KTG CKFG+ C++HHPR         ++SP+GL     PLRPG+  
Sbjct  90   YPERVGQPTCQYFIKTGTCKFGATCKYHHPRYG-----GGLMSPVGLNILGYPLRPGDKE  144

Query  342  CIFYSRYGICKFGPSCKFDHPMGV  413
            C +Y + G CKFGP+CKF HP  V
Sbjct  145  CSYYVKTGQCKFGPTCKFHHPQPV  168


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 2/77 (3%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPICIFY  353
            +PERPG+ +C FYMKTG C++G+ CR++HP +R  P  D + +  G  P R G+P C ++
Sbjct  44   YPERPGEADCMFYMKTGFCRYGANCRYNHPHDR-NPAADVLQTGGGEYPERVGQPTCQYF  102

Query  354  SRYGICKFGPSCKFDHP  404
             + G CKFG +CK+ HP
Sbjct  103  IKTGTCKFGATCKYHHP  119



>ref|XP_010652064.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Vitis 
vinifera]
 emb|CBI32253.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 108/177 (61%), Gaps = 26/177 (15%)
 Frame = +3

Query  6    QGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGT-----------  149
            QGP  Y P++ P G+V +PG++ YS  +  V S  G + T G+  VYG            
Sbjct  215  QGP--YGPVLFPPGVVPIPGWSPYSTPVSPVLSP-GAQPTVGAGSVYGVTQLPSTHTLAG  271

Query  150  -----------SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                       S + ++E VFPERPGQ ECQ+Y++TGDCKFGS CR+HHPRE ++P  +C
Sbjct  272  PYASLPSSAGPSSSNQKEQVFPERPGQQECQYYLRTGDCKFGSSCRYHHPREWVVPKTNC  331

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            +LSP+GLPLRPG   C FY + G CKFG +CKFDHP+G   YS S S  TD P   +
Sbjct  332  VLSPLGLPLRPGVQPCTFYLQNGYCKFGSTCKFDHPLGNMRYSPSASSLTDMPVAPY  388


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P CQFY+KTG CKFG+ CRFHHPR          L+  G PLR GE  C +Y 
Sbjct  90   YPERIGEPACQFYLKTGTCKFGASCRFHHPRNGGGSMSHVSLNIYGYPLRLGEKECSYYL  149

Query  357  RYGICKFGPSCKFDHPM  407
            + G CKFG +CKF HP 
Sbjct  150  KTGQCKFGITCKFHHPQ  166


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 51/84 (61%), Gaps = 3/84 (4%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPG  332
             +     +PERPG  +C +YMKTG C FGS CR++HPR+R       + S  G  P R G
Sbjct  38   GLSSRESYPERPGVADCVYYMKTGFCGFGSRCRYNHPRDRSS--VSTLRSGGGEYPERIG  95

Query  333  EPICIFYSRYGICKFGPSCKFDHP  404
            EP C FY + G CKFG SC+F HP
Sbjct  96   EPACQFYLKTGTCKFGASCRFHHP  119



>ref|XP_006397979.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
 gb|ESQ39432.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
Length=525

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 104/170 (61%), Gaps = 21/170 (12%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P+++  G+V +PG++      S + + G +   G++ +YG ++               
Sbjct  269  YGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQHAVGATSLYGVTQLSSTTASLPPGVYPS  328

Query  156  ------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL  317
                   +++E  FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P  +C+LSPIGL
Sbjct  329  LSSPTGILQKEQTFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRIPPRANCVLSPIGL  388

Query  318  PLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            PLRPG   C FY + G CKFG +CKFDHPMG   Y+ S S   DAP   +
Sbjct  389  PLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVAPY  438


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A+     +PER G+P CQFY+KTG CKFG+ C+FHHP+          L+  G P+R GE
Sbjct  135  AVRATGQYPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGE  194

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y + G CKFG +CKF HP
Sbjct  195  KDCSYYLKTGQCKFGITCKFHHP  217


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 3/79 (4%)
 Frame = +3

Query  171  NVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPICI  347
              +PERPG P+C +YM+TG C +G+ CR++HPR+R     +  +   G  P R GEP C 
Sbjct  95   ETYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRAT--VEAAVRATGQYPERIGEPPCQ  152

Query  348  FYSRYGICKFGPSCKFDHP  404
            FY + G CKFG SCKF HP
Sbjct  153  FYLKTGTCKFGASCKFHHP  171



>ref|XP_008796232.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X2 [Phoenix dactylifera]
Length=409

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 110/177 (62%), Gaps = 26/177 (15%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSRAI---------  161
            P +Y P+++  G+V V G+  Y   +  V S  GQ+ T  +  +YG S  +         
Sbjct  152  PGSYGPMLLSPGVVPVQGWGPYPAPISPVVSPGGQQ-TVQTGPLYGLSDQVTTSVPAYQV  210

Query  162  ---------------ERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                           ERE +FPERPGQPECQFYM+TGDCKFG+ C++HHPR+  IP  +C
Sbjct  211  PYTSASSLARPSSSSEREQMFPERPGQPECQFYMRTGDCKFGATCKYHHPRDWSIPKTNC  270

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            +LSP+GLPLRPG  IC +Y+++G+CKFGP+CKFDHP+G  +YS S S  +D P   +
Sbjct  271  VLSPLGLPLRPGAQICSYYAQHGVCKFGPTCKFDHPVGTLSYSPSASSLSDMPVAPY  327


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P+  GQP C++YMKTG CKFGS C++HHPR+        +L+  G PLRPGE  C +Y 
Sbjct  28   YPQHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYYGYPLRPGEKECSYYM  87

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  88   KTGQCKFGLTCKFHHP  103



>ref|XP_010921758.1| PREDICTED: zinc finger CCCH domain-containing protein 6 [Elaeis 
guineensis]
Length=466

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 124/215 (58%), Gaps = 30/215 (14%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSRAI---------  161
            P +Y P+++  G+V V G+  Y   +  V S  GQ+ T  +  +YG S  +         
Sbjct  209  PGSYGPMLLSPGVVPVQGWGPYPAPVSPVVSPGGQQ-TVQAGHLYGLSSQVTASVPSYQG  267

Query  162  ---------------ERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                           +RE+ FPERPGQPECQFYM+TGDCKFGS CR+HHPR+  +P  +C
Sbjct  268  PYTPVSSSAGPSSGSQREHTFPERPGQPECQFYMRTGDCKFGSTCRYHHPRDWSMPKTNC  327

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG----Q  464
             LSP+GLPLRPG   C +Y+++G+CKFGP+CKFDHPMG  +YS S S  +D P       
Sbjct  328  ALSPLGLPLRPGAQPCAYYAQHGVCKFGPTCKFDHPMGTLSYSPSASSLSDMPVAPYPIG  387

Query  465  FllgsssgtgaltlsseglVDAGSTNPRRLPSGDN  569
            F + + + + + +      + +  + P R+PS +N
Sbjct  388  FSVATLAPSSSSSDLRPEFISSKESFPTRMPSSEN  422


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQP C++YM+TG CKFGS C++HHPR+        +L+  G PLRPGE  C +Y 
Sbjct  85   YPERVGQPVCEYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLLNYSGYPLRPGEKECSYYM  144

Query  357  RYGICKFGPSCKFDHPMGVFAYSLSPSPS  443
            + G CKFG +CKF HP    A   SP+P+
Sbjct  145  KTGQCKFGSTCKFHHPQPGGASVPSPAPT  173


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICI  347
            ++ +PERPG+P+C +YM+TG C +G  CR++HPR+R         +    P R G+P+C 
Sbjct  36   DSPYPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGAGRTAAGEYPERVGQPVCE  95

Query  348  FYSRYGICKFGPSCKFDHP  404
            +Y R G CKFG +CK+ HP
Sbjct  96   YYMRTGTCKFGSTCKYHHP  114



>emb|CAN74119.1| hypothetical protein VITISV_002050 [Vitis vinifera]
Length=1388

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 107/175 (61%), Gaps = 26/175 (15%)
 Frame = +3

Query  6    QGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGT-----------  149
            QGP  Y P++ P G+V +PG++ YS  +  V S  G + T G+  VYG            
Sbjct  253  QGP--YGPVLFPPGVVPIPGWSPYSTPVSPVLSP-GAQPTVGAGSVYGVTQLPSTHTLAG  309

Query  150  -----------SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                       S + ++E VFPERPGQ ECQ+Y++TGDCKFGS CR+HHPRE ++P  +C
Sbjct  310  PYASLPSSAGPSSSNQKEQVFPERPGQQECQYYLRTGDCKFGSSCRYHHPREWVVPKTNC  369

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAG  461
            +LSP+GLPLRPG   C FY + G CKFG +CKFDHP+G   YS S S  TD P  
Sbjct  370  VLSPLGLPLRPGVQPCTFYLQNGYCKFGSTCKFDHPLGNMRYSPSASSLTDMPVA  424


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 49/83 (59%), Gaps = 9/83 (11%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS-------PIGLPLRPGE  335
            +PERPG  +C +YMKTG C FGS CR++HPR+R       + S        IG P   GE
Sbjct  123  YPERPGVADCVYYMKTGFCGFGSRCRYNHPRDR--SSVSTLRSGGGEYPERIGEPACQGE  180

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y + G CKFG +CKF HP
Sbjct  181  KECSYYLKTGQCKFGITCKFHHP  203



>ref|XP_011090931.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Sesamum 
indicum]
Length=496

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 108/176 (61%), Gaps = 25/176 (14%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR-----------  155
            P +Y P++ P G+V VPG+  Y   +  V+S+  Q  T G   +YG ++           
Sbjct  236  PGSYGPMLFPPGVVPVPGWTPYPAPVSPVASSSAQP-TVGPGPIYGLTQLSPSATAYTGP  294

Query  156  ------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCM  299
                        + ++E+ FPERPGQPECQ+Y+KTGDCKFG+ C++HHP E   P  + +
Sbjct  295  FLSVTSSAGPSSSSQKEHPFPERPGQPECQYYLKTGDCKFGATCKYHHPPEWSAPKINFV  354

Query  300  LSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            LSP+GLPLRPG P+C  Y++ G+CKFGPSCKFDHPM + +YS S S  TD P   +
Sbjct  355  LSPMGLPLRPGAPLCSHYAQNGVCKFGPSCKFDHPMRILSYSPSASSLTDMPVAPY  410


 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            S   G  RA   E  +PER GQP CQ+YM+TG CKFG+ C++HHP+  +       L+  
Sbjct  89   SMAMGALRAGGGE--YPERAGQPVCQYYMRTGMCKFGASCKYHHPKHGVGSSAPVTLNVY  146

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            G PLRPGE  C +Y + G CKFG +CKF HP
Sbjct  147  GYPLRPGEKECSYYVKTGQCKFGVTCKFHHP  177


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 11/97 (11%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERP +P+C +Y++TG C +G+ CRF+HPR+R +            P R G+P+C +Y 
Sbjct  56   YPERPDEPDCIYYLRTGFCGYGNRCRFNHPRDRSMAMGALRAGGGEYPERAGQPVCQYYM  115

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSP  434
            R G+CKFG SCK+ HP           + V+ Y L P
Sbjct  116  RTGMCKFGASCKYHHPKHGVGSSAPVTLNVYGYPLRP  152



>ref|XP_010507789.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Camelina 
sativa]
Length=399

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 104/170 (61%), Gaps = 21/170 (12%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P+++  G+V +PG++      S + + G +   G++ +YG ++               
Sbjct  144  YGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQHAVGATSLYGVTQLSSTSPSLPGVYPSL  203

Query  156  -----AIERENV-FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL  317
                  I++E   FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P  +C+LSPIGL
Sbjct  204  SSPTGVIQKEQAAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGL  263

Query  318  PLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            PLRPG   C FY + G CKFG +CKFDHPMG   Y+ S S   DAP   +
Sbjct  264  PLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVAPY  313


 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
             +     +PER G+  CQFY+KTG CKFG+ C+FHHP+          L+  G P+R GE
Sbjct  6    TVRATGQYPERFGELPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGE  65

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C +Y + G CKFG +CKF HP
Sbjct  66   NECSYYLKTGQCKFGITCKFHHP  88



>ref|XP_008796231.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X1 [Phoenix dactylifera]
Length=464

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 110/177 (62%), Gaps = 26/177 (15%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSRAI---------  161
            P +Y P+++  G+V V G+  Y   +  V S  GQ+ T  +  +YG S  +         
Sbjct  207  PGSYGPMLLSPGVVPVQGWGPYPAPISPVVSPGGQQ-TVQTGPLYGLSDQVTTSVPAYQV  265

Query  162  ---------------ERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                           ERE +FPERPGQPECQFYM+TGDCKFG+ C++HHPR+  IP  +C
Sbjct  266  PYTSASSLARPSSSSEREQMFPERPGQPECQFYMRTGDCKFGATCKYHHPRDWSIPKTNC  325

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            +LSP+GLPLRPG  IC +Y+++G+CKFGP+CKFDHP+G  +YS S S  +D P   +
Sbjct  326  VLSPLGLPLRPGAQICSYYAQHGVCKFGPTCKFDHPVGTLSYSPSASSLSDMPVAPY  382


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 61/105 (58%), Gaps = 2/105 (2%)
 Frame = +3

Query  96   SSAEGQKLTAGSSQVYGTSRAIERENV--FPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            S   G++      + +G      R  V  +P+  GQP C++YMKTG CKFGS C++HHPR
Sbjct  54   SCGYGERCRYNHPRDHGALAGAGRTGVVEYPQHVGQPVCEYYMKTGTCKFGSTCKYHHPR  113

Query  270  ERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            +        +L+  G PLRPGE  C +Y + G CKFG +CKF HP
Sbjct  114  QGGGSEQPVLLNYYGYPLRPGEKECSYYMKTGQCKFGLTCKFHHP  158


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICI  347
            ++ +PERPG+P+C +Y++TG C +G  CR++HPR+            +  P   G+P+C 
Sbjct  34   DSPYPERPGEPDCAYYIRTGSCGYGERCRYNHPRDHGALAGAGRTGVVEYPQHVGQPVCE  93

Query  348  FYSRYGICKFGPSCKFDHP  404
            +Y + G CKFG +CK+ HP
Sbjct  94   YYMKTGTCKFGSTCKYHHP  112



>ref|XP_009802825.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana sylvestris]
Length=496

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 107/175 (61%), Gaps = 24/175 (14%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGY----AYSGQLGSVSS--AEGQKLTAGSSQV-----------  140
            P  Y P++ P GMV VPG+    A + QL S+++  A G     G +Q+           
Sbjct  237  PGTYGPMLFPPGMVPVPGWTPYPASASQLPSLTTQPAAGAGPVYGLTQLSASAPSYMGPH  296

Query  141  ------YGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCML  302
                   G S +I++E+ FPERPGQPECQ+YMK GDCKFGS CR+HHP E   P    +L
Sbjct  297  TSLTASIGPSGSIQKEHAFPERPGQPECQYYMKYGDCKFGSSCRYHHPPEWSGPKLGFIL  356

Query  303  SPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            S +GLPLRPG PIC  YS+ G+CKFGPSCKFDHPMG+ +YS S S   D P   +
Sbjct  357  SAMGLPLRPGAPICSHYSQNGVCKFGPSCKFDHPMGI-SYSPSASSLVDMPVAPY  410


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 59/96 (61%), Gaps = 7/96 (7%)
 Frame = +3

Query  138  VYGTSRAIERENV---FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP  308
            V G +RAI        +PER GQP CQ+YM+TG CKFG+ C++HHPR+    P     + 
Sbjct  78   VMGAARAIGGGGGEGEYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNI  137

Query  309  IGLPLRP----GEPICIFYSRYGICKFGPSCKFDHP  404
             G PLRP    GE  C+FY + G CKFG +CKF HP
Sbjct  138  YGYPLRPFLAQGEKECLFYMKTGQCKFGITCKFHHP  173


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 13/85 (15%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL---------PLRP  329
            +PERP + +C +Y++TG C +GS CRF+HP +R +     M +   +         P R 
Sbjct  43   YPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNL----VMGAARAIGGGGGEGEYPERV  98

Query  330  GEPICIFYSRYGICKFGPSCKFDHP  404
            G+P+C +Y R G+CKFG SCK+ HP
Sbjct  99   GQPVCQYYMRTGMCKFGASCKYHHP  123


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 6/48 (13%)
 Frame = +3

Query  144  GTSRAIERENVF--PERP----GQPECQFYMKTGDCKFGSVCRFHHPR  269
            G S A+   N++  P RP    G+ EC FYMKTG CKFG  C+FHHP+
Sbjct  127  GGSPALMTHNIYGYPLRPFLAQGEKECLFYMKTGQCKFGITCKFHHPQ  174



>ref|XP_009802826.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
isoform X2 [Nicotiana sylvestris]
Length=492

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 107/175 (61%), Gaps = 24/175 (14%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGY----AYSGQLGSVSS--AEGQKLTAGSSQV-----------  140
            P  Y P++ P GMV VPG+    A + QL S+++  A G     G +Q+           
Sbjct  233  PGTYGPMLFPPGMVPVPGWTPYPASASQLPSLTTQPAAGAGPVYGLTQLSASAPSYMGPH  292

Query  141  ------YGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCML  302
                   G S +I++E+ FPERPGQPECQ+YMK GDCKFGS CR+HHP E   P    +L
Sbjct  293  TSLTASIGPSGSIQKEHAFPERPGQPECQYYMKYGDCKFGSSCRYHHPPEWSGPKLGFIL  352

Query  303  SPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            S +GLPLRPG PIC  YS+ G+CKFGPSCKFDHPMG+ +YS S S   D P   +
Sbjct  353  SAMGLPLRPGAPICSHYSQNGVCKFGPSCKFDHPMGI-SYSPSASSLVDMPVAPY  406


 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = +3

Query  138  VYGTSRAIERENV---FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP  308
            V G +RAI        +PER GQP CQ+YM+TG CKFG+ C++HHPR+    P     + 
Sbjct  78   VMGAARAIGGGGGEGEYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNI  137

Query  309  IGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             G PLRPGE  C+FY + G CKFG +CKF HP
Sbjct  138  YGYPLRPGEKECLFYMKTGQCKFGITCKFHHP  169


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 13/85 (15%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL---------PLRP  329
            +PERP + +C +Y++TG C +GS CRF+HP +R +     M +   +         P R 
Sbjct  43   YPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNL----VMGAARAIGGGGGEGEYPERV  98

Query  330  GEPICIFYSRYGICKFGPSCKFDHP  404
            G+P+C +Y R G+CKFG SCK+ HP
Sbjct  99   GQPVCQYYMRTGMCKFGASCKYHHP  123


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 2/44 (5%)
 Frame = +3

Query  144  GTSRAIERENVF--PERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            G S A+   N++  P RPG+ EC FYMKTG CKFG  C+FHHP+
Sbjct  127  GGSPALMTHNIYGYPLRPGEKECLFYMKTGQCKFGITCKFHHPQ  170



>ref|XP_010523985.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523986.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523988.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523989.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
Length=475

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 105/170 (62%), Gaps = 26/170 (15%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------------  155
            Y P+++  G+V +PG++ YS  +  V S  G +   G++ +YG ++              
Sbjct  215  YGPMLLTPGVVPIPGWSPYSAPMSPVLSP-GAQHAVGATSLYGVTQLSSSTPSVAGVYQS  273

Query  156  ----------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
                        ++E +FPERPG+PECQ+Y++TGDCKFG  C+FHHPR+R+ P  +C+LS
Sbjct  274  LSSSTAPSAAGNQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHPRDRVPPRANCILS  333

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAP  455
            PIGLPLRPG   C FY + G C+FG +CKFDHPMG  +Y+ S S   DAP
Sbjct  334  PIGLPLRPGVQPCTFYLQNGFCRFGSTCKFDHPMGTLSYNPSASSLVDAP  383


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A+     +PER G+P CQFY+KTG CKFG+ C+FHHP+          L+  G PLR GE
Sbjct  83   AVRATGDYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREGE  142

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C  Y + G CKFG +CKF HP
Sbjct  143  KECSHYLKTGQCKFGVTCKFHHP  165


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +3

Query  159  IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGE  335
            +     +PERPG P+C +YM+TG C +GS CR++HPR+R +   +  +   G  P R GE
Sbjct  39   LSNSETYPERPGVPDCAYYMRTGICGYGSRCRYNHPRDRAM--VEAAVRATGDYPERVGE  96

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            P C FY + G CKFG SCKF HP
Sbjct  97   PPCQFYLKTGTCKFGASCKFHHP  119



>ref|XP_008802110.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
[Phoenix dactylifera]
Length=466

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 107/176 (61%), Gaps = 25/176 (14%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSRAI---------  161
            P +Y P+++  G+V V G+  Y   +  V S  GQ+ T  +  +YG S            
Sbjct  210  PGSYGPMLLSPGVVPVQGWGPYPAPVSPVVSPGGQQ-TVQAGHLYGLSSQTASVPAYPGP  268

Query  162  --------------ERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCM  299
                          +RE+ FPERPGQPECQFYM+TGDCKFG+ CR+HHPR+  IP  +C 
Sbjct  269  YTPVSSSAGPSSSSQREHTFPERPGQPECQFYMRTGDCKFGATCRYHHPRDWSIPKTNCA  328

Query  300  LSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            LSP+GLPLRPG   C +Y+++G+CKFGP+CKFDHPMG  +YS S S  +D P   +
Sbjct  329  LSPLGLPLRPGAQPCAYYAQHGVCKFGPTCKFDHPMGTLSYSPSASSLSDMPVAPY  384


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 0/89 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQP C++YM+TG CKFGS C++HHPR+        + +  G PLRPGE  C +Y 
Sbjct  86   YPERVGQPVCEYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLFNYYGFPLRPGEKECSYYM  145

Query  357  RYGICKFGPSCKFDHPMGVFAYSLSPSPS  443
            + G CKFG +CKF HP    A   SP+P+
Sbjct  146  KTGQCKFGSTCKFHHPQPAGASVPSPAPT  174


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P+C +YM+TG C +G  CR++HPR+R              P R G+P+C +Y 
Sbjct  40   YPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGGGRTGVGEYPERVGQPVCEYYM  99

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CK+ HP
Sbjct  100  RTGTCKFGSTCKYHHP  115



>ref|XP_010507842.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Camelina sativa]
 ref|XP_010507843.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Camelina sativa]
Length=449

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 104/170 (61%), Gaps = 21/170 (12%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P+++  G+V +PG++      S + + G +   G++ +YG ++               
Sbjct  194  YGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQHAVGATSLYGVTQLSSTSPSLPGVYPSL  253

Query  156  -----AIERENV-FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL  317
                  I++E   FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P  +C+LSPIGL
Sbjct  254  SSPTGVIQKEQAAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGL  313

Query  318  PLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            PLRPG   C FY + G CKFG +CKFDHP+G   Y+ S S   DAP   +
Sbjct  314  PLRPGVQRCTFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLADAPVAPY  363


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPIC  344
               +PER G P+C +YM+TG C +G+ CR++HPR+R     +  +   G  P R GE  C
Sbjct  42   SETYPERLGAPDCAYYMRTGVCGYGNRCRYNHPRDRA--SVEATVRATGQYPERIGELPC  99

Query  345  IFYSRYGICKFGPSCKFDHP  404
             FY + G CKFG SCKF HP
Sbjct  100  QFYLKTGTCKFGASCKFHHP  119


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRE  272
            + V  T RA  +   +PER G+  CQFY+KTG CKFG+ C+FHHP+ 
Sbjct  78   ASVEATVRATGQ---YPERIGELPCQFYLKTGTCKFGASCKFHHPKN  121



>ref|XP_007035523.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
 gb|EOY06449.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
Length=472

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 103/173 (60%), Gaps = 27/173 (16%)
 Frame = +3

Query  18   NYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTS---------------  152
            +Y PL++  GMVSVP  +++  +  VS   G + T GSS ++G +               
Sbjct  219  HYGPLLLSPGMVSVP--SWNPYMAPVS--PGTQPTVGSSSIFGVTPLSPSAPAYTGPYLP  274

Query  153  --------RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP  308
                     + ++E  FPERPGQPECQ+YMKTGDCK+GS CR+HHP E + P  D ML P
Sbjct  275  VPSSVGPSSSSQKEQSFPERPGQPECQYYMKTGDCKYGSSCRYHHPPEVIAPKADVMLGP  334

Query  309  IGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            +GLPLRPG P C  YS+ G+CKFG +CKFDHP G  +YS S S   D P   +
Sbjct  335  LGLPLRPGAPPCSHYSQRGVCKFGAACKFDHPTGTLSYSPSASSLADMPVAPY  387


 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQP CQ+YM+TG CKFG  C++HHP++        +L+  G PLRPGE  C +Y 
Sbjct  84   YPERVGQPVCQYYMRTGTCKFGVSCKYHHPKQGGGSVSSVLLNYYGYPLRPGEKECSYYV  143

Query  357  RYGICKFGPSCKFDH  401
            + G CKFG +CKF H
Sbjct  144  KTGQCKFGATCKFHH  158


 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERP + +C +Y++TG C +GS CRF+HPR+R              P R G+P+C +Y 
Sbjct  38   YPERPEEADCIYYLRTGFCGYGSRCRFNHPRDRAAVMGAGRGGVGEYPERVGQPVCQYYM  97

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG SCK+ HP
Sbjct  98   RTGTCKFGVSCKYHHP  113



>ref|XP_010507840.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Camelina sativa]
 ref|XP_010507841.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Camelina sativa]
Length=475

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 104/170 (61%), Gaps = 21/170 (12%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P+++  G+V +PG++      S + + G +   G++ +YG ++               
Sbjct  220  YGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQHAVGATSLYGVTQLSSTSPSLPGVYPSL  279

Query  156  -----AIERENV-FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL  317
                  I++E   FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P  +C+LSPIGL
Sbjct  280  SSPTGVIQKEQAAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGL  339

Query  318  PLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            PLRPG   C FY + G CKFG +CKFDHP+G   Y+ S S   DAP   +
Sbjct  340  PLRPGVQRCTFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLADAPVAPY  389


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            + V  T RA  +   +PER G+  CQFY+KTG CKFG+ C+FHHP+          L+  
Sbjct  78   ASVEATVRATGQ---YPERIGELPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIY  134

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            G P+R GE  C +Y + G CKFG +CKF HP
Sbjct  135  GYPVREGENECSYYLKTGQCKFGITCKFHHP  165


 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 49/79 (62%), Gaps = 3/79 (4%)
 Frame = +3

Query  171  NVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPICI  347
              +PER G P+C +YM+TG C +G+ CR++HPR+R     +  +   G  P R GE  C 
Sbjct  43   ETYPERLGAPDCAYYMRTGVCGYGNRCRYNHPRDRA--SVEATVRATGQYPERIGELPCQ  100

Query  348  FYSRYGICKFGPSCKFDHP  404
            FY + G CKFG SCKF HP
Sbjct  101  FYLKTGTCKFGASCKFHHP  119



>ref|XP_010518502.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Camelina sativa]
Length=445

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 103/170 (61%), Gaps = 21/170 (12%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P+++  G+V +PG++      S + + G +   G++ +YG ++               
Sbjct  190  YGPMLLTPGVVPIPGWSPYSAPVSPALSPGAQHAVGATSLYGVTQLSSTSPSLPGVYPSL  249

Query  156  -----AIERENV-FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL  317
                  I++E   FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P  +C+LSPIGL
Sbjct  250  SSPTGVIQKEQAAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGL  309

Query  318  PLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            PLRPG   C FY + G CKFG  CKFDHP+G   Y+ S S   DAP   +
Sbjct  310  PLRPGVQRCTFYVQNGFCKFGSKCKFDHPVGTIRYNPSASSLADAPVAPY  359


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGL-PLRPGEPIC  344
               +PER G P+C +YM+TG C +G+ CR++HPR+R     +  +   GL P R G+  C
Sbjct  38   SETYPERLGAPDCAYYMRTGVCGYGNRCRYNHPRDRA--SVEATVRATGLYPERIGDLPC  95

Query  345  IFYSRYGICKFGPSCKFDHP  404
             FY + G CKFG SCKF HP
Sbjct  96   QFYLKTGTCKFGASCKFHHP  115


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRE  272
             +    ++PER G   CQFY+KTG CKFG+ C+FHHP+ 
Sbjct  79   TVRATGLYPERIGDLPCQFYLKTGTCKFGASCKFHHPKN  117



>gb|EEE54266.1| hypothetical protein OsJ_01160 [Oryza sativa Japonica Group]
Length=182

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = +3

Query  150  SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            S + ++E  FP RPGQPECQ+Y+KTG CKFGS C++HHP+    P  +CMLSP+GLPLRP
Sbjct  3    SSSSKQEPAFPARPGQPECQYYLKTGSCKFGSACKYHHPQYLNTPKSNCMLSPLGLPLRP  62

Query  330  GEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            G   C +Y+++G CKFGP+CKFDHPMG  +YS S S  TD P   +
Sbjct  63   GSQPCAYYTQHGFCKFGPTCKFDHPMGTLSYSPSASSITDLPIAPY  108



>ref|XP_011071464.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Sesamum indicum]
 ref|XP_011071465.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Sesamum indicum]
Length=488

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 107/173 (62%), Gaps = 21/173 (12%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQ----------KLTAGSSQVYGTSRA  158
            P +Y P+++P G+V VPG+  Y   +  V+ A  Q          +L+  ++   G   +
Sbjct  235  PGSYGPMLLPPGVVPVPGWTPYPAPVSPVAPATTQTSGGPNYGITQLSPSAAAYTGPYIS  294

Query  159  I----------ERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP  308
            I          ++E+ FPERPG+PECQ+Y+KTGDCKFGS C++HHP E   P  + +LSP
Sbjct  295  ITSSAGPSSSSQKESPFPERPGEPECQYYLKTGDCKFGSTCKYHHPPEWSAPKSNFLLSP  354

Query  309  IGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            +GLPLRPG P+C  Y++ G+CKFGPSCKFDHPM   +YS S S  TD P   +
Sbjct  355  MGLPLRPGAPLCSHYAQNGVCKFGPSCKFDHPMRTLSYSPSASSLTDMPVAPY  407


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER  QP CQ+YM+TG CKFG+ C++HHP++ +      ML+  G PLRPGE  C +Y 
Sbjct  88   YPERISQPVCQYYMRTGMCKFGASCKYHHPKQGIGSSAPIMLNFYGYPLRPGEKECSYYV  147

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  148  KTGQCKFGVTCKFHHP  163


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERP +P+C +Y++TG C +G+ CRF+HPR+R         S  G P R  +P+C +Y 
Sbjct  42   YPERPDEPDCIYYLRTGSCGYGTRCRFNHPRDRGAAVGALRASGGGYPERISQPVCQYYM  101

Query  357  RYGICKFGPSCKFDHP  404
            R G+CKFG SCK+ HP
Sbjct  102  RTGMCKFGASCKYHHP  117


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            +P RPG+ EC +Y+KTG CKFG  C+FHHP+
Sbjct  134  YPLRPGEKECSYYVKTGQCKFGVTCKFHHPQ  164



>ref|XP_009378917.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 32 [Pyrus x bretschneideri]
Length=571

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 103/174 (59%), Gaps = 25/174 (14%)
 Frame = +3

Query  18   NYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSRAIE----------  164
             Y P+++P G+V + G++ YS  L  V S  G + T G++ +YG ++             
Sbjct  324  TYGPVLIPPGVVPIQGWSPYSAPLSPVPSP-GAQPTVGATSLYGVTQLSSPTHGLASPYT  382

Query  165  -------------RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
                          E VFPERPG+ ECQ+Y+KTGDCK+G  CR+HHPR+R +P   C+LS
Sbjct  383  SIPSSVGPSSSNPSEQVFPERPGELECQYYLKTGDCKYGPSCRYHHPRDRTVPGITCLLS  442

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            PIGLPLRPGEP C FY + G C FG +CKFDHP+    Y+LS S   D P  Q+
Sbjct  443  PIGLPLRPGEPPCRFYLKNGQCMFGSTCKFDHPVQTMRYNLSASSLVDMPVVQY  496


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P CQ+Y+KTG CKFG+ C++HHP+          L+  G PLRPGE  C +Y 
Sbjct  198  YPERVGEPVCQYYLKTGTCKFGASCKYHHPKHGAGSLNRAPLNIYGYPLRPGENECSYYL  257

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  258  KTGQCKFGITCKFHHP  273


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 52/97 (54%), Gaps = 12/97 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G P C +YM+TG C +G  CR+ HPR+R         +    P R GEP+C +Y 
Sbjct  153  YPERLGVPNCVYYMRTGFCGYGGRCRYSHPRDRAAVVATVRATG-DYPERVGEPVCQYYL  211

Query  357  RYGICKFGPSCKFDH-----------PMGVFAYSLSP  434
            + G CKFG SCK+ H           P+ ++ Y L P
Sbjct  212  KTGTCKFGASCKYHHPKHGAGSLNRAPLNIYGYPLRP  248



>gb|AAC63639.1| unknown protein [Arabidopsis thaliana]
Length=553

 Score =   145 bits (367),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 104/180 (58%), Gaps = 31/180 (17%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYA---------YSGQLGSVSSA--EGQKLTAGSSQVYGTSR----  155
            Y P+++  G+V +PG++                VS A   G +   G++ +YG ++    
Sbjct  288  YGPMLLTPGVVPIPGWSPYSSLTVSLLLLLQAPVSPALSPGAQHAVGATSLYGVTQLTST  347

Query  156  ----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPP  287
                             I++E  FPERPG+PECQ+Y+KTGDCKFG+ C+FHHPR+R+ P 
Sbjct  348  TPSLPGVYPSLSSPTGVIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPR  407

Query  288  PDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
             +C+LSPIGLPLRPG   C FY + G CKFG +CKFDHPMG   Y+ S S   DAP   +
Sbjct  408  ANCVLSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVAPY  467


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            + V  T RA  +   +PER G+P CQFY+KTG CKFG+ C+FHHP+          L+  
Sbjct  149  ASVEATVRATGQ---YPERFGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIY  205

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            G P+R G+  C +Y + G CKFG +CKF HP
Sbjct  206  GYPVREGDNECSYYLKTGQCKFGITCKFHHP  236


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 3/80 (4%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPIC  344
             + +PERPG P+C +YM+TG C +G+ CR++HPR+R     +  +   G  P R GEP C
Sbjct  113  SDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRA--SVEATVRATGQYPERFGEPPC  170

Query  345  IFYSRYGICKFGPSCKFDHP  404
             FY + G CKFG SCKF HP
Sbjct  171  QFYLKTGTCKFGASCKFHHP  190



>gb|KDP28101.1| hypothetical protein JCGZ_13872 [Jatropha curcas]
Length=468

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 100/168 (60%), Gaps = 21/168 (13%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSS------------------QVY  143
            Y P++   G+V +PG++ YS  +  V S   Q    G+S                   V 
Sbjct  217  YGPVLFSPGVVPIPGWSHYSAPVSPVMSPGAQPAVGGTSLYVSSSTPALVGTYPSPSSVA  276

Query  144  GTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPL  323
            G S   ++E  FPERPG+PECQ+Y++TGDCKFGS CR+HHPR+R++P  +C+LSP+GLPL
Sbjct  277  GLSSGTQKELTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRIVPRTNCVLSPLGLPL  336

Query  324  RPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            RPG   C FY R G CKFG +CKFDHPM    YS S S   D P   +
Sbjct  337  RPGVQHCTFYMRNGHCKFGSTCKFDHPM--MRYSPSASSLIDMPVAPY  382


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P CQFY+KTG CKFG+ C+FHHP+          L+  G PLRPGE  C +Y 
Sbjct  90   YPERAGEPLCQFYLKTGTCKFGASCKFHHPKHGGGSLSHVPLNIHGYPLRPGEKECSYYL  149

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  150  KTGQCKFGITCKFHHP  165


 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
             +     +PER G P+C +YM+TG C +G+ CR++HPR R         +    P R GE
Sbjct  38   GLASSESYPERSGVPDCVYYMRTGCCGYGARCRYNHPRNRAAVEAAVRAT-GEYPERAGE  96

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            P+C FY + G CKFG SCKF HP
Sbjct  97   PLCQFYLKTGTCKFGASCKFHHP  119



>ref|XP_011077188.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Sesamum indicum]
Length=327

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 91/134 (68%), Gaps = 25/134 (19%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGY-AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIE-----  164
            WQ PS+Y+PL + QG+ S PG+  YSGQ+  VS +E Q+   G+ Q  GTS  +E     
Sbjct  197  WQTPSSYAPLFMSQGVASAPGWNTYSGQVEPVSPSENQQ---GNIQNDGTSYQVEGLNVG  253

Query  165  ----------------RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                            R+NVFPERPGQP+CQFYMKTGDCKFG+VC+FHHPRERLIP PDC
Sbjct  254  SQFGSNTLPIGYYAFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPLPDC  313

Query  297  MLSPIGLPLRPGEP  338
            +LSPIGLPLRP  P
Sbjct  314  VLSPIGLPLRPVAP  327


 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHPR+ L       L+ +G PLRP E  C +Y 
Sbjct  82   YPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCAYYI  141

Query  357  RYGICKFGPSCKFDHP  404
            R G+CKFG +CKF HP
Sbjct  142  RNGLCKFGRTCKFHHP  157


 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 12/98 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P R G+P+C +Y++TG C+FG+ CRF+HP  R +      +     P R G+P C +Y 
Sbjct  37   YPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARMKS-EYPERIGQPECQYYL  95

Query  357  RYGICKFGPSCKFDHP-----------MGVFAYSLSPS  437
            + G CKFG +CKF HP           + V  Y L P+
Sbjct  96   KTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPN  133



>ref|XP_002520668.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF41630.1| nucleic acid binding protein, putative [Ricinus communis]
Length=478

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 119/214 (56%), Gaps = 31/214 (14%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------------  155
            Y P++   G+V +PG++ YS  +  V S   Q    G++ +YG ++              
Sbjct  220  YGPVLFSPGVVPIPGWSPYSAPVSPVLSPSAQP-AVGATSLYGVTQLSSSTPALAGPYPS  278

Query  156  -------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDC  296
                           ++E  FPERPG+PECQ+Y++TGDCKFGS CR+HHPR+R++P  +C
Sbjct  279  PSSAAAAAAAPLSGTQKEQTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRVVPRTNC  338

Query  297  MLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQFllg  476
            +LSP+GLPLRPG   C FY R G CKFG +CKFDHPM    YS S S   D P   + +G
Sbjct  339  VLSPLGLPLRPGAQHCTFYLRNGHCKFGSTCKFDHPMETMRYSPSASSLIDMPVAPYPVG  398

Query  477  sssgtgaltlsseglVDAGSTNP--RRLPSGDNN  572
            S   T A + SS  L+     +P   R+PS  N 
Sbjct  399  SLLATLAPSSSSSELIGGTKIDPYLSRIPSSGNT  432


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P C+FY+KTG CKFG+ C+FHHP+          L+  G PLRPGE  C +Y 
Sbjct  93   YPERIGEPSCEFYLKTGTCKFGASCKFHHPKHGGGSLSHVPLNTHGYPLRPGENECSYYL  152

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  153  KTGQCKFGITCKFHHP  168


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG P+C +YM+TG C +G+ CR++HPR R         +    P R GEP C FY 
Sbjct  48   YPERPGVPDCVYYMRTGFCGYGNRCRYNHPRNRAAVEAAVRAT-GEYPERIGEPSCEFYL  106

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG SCKF HP
Sbjct  107  KTGTCKFGASCKFHHP  122


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            +P RPG+ EC +Y+KTG CKFG  C+FHHP+
Sbjct  139  YPLRPGENECSYYLKTGQCKFGITCKFHHPQ  169



>ref|XP_010112757.1| Zinc finger CCCH domain-containing protein 32 [Morus notabilis]
 gb|EXC34715.1| Zinc finger CCCH domain-containing protein 32 [Morus notabilis]
Length=466

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 105/173 (61%), Gaps = 25/173 (14%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR------AIER----  167
            Y P++ P G+V +PG+  YS  +  V S  G + T G++ +YG +       A+ R    
Sbjct  215  YGPVLFPPGVVPIPGWNPYSAPVSPVLSP-GAQPTVGAASMYGVTHLSSSTAALARPYPS  273

Query  168  -------------ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP  308
                         E VFPER G+PECQ+Y++TGDCKFGS CR+HHPR+R++P  +C+LSP
Sbjct  274  LPSSIGASSSSPKEQVFPERHGEPECQYYLRTGDCKFGSSCRYHHPRDRVMPRTNCLLSP  333

Query  309  IGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            +GLPLRPG   C FY + G CKFG +CKFDHP+G   YS S S   D P   +
Sbjct  334  VGLPLRPGVQPCTFYLQNGHCKFGSTCKFDHPIGTMRYSPSASSLIDMPVAPY  386


 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P CQ+Y+KTG CKFG+ C+FHHP+          L+  G PLRPGE  C +Y 
Sbjct  87   YPERVGEPVCQYYLKTGTCKFGASCKFHHPKHGGGSLSQAPLNIYGYPLRPGETECSYYL  146

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  147  KTGQCKFGITCKFHHP  162


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 12/97 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG P C +YM+TG C +G  CR++HPR+R         +    P R GEP+C +Y 
Sbjct  42   YPERPGVPNCVYYMRTGYCGYGVRCRYNHPRDRAAVAAAVRAT-GEYPERVGEPVCQYYL  100

Query  357  RYGICKFGPSCKFDH-----------PMGVFAYSLSP  434
            + G CKFG SCKF H           P+ ++ Y L P
Sbjct  101  KTGTCKFGASCKFHHPKHGGGSLSQAPLNIYGYPLRP  137



>ref|XP_010913061.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=381

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 92/135 (68%), Gaps = 27/135 (20%)
 Frame = +3

Query  3    WQGPSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------  155
            WQGPS+Y+ L++PQG+V VPG+  Y GQ+GS SS + ++ T G ++ Y  SR        
Sbjct  216  WQGPSSYAQLILPQGLVQVPGWNPYPGQMGS-SSPKSRQQTPGVAEYYSASRQSETSEGA  274

Query  156  -----------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIP  284
                             A++REN+FP RP QPECQFYMKTGDCKFG+ CRFHHPRERL+P
Sbjct  275  QGTFSSYRLGSIPMGVYALQRENIFPNRPDQPECQFYMKTGDCKFGAACRFHHPRERLMP  334

Query  285  PPDCMLSPIGLPLRP  329
             PDC+LSP+GLPLRP
Sbjct  335  VPDCVLSPLGLPLRP  349


 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQPECQ+Y+KTG CKFG+ C+FHHP+++        L+ +G PLRP E  C +Y 
Sbjct  92   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYL  151

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG +CKF HP
Sbjct  152  RTGQCKFGNTCKFHHP  167


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +P+RPG+P+C +Y++TG C+FG  C+F+HP  R +      +   G P R G+P C +Y 
Sbjct  47   YPKRPGEPDCAYYIRTGLCRFGMTCKFNHPPNRKMAIAAARIKG-GYPERVGQPECQYYL  105

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 13/61 (21%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCML--------SPIGLPLRPG  332
            +P RP + EC +Y++TG CKFG+ C+FHHP+     P + M+        SP+  P  PG
Sbjct  138  YPLRPNEKECAYYLRTGQCKFGNTCKFHHPQ-----PSNAMVALRGSSVYSPVHSPTIPG  192

Query  333  E  335
            +
Sbjct  193  Q  193



>emb|CDO98891.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 100/175 (57%), Gaps = 23/175 (13%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR------------  155
            P  Y P+++P GMV +P +       S+++    +   G+  +YG ++            
Sbjct  233  PGTYGPMLLPPGMVPLPAWTSYPSPVSLAATASNQPAVGAGHIYGITQLSPSAPAYTGQY  292

Query  156  -----------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCML  302
                       + +RE+ FPERPGQPECQ+YMK GDCKFG+ CR+HHP E      + +L
Sbjct  293  LSIPPAAGPSGSSQREHAFPERPGQPECQYYMKYGDCKFGASCRYHHPPELSAQKSNPVL  352

Query  303  SPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            SP+GLPLRPG  +C  Y + G+CKFGPSCKFDHPMG  +YS S S   D P   +
Sbjct  353  SPMGLPLRPGAAVCSHYIQNGVCKFGPSCKFDHPMGTLSYSPSASSLADMPVAPY  407


 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +3

Query  150  SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRP  329
            +RA   E  +PER GQP CQFYM+TG+CKFG+ C++HHPR+         L+  G PLRP
Sbjct  85   ARATAGE--YPERVGQPVCQFYMRTGNCKFGASCKYHHPRQGSGSQTPVNLNFFGYPLRP  142

Query  330  GEPICIFYSRYGICKFGPSCKFDHP  404
            GE  C +Y + G CK+G +CK+ HP
Sbjct  143  GEKDCSYYVKTGQCKYGVTCKYHHP  167


 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERP Q +C +Y++TG C +G+ CRF+HPR+R         +    P R G+P+C FY 
Sbjct  47   YPERPDQADCIYYLRTGLCGYGARCRFNHPRDRTA-AMGARATAGEYPERVGQPVCQFYM  105

Query  357  RYGICKFGPSCKFDHP  404
            R G CKFG SCK+ HP
Sbjct  106  RTGNCKFGASCKYHHP  121



>ref|XP_007050814.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
 gb|EOX94971.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
Length=476

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 103/172 (60%), Gaps = 23/172 (13%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSR---------------  155
            Y P++   G+V +PG+++     S   + G +   G++ +YG ++               
Sbjct  218  YGPVLFSPGVVPIPGWSHYSAPVSPVLSPGAQPAVGATSLYGLTQLSSSTPSLAGPYSSV  277

Query  156  --------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
                    + ++E  FPERPG+PECQ+Y++TGDCKFGS CR+HHPR+R++P  +C+LSP+
Sbjct  278  PSSTGPASSNQKEQTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRVVPRTNCVLSPM  337

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            GLPLRPG   C FY + G CKFG +CKFDHPMG   YS S S   D P   +
Sbjct  338  GLPLRPGVQPCSFYLQNGHCKFGSTCKFDHPMGTMRYSPSASSLIDMPVAPY  389


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P CQFY+KTG CKFG+ C+FHHP+          L+  G PLRPGE  C +Y 
Sbjct  90   YPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSHVPLNIYGYPLRPGEKECSYYL  149

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  150  KTGQCKFGITCKFHHP  165


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 57/104 (55%), Gaps = 12/104 (12%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            ++     +PERPG P+C +YM+TG C +G+ CR++HPR R         +    P RPGE
Sbjct  38   SLRGTESYPERPGVPDCVYYMRTGFCGYGNRCRYNHPRNRAAVEAAVRAT-GEYPERPGE  96

Query  336  PICIFYSRYGICKFGPSCKFDH-----------PMGVFAYSLSP  434
            P C FY + G CKFG SCKF H           P+ ++ Y L P
Sbjct  97   PACQFYLKTGTCKFGASCKFHHPKHGGGSFSHVPLNIYGYPLRP  140


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            +P RPG+ EC +Y+KTG CKFG  C+FHHP+
Sbjct  136  YPLRPGEKECSYYLKTGQCKFGITCKFHHPQ  166



>ref|XP_011013662.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=476

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 89/133 (67%), Gaps = 12/133 (9%)
 Frame = +3

Query  69   AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSV  248
            AY+G   SV+SA+G             S + ++E+VFPERPGQPECQ+YMKTGDCKF S 
Sbjct  274  AYTGAYQSVTSAKG------------PSSSSQKEHVFPERPGQPECQYYMKTGDCKFESS  321

Query  249  CRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSL  428
            CR+HHP E +    + +LSP+G PLRPG P C  Y+++G CKFGP+CKFDHPMG  +YS 
Sbjct  322  CRYHHPPELVASKTNVVLSPMGFPLRPGAPTCTHYTQHGQCKFGPACKFDHPMGTLSYSP  381

Query  429  SPSPSTDAPAGQF  467
            S S   D P   +
Sbjct  382  SASSLADMPVAPY  394


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 59/90 (66%), Gaps = 4/90 (4%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            FPER GQP CQ+YM+TG CKFG+ C+++HP++         L+  G PLRPG+  C +Y 
Sbjct  90   FPERVGQPLCQYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNFYGYPLRPGDKECTYYI  149

Query  357  RYGICKFGPSCKFDHP----MGVFAYSLSP  434
            + G CKFG +CKF HP    M + A SL+P
Sbjct  150  KTGQCKFGATCKFHHPQPANMQIPAQSLAP  179


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +3

Query  162  ERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPI  341
            E E+ +PERP + +C +Y++TG C +G+ CR++HPR+R              P R G+P+
Sbjct  39   ETESEYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAALEAGRTGGGEFPERVGQPL  98

Query  342  CIFYSRYGICKFGPSCKFDHP  404
            C +Y R G CKFG SCK++HP
Sbjct  99   CQYYMRTGTCKFGASCKYNHP  119



>ref|XP_004309682.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Fragaria 
vesca subsp. vesca]
Length=462

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 106/173 (61%), Gaps = 26/173 (15%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR------AIER----  167
            Y P+++P G+V +P +  YS  L S + + G + T G++ +YG ++      A+ R    
Sbjct  214  YGPVLIPPGVVPIPSWNPYSAPL-SPALSPGAQPTVGATSLYGLTQLSSPPHALARPYTS  272

Query  168  -------------ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP  308
                         E  FPERPG+PECQ+Y++TGDCKFG  CR+HHPR+R+ P  +C+LSP
Sbjct  273  VPSSVGPSSSSPNEQTFPERPGEPECQYYLRTGDCKFGPSCRYHHPRDRIAPRTNCLLSP  332

Query  309  IGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            +GLPLRPG   C FY + G CKFG SCKFDHPMG   YS S S S D P   +
Sbjct  333  VGLPLRPGVQPCTFYLQNGHCKFGSSCKFDHPMGTMRYSPSAS-SLDMPVAPY  384


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P CQ+Y+KTG CKFG+ C+FHHP+          L+  G PLRPGE  C +Y 
Sbjct  86   YPERVGEPVCQYYLKTGTCKFGASCKFHHPKHGGGSLTRAPLNIYGYPLRPGESECSYYL  145

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  146  KTGQCKFGLTCKFHHP  161


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 56/107 (52%), Gaps = 12/107 (11%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
             +     +PERPG P C +YM+TG C +G  CR++HPR+R         +    P R GE
Sbjct  34   GLTSTESYPERPGVPNCVYYMRTGFCGYGVRCRYNHPRDRAAVVAAVRAT-GDYPERVGE  92

Query  336  PICIFYSRYGICKFGPSCKFDH-----------PMGVFAYSLSPSPS  443
            P+C +Y + G CKFG SCKF H           P+ ++ Y L P  S
Sbjct  93   PVCQYYLKTGTCKFGASCKFHHPKHGGGSLTRAPLNIYGYPLRPGES  139


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 10/54 (19%)
 Frame = +3

Query  108  GQKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            G  LT     +YG          +P RPG+ EC +Y+KTG CKFG  C+FHHP+
Sbjct  119  GGSLTRAPLNIYG----------YPLRPGESECSYYLKTGQCKFGLTCKFHHPQ  162



>ref|XP_001752915.1| predicted protein [Physcomitrella patens]
 gb|EDQ82419.1| predicted protein, partial [Physcomitrella patens]
Length=78

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICI  347
            E++FPERPGQPECQ+YMKTGDCKFG+ CR+HHP++R  P P C LSPIGLPLRPG   C 
Sbjct  1    ESLFPERPGQPECQYYMKTGDCKFGTTCRYHHPKDRTTPSPTCHLSPIGLPLRPGNLPCS  60

Query  348  FYSRYGICKFGPSCKFDH  401
            FY+RYGICKFGP+CKFDH
Sbjct  61   FYTRYGICKFGPTCKFDH  78



>ref|XP_009631342.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana tomentosiformis]
Length=488

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 102/174 (59%), Gaps = 26/174 (15%)
 Frame = +3

Query  18   NYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR-------------  155
             Y P++ P GMV VPG+  Y      V S   Q   AG+  VYG ++             
Sbjct  231  TYGPMLFPPGMVPVPGWTPYPASASQVPSLTTQP-AAGAGPVYGLTQLSASAPAYMGPYT  289

Query  156  ----------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
                      +I++E+ FPERPGQPECQ+Y+K GDCKFGS CR+HHP E   P    +LS
Sbjct  290  SLTASIGPSGSIQKEHAFPERPGQPECQYYIKYGDCKFGSSCRYHHPPEWSGPKSGFILS  349

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
             +GLPLRPG PIC  YS+ G+CKFGPSCKFDHPMG+ +YS S S   D P   +
Sbjct  350  AMGLPLRPGAPICSHYSQNGVCKFGPSCKFDHPMGI-SYSPSASSLVDMPVAPY  402


 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 60/90 (67%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  VYGTSRAIER-ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG  314
            V G +RAI   E  +PER GQP CQ+YM+TG CKFG+ C++HHPR+    P     +  G
Sbjct  78   VMGAARAIGGGEEKYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYG  137

Query  315  LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
             PLRPGE  C+FY + G CKFG +CKF HP
Sbjct  138  YPLRPGEKECLFYMKTGQCKFGITCKFHHP  167


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 3/79 (4%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG---LPLRPGEPICI  347
            +PERP + +C +Y++TG C +GS CRF+HP +R +          G    P R G+P+C 
Sbjct  43   YPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAARAIGGGEEKYPERVGQPVCQ  102

Query  348  FYSRYGICKFGPSCKFDHP  404
            +Y R G+CKFG SCK+ HP
Sbjct  103  YYMRTGMCKFGASCKYHHP  121


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (60%), Gaps = 2/57 (4%)
 Frame = +3

Query  144  GTSRAIERENVF--PERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP  308
            G S A+   N++  P RPG+ EC FYMKTG CKFG  C+FHHP+   +  P     P
Sbjct  125  GGSPALMTHNIYGYPLRPGEKECLFYMKTGQCKFGITCKFHHPQPAGVQVPTSAARP  181



>gb|AGT16102.1| hypothetical protein SHCRBa_134_J05_F_10 [Saccharum hybrid cultivar 
R570]
Length=353

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 108/176 (61%), Gaps = 24/176 (14%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQK------------------LTAGS-  131
            P +Y P+M+P  ++ + G+  Y   +  V+ A GQ+                  +T GS 
Sbjct  123  PGSYPPMMLPPTVMPMQGWNPYVSPMNQVTPAGGQQAVPAGASYGLSHQGPTSAVTYGSH  182

Query  132  -SQVY---GTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCM  299
             +Q+Y   GTS +  +E  FPERPGQPEC+ YMKTG CK+G+VC++HHP+    P  +C+
Sbjct  183  YAQLYSSTGTSSSNIQEYAFPERPGQPECEHYMKTGTCKYGAVCKYHHPQYFSGPKSNCI  242

Query  300  LSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            LSP+GLPLRPG   C +Y+ +G CKFGP+CKFDHPMG   YS+S S  TD P   +
Sbjct  243  LSPLGLPLRPGSQPCAYYAHHGFCKFGPTCKFDHPMGTPNYSISASSLTDVPVAPY  298


 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 50/76 (66%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPGQP C++Y K G CKFGS C+F HPRE    P    L+  G PLR GE  C +Y 
Sbjct  4    YPERPGQPLCEYYAKNGTCKFGSNCKFDHPREGGFVP--VTLNSSGFPLRLGEKECSYYM  61

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  62   KTGHCKFGATCKFHHP  77


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            FP R G+ EC +YMKTG CKFG+ C+FHHP 
Sbjct  48   FPLRLGEKECSYYMKTGHCKFGATCKFHHPE  78



>ref|XP_006644012.1| PREDICTED: zinc finger CCCH domain-containing protein 5-like 
[Oryza brachyantha]
Length=436

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 103/172 (60%), Gaps = 28/172 (16%)
 Frame = +3

Query  18   NYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEG-QKLTAGSSQVYGTSR------------  155
            +Y P+M+P  +V + G+  Y   +  V+SA G Q + AG  Q YG S             
Sbjct  188  SYPPMMLPSTVVPMQGWNPYISPVNQVASAGGHQAVQAG--QFYGLSHQGPSSAVTYSSQ  245

Query  156  ------------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCM  299
                        + ++E  FPERPGQPECQ+Y+KTG CKFGS C++HHP+    P  +CM
Sbjct  246  YAPLLSSAMPLSSSKQEPAFPERPGQPECQYYLKTGSCKFGSACKYHHPQYLNTPKSNCM  305

Query  300  LSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAP  455
            LSP+GLPLRPG   C +Y+++G CKFGP+CKFDHPMG   YS S S  TD P
Sbjct  306  LSPLGLPLRPGSQPCAYYTQHGFCKFGPTCKFDHPMGTLNYSPSASSITDLP  357


 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPGQP C+++MK G CKFGS C++ HPRE  + P   +L+  G PLRPGE  C +Y 
Sbjct  69   YPERPGQPVCEYFMKNGTCKFGSNCKYDHPREGSVQP--VVLNASGYPLRPGEKDCSYYV  126

Query  357  RYGICKFGPSCKFDHP  404
            +   CKFG +CKF HP
Sbjct  127  KTSHCKFGSTCKFHHP  142


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCM-----LSPIGLPLRPGEPI  341
             PERPG+ +C +Y++TG C +G  CR++HPR+R                   P RPG+P+
Sbjct  18   LPERPGEADCVYYLRTGACGYGENCRYNHPRDRASAAAALNGGGKSTHSAEYPERPGQPV  77

Query  342  CIFYSRYGICKFGPSCKFDHP  404
            C ++ + G CKFG +CK+DHP
Sbjct  78   CEYFMKNGTCKFGSNCKYDHP  98


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPP  287
            +P RPG+ +C +Y+KT  CKFGS C+FHHP    + P
Sbjct  113  YPLRPGEKDCSYYVKTSHCKFGSTCKFHHPETGGVTP  149



>ref|XP_002314462.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
 gb|EEF00633.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
Length=456

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 89/133 (67%), Gaps = 12/133 (9%)
 Frame = +3

Query  69   AYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSV  248
            AY+G   S+ +A+G             S + ++E+VFPERPGQPECQ+YMKTGDCKF S 
Sbjct  274  AYTGAYQSIPTAKG------------PSSSSQKEHVFPERPGQPECQYYMKTGDCKFESS  321

Query  249  CRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSL  428
            CR+HHP E +    + +LSP+GLPLRPG P C  Y+++G CKFGP+CKFDHPMG  +YS 
Sbjct  322  CRYHHPPELVTSKTNVVLSPMGLPLRPGAPTCTHYTQHGQCKFGPACKFDHPMGTLSYSP  381

Query  429  SPSPSTDAPAGQF  467
            S S   D P   +
Sbjct  382  SASSLADMPVAPY  394


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 66/105 (63%), Gaps = 6/105 (6%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            + V G +RA   E  FPER GQP CQ+YM+TG CKFG+ C+++HP++         L+  
Sbjct  77   TAVLGAARAGGGE--FPERVGQPLCQYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNYY  134

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP----MGVFAYSLSP  434
            G PLRPGE  C +Y + G CKFG +CKF HP    M + A SL+P
Sbjct  135  GYPLRPGERECTYYIKTGQCKFGATCKFHHPQPANMQIPAQSLAP  179


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 65/115 (57%), Gaps = 8/115 (7%)
 Frame = +3

Query  78   GQLGSVSSAEGQKLTAGSSQVYGTSRAI------ERENVFPERPGQPECQFYMKTGDCKF  239
            GQ GS S    Q+ T GS Q  G    +      E E+ +PERP + +C +Y++TG C +
Sbjct  7    GQEGSQSDP-AQEWT-GSGQETGLEEGVWQLEIGETESEYPERPNEQDCMYYLRTGFCGY  64

Query  240  GSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            G+ CR++HPR+R              P R G+P+C +Y R G CKFG SCK++HP
Sbjct  65   GARCRYNHPRDRTAVLGAARAGGGEFPERVGQPLCQYYMRTGTCKFGASCKYNHP  119



>ref|XP_008389190.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Malus domestica]
Length=386

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 101/174 (58%), Gaps = 25/174 (14%)
 Frame = +3

Query  18   NYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGT---------------  149
             Y P+++P G+V + G++ YS  L  V S  G + T G++ +YG                
Sbjct  127  TYGPVLIPPGVVPIQGWSPYSAPLSPVPS-PGAQPTVGATSLYGVTQLXSPXHGLASPYT  185

Query  150  --------SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
                    S +   E VFPERPG+ EC++Y+KTGDCK+G  CR+HHPR+R +P   C+LS
Sbjct  186  SIPSSVGPSSSNXXEQVFPERPGELECZYYLKTGDCKYGPSCRYHHPRDRTVPRITCLLS  245

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            P+GLPLRPG   C FY + G CKFG +CKFDHP+    Y LS S   D P  Q+
Sbjct  246  PMGLPLRPGVQPCTFYLQNGQCKFGSTCKFDHPVQTMRYDLSASSLVDMPVVQY  299



>gb|KHG04581.1| hypothetical protein F383_30084 [Gossypium arboreum]
Length=365

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 100/158 (63%), Gaps = 23/158 (15%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGT-----------------  149
            Y P++   G+V +PG+++     S   + G +  AG++ +YG                  
Sbjct  207  YGPVLFSPGVVPIPGWSHYLAPVSPVLSPGAQPAAGATSLYGLTHLSSSTPSLAGPYSSL  266

Query  150  ------SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
                  SR+ ++E+ FPERPG+PECQ+Y++TGDCKFGS CR+HHPR+R++P  +C+LSP+
Sbjct  267  PSSTGLSRSNQKEHTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDRVVPQTNCVLSPM  326

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYS  425
            GLPLRPG   C FY + G CKFG +CKFDHP+G   +S
Sbjct  327  GLPLRPGVQPCAFYLQNGHCKFGSTCKFDHPVGTMRFS  364


 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 3/77 (4%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P   FY+KTG CKFG+ C+FHHP++         L+  G PLRPGE  C +Y 
Sbjct  90   YPERPGEP---FYLKTGTCKFGASCKFHHPKDGGGSFSHVSLNMHGYPLRPGEKECSYYL  146

Query  357  RYGICKFGPSCKFDHPM  407
            + G CKFG +CKF HP 
Sbjct  147  KTGQCKFGITCKFHHPQ  163


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 7/84 (8%)
 Frame = +3

Query  153  RAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPG  332
            R +E    +PER G  +C +YM+TG C +G+ CR++HPR R         +    P RPG
Sbjct  40   RGVES---YPERLGVTDCVYYMRTGFCGYGNSCRYNHPRNRAAVEAAVRATGE-YPERPG  95

Query  333  EPICIFYSRYGICKFGPSCKFDHP  404
            EP   FY + G CKFG SCKF HP
Sbjct  96   EP---FYLKTGTCKFGASCKFHHP  116



>ref|XP_008235007.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Prunus 
mume]
Length=472

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 104/171 (61%), Gaps = 25/171 (15%)
 Frame = +3

Query  18   NYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR------AIER---  167
             Y P+++  G+V + G++ YS  L  V S  G + T G++ +YG ++       + R   
Sbjct  213  TYGPVLISPGVVPIQGWSPYSAPLSPVLSP-GAQPTVGATSLYGVTQLSSPTHGLARPYT  271

Query  168  --------------ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
                          E VFPERPG+PECQ+Y+KTGDCK+G  CR+HHPR+R++P  +C+LS
Sbjct  272  SVPSAVGPSSSSPSEQVFPERPGEPECQYYLKTGDCKYGPSCRYHHPRDRVVPRTNCLLS  331

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPA  458
            PIGLPLRPG   C FY + G CKFG +CKFDHP+G   Y+ S S   D P 
Sbjct  332  PIGLPLRPGVQPCTFYLQNGHCKFGSTCKFDHPIGTMRYNPSASSLVDMPV  382


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER G+P CQ+Y+KTG CKFG+ C+FHHP+          L+  GLPLRPGE  C +Y 
Sbjct  86   YPERVGEPICQYYLKTGTCKFGASCKFHHPKHGGGSLSRAPLNIYGLPLRPGENECSYYL  145

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  146  KTGQCKFGITCKFHHP  161


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
             +     +PERPG P C +YM+TG C +G  CR++HPR+R         +    P R GE
Sbjct  34   GLTSSESYPERPGVPNCVYYMRTGFCGYGIRCRYNHPRDRAAVVAAVRAT-GDYPERVGE  92

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            PIC +Y + G CKFG SCKF HP
Sbjct  93   PICQYYLKTGTCKFGASCKFHHP  115



>ref|NP_001042632.2| Os01g0257400 [Oryza sativa Japonica Group]
 sp|Q5NAV3.1|C3H5_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 5; Short=OsC3H5; 
AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 3 [Oryza sativa Japonica Group]
 dbj|BAD81393.1| putative floral homeotic protein HUA1 [Oryza sativa Japonica 
Group]
 dbj|BAG93710.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04546.2| Os01g0257400 [Oryza sativa Japonica Group]
Length=466

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 104/170 (61%), Gaps = 24/170 (14%)
 Frame = +3

Query  18   NYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEG-QKLTAG-----------SSQVYGTSRA  158
            +Y P+M+P  +V + G+  Y   +  V+SA G Q + AG           ++  YG+  A
Sbjct  219  SYPPMMLPSTVVPMQGWNPYISPVNQVASAGGHQTVQAGPFYGLSHQGPSAAVTYGSQYA  278

Query  159  -----------IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLS  305
                        ++E  FP RPGQPECQ+Y+KTG CKFGS C++HHP+    P  +CMLS
Sbjct  279  PLSSSTMPSSSSKQEPAFPARPGQPECQYYLKTGSCKFGSACKYHHPQYLNTPKSNCMLS  338

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAP  455
            P+GLPLRPG   C +Y+++G CKFGP+CKFDHPMG  +YS S S  TD P
Sbjct  339  PLGLPLRPGSQPCAYYTQHGFCKFGPTCKFDHPMGTLSYSPSASSITDLP  388


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPGQP C++YMK G CKFGS C++ HPRE  +     ML+  G PLR GE  C +Y 
Sbjct  98   YPERPGQPVCEYYMKNGTCKFGSNCKYDHPREGSV--QAVMLNSSGYPLRSGEKDCTYYV  155

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  156  KTGHCKFGSTCKFHHP  171


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 10/83 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-------LPLRPGE  335
             PERPG+ +C +Y++TG C +G  CR++HPR+R       +L+  G        P RPG+
Sbjct  48   LPERPGEADCVYYLRTGACGYGENCRYNHPRDRAA---AAVLNGGGKTTHSAEYPERPGQ  104

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            P+C +Y + G CKFG +CK+DHP
Sbjct  105  PVCEYYMKNGTCKFGSNCKYDHP  127



>ref|XP_010545037.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X1 [Tarenaya hassleriana]
Length=469

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 103/173 (60%), Gaps = 25/173 (14%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------------  155
            Y P+++  G+V +PG+  YSG +  V S  G +   G++ +YG ++              
Sbjct  215  YGPMLLTPGVVPIPGWNPYSGPVSPVLSP-GAQHAVGATSLYGVTQLSSSTPSLAGAYPS  273

Query  156  ---------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP  308
                       ++E +FPERPG+PECQ+Y++TGDCKFG  C+FHH R+R+    +C+LSP
Sbjct  274  LSSSTAPSVGSQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHRRDRIPQRANCILSP  333

Query  309  IGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            IGLPLRPG   C FY + G C+FG +CKFDHPMG   Y+ S S   DAP   +
Sbjct  334  IGLPLRPGVQPCTFYLQNGFCRFGSTCKFDHPMGTLRYNPSASSLVDAPVAPY  386


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 3/83 (4%)
 Frame = +3

Query  159  IERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGE  335
            +     +PERPG P+C +YM+TG C +GS CR++HPR+R +   +  +   G  P R GE
Sbjct  39   LSSSETYPERPGAPDCAYYMRTGICGYGSRCRYNHPRDRAV--VEAAVRATGEYPERVGE  96

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            P C FY + G CKFG SCKF HP
Sbjct  97   PPCQFYLKTGTCKFGASCKFHHP  119


 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A+     +PER G+P CQFY+KTG CKFG+ C+FHHP+          L+  G PLR  E
Sbjct  83   AVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREAE  142

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C  Y + G CKFG +CKF HP
Sbjct  143  KECSHYLKTGQCKFGVTCKFHHP  165



>gb|AGT16494.1| zinc finger CCCH type domain-containing protein [Saccharum hybrid 
cultivar R570]
Length=448

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 108/176 (61%), Gaps = 24/176 (14%)
 Frame = +3

Query  12   PSNYSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQK------------------LTAGS-  131
            P +Y P+M+P  ++ + G+  Y   +  V+ A GQ+                  +T GS 
Sbjct  205  PGSYPPMMLPPTVMPMQGWNPYVSPMNQVTPAGGQQAVPAAASYGLSHQGPTSAVTYGSH  264

Query  132  -SQVY---GTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCM  299
             +Q+Y   GTS +  +E  FPERPGQPEC+ YMKTG CK+G+VC++HHP+    P  +C+
Sbjct  265  YAQLYSSTGTSSSNIQEYAFPERPGQPECEHYMKTGTCKYGAVCKYHHPQYFSGPKSNCI  324

Query  300  LSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            LSP+GLPLRPG   C +Y+ +G CKFGP+CKFDHPMG   YS+S S  TD P   +
Sbjct  325  LSPLGLPLRPGSQPCAYYAHHGFCKFGPTCKFDHPMGTPNYSISASSLTDVPVAPY  380


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 50/76 (66%), Gaps = 2/76 (3%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPGQP C++Y K G CKFGS C+F HPRE    P    L+  G PLR GE  C +Y 
Sbjct  86   YPERPGQPLCEYYAKNGTCKFGSNCKFDHPREGGFVP--VTLNSSGFPLRLGEKECSYYM  143

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  144  KTGHCKFGATCKFHHP  159


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP--IGLPLRPGEPI  341
            E   PERPG+ +C +Y++TG C +G  CR++HPR+R  P      +   +  P RPG+P+
Sbjct  35   EEKLPERPGEADCAYYLRTGACGYGERCRYNHPRDRPAPVNGVGKTAGMVEYPERPGQPL  94

Query  342  CIFYSRYGICKFGPSCKFDHP  404
            C +Y++ G CKFG +CKFDHP
Sbjct  95   CEYYAKNGTCKFGSNCKFDHP  115


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            FP R G+ EC +YMKTG CKFG+ C+FHHP    +     M  P+
Sbjct  130  FPLRLGEKECSYYMKTGHCKFGATCKFHHPELGFLTETPGMYPPV  174



>ref|XP_010545038.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X2 [Tarenaya hassleriana]
Length=463

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 103/173 (60%), Gaps = 25/173 (14%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------------  155
            Y P+++  G+V +PG+  YSG +  V S  G +   G++ +YG ++              
Sbjct  209  YGPMLLTPGVVPIPGWNPYSGPVSPVLS-PGAQHAVGATSLYGVTQLSSSTPSLAGAYPS  267

Query  156  ---------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP  308
                       ++E +FPERPG+PECQ+Y++TGDCKFG  C+FHH R+R+    +C+LSP
Sbjct  268  LSSSTAPSVGSQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHRRDRIPQRANCILSP  327

Query  309  IGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            IGLPLRPG   C FY + G C+FG +CKFDHPMG   Y+ S S   DAP   +
Sbjct  328  IGLPLRPGVQPCTFYLQNGFCRFGSTCKFDHPMGTLRYNPSASSLVDAPVAPY  380


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 4/111 (4%)
 Frame = +3

Query  78   GQLGSVSSAEGQKLTAGSSQVYGTS-RAIERENVFPERPGQPECQFYMKTGDCKFGSVCR  254
            G+  ++S A+  +    SS+   T    +     +PERPG P+C +YM+TG C +GS CR
Sbjct  5    GRSQAMSGAQSGQAPEWSSEGADTGLEGLSSSETYPERPGAPDCAYYMRTGICGYGSRCR  64

Query  255  FHHPRERLIPPPDCMLSPIG-LPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            ++HPR+R +   +  +   G  P R GEP C FY + G CKFG SCKF HP
Sbjct  65   YNHPRDRAV--VEAAVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHP  113


 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            A+     +PER G+P CQFY+KTG CKFG+ C+FHHP+          L+  G PLR  E
Sbjct  77   AVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREAE  136

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
              C  Y + G CKFG +CKF HP
Sbjct  137  KECSHYLKTGQCKFGVTCKFHHP  159



>ref|XP_006829498.1| hypothetical protein AMTR_s00074p00109750 [Amborella trichopoda]
 gb|ERM96914.1| hypothetical protein AMTR_s00074p00109750 [Amborella trichopoda]
Length=201

 Score =   135 bits (341),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  165  RENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPIC  344
            +  +FPERP QPECQ+YMKTGDCKFG+ C++HHP ER +P  +C L P+GLPLRPG+P+C
Sbjct  49   QNGLFPERPDQPECQYYMKTGDCKFGASCKYHHPLERAMPLTNCALGPLGLPLRPGQPLC  108

Query  345  IFYSRYGICKFGPSCKFDH  401
             FYS+YGICKFGP+CKFDH
Sbjct  109  TFYSKYGICKFGPTCKFDH  127



>gb|KHG22563.1| hypothetical protein F383_29382 [Gossypium arboreum]
Length=475

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 102/172 (59%), Gaps = 23/172 (13%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGT-----------------  149
            Y P++   G+V +PG+++     S   + G +   G++ +YG                  
Sbjct  218  YGPVLFSPGVVPIPGWSHYSAPVSPVLSPGAQPAVGATSLYGLTQLSSSTPSLAGPYPSL  277

Query  150  ------SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
                  S + +++  FPERPG+PECQ+Y++TGDCKFGS CR+HHPR+R++P  +C+LSP+
Sbjct  278  PSSTGPSSSNQKDQTFPERPGEPECQYYLRTGDCKFGSTCRYHHPRDRVVPRTNCILSPM  337

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            GLPLRPG   C FY + G CKFG +CKFDHP+G   Y+ S S   D P   +
Sbjct  338  GLPLRPGVQPCSFYLQNGHCKFGSTCKFDHPVGAMRYNPSASSFIDMPVAPY  389


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P CQFY+KTG CKFG+ C+FHHP+          L+  G PLRPGE  C +Y 
Sbjct  90   YPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSQVPLNIYGYPLRPGEEECSYYL  149

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  150  KMGQCKFGVTCKFHHP  165


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 57/104 (55%), Gaps = 12/104 (12%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            ++     +PERPG P+C +YM+TG C +GS CR++HPR R         +    P RPGE
Sbjct  38   SLRGAESYPERPGVPDCVYYMRTGLCGYGSRCRYNHPRNRAAVEAAVRAT-GEYPERPGE  96

Query  336  PICIFYSRYGICKFGPSCKFDH-----------PMGVFAYSLSP  434
            P C FY + G CKFG SCKF H           P+ ++ Y L P
Sbjct  97   PACQFYLKTGTCKFGASCKFHHPKHGGGSFSQVPLNIYGYPLRP  140


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            +P RPG+ EC +Y+K G CKFG  C+FHHP+
Sbjct  136  YPLRPGEEECSYYLKMGQCKFGVTCKFHHPQ  166



>ref|XP_010241841.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Nelumbo nucifera]
Length=475

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 107/173 (62%), Gaps = 25/173 (14%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYA-YSGQLGSVSSAEGQKLTAGSSQVYGTSR--------------  155
            Y  +++  GMVSVPG++ Y   +  V+S  G + T G   +YG ++              
Sbjct  218  YGHVLLSPGMVSVPGWSPYPAPVSPVASP-GTQPTVGGGPLYGVTQLSPSAPAYAGPYPP  276

Query  156  ---------AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSP  308
                     + ++E+V+PERPG PECQ+YM+TG+CKFGS C++HHP E + P  +C+LSP
Sbjct  277  LPSSAGPSSSSQKEHVYPERPGHPECQYYMRTGECKFGSSCKYHHPPEWITPKTNCILSP  336

Query  309  IGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            IGLPLR G   C FY++YGICKFGP+CKFDHPMG  +YS S S   D P   +
Sbjct  337  IGLPLRSGASPCAFYTQYGICKFGPTCKFDHPMGSLSYSPSASSLADMPVAPY  389


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 2/91 (2%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            S V G++R    E  +PER GQP CQ++MKTG CKFG+ C++HHPR          L+  
Sbjct  78   SAVLGSARPGGVE--YPERVGQPVCQYFMKTGTCKFGASCKYHHPRHGGGSVSPVSLNYH  135

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
            G PLRPGE  C +Y + G CKFG +CKF HP
Sbjct  136  GYPLRPGEKECSYYVKTGQCKFGVTCKFHHP  166


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
             +   + +PERP +P+C +YM+TG C +G+ CR++HPR+R           +  P R G+
Sbjct  38   GLVSRDSYPERPNEPDCVYYMRTGFCGYGARCRYNHPRDRSAVLGSARPGGVEYPERVGQ  97

Query  336  PICIFYSRYGICKFGPSCKFDHP  404
            P+C ++ + G CKFG SCK+ HP
Sbjct  98   PVCQYFMKTGTCKFGASCKYHHP  120



>ref|XP_006380188.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
 gb|ERP57985.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
Length=477

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  144  GTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPL  323
            G S + ++E++FPERPGQPECQ+Y+KTGDCKF S CR+HHP E ++   + +LSPIGLPL
Sbjct  287  GPSSSTQKEHLFPERPGQPECQYYIKTGDCKFRSSCRYHHPPELVVSKSNVVLSPIGLPL  346

Query  324  RPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            RPG P C  Y++ G CKFGP+CKFDHPMG  +YS S S   D P   +
Sbjct  347  RPGAPTCSHYTQRGQCKFGPACKFDHPMGTLSYSPSASSLADMPVAPY  394


 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 66/105 (63%), Gaps = 6/105 (6%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            + V G +RA   E  +PER GQP CQ+YM+TG CKFG+ C++HHP++         L+  
Sbjct  77   NAVLGAARAGGAE--YPERAGQPLCQYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYY  134

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP----MGVFAYSLSP  434
            G PLRPGE  C +Y + G CKFG +CKF HP    + + A SL+P
Sbjct  135  GYPLRPGERECTYYIKTGQCKFGATCKFHHPQPGNIQIPAQSLAP  179


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +3

Query  162  ERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPI  341
            E E+ +PER  + +C +Y++TG C +G+ CR++HPR+R              P R G+P+
Sbjct  39   ETESEYPERSNEQDCMYYLRTGFCGYGARCRYNHPRDRNAVLGAARAGGAEYPERAGQPL  98

Query  342  CIFYSRYGICKFGPSCKFDHP  404
            C +Y R G CKFG SCK+ HP
Sbjct  99   CQYYMRTGTCKFGASCKYHHP  119



>ref|XP_011018690.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=479

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = +3

Query  144  GTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPL  323
            G S + ++E++FPERPGQPECQ+Y+KTGDCKF S CR+HHP E ++   + +LSPIGLPL
Sbjct  287  GPSSSTQKEHLFPERPGQPECQYYIKTGDCKFRSSCRYHHPPELVVSKTNVVLSPIGLPL  346

Query  324  RPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            RPG P C  Y++ G CKFGP+CKFDHPMG  +YS S S   D P   +
Sbjct  347  RPGAPTCSHYTQRGQCKFGPACKFDHPMGTLSYSPSASSLADMPVAPY  394


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 65/105 (62%), Gaps = 6/105 (6%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
            S V G  RA   E  +PER GQP CQ+YM+TG CKFG+ C++HHP++         L+  
Sbjct  77   SAVLGAPRAGGAE--YPERVGQPLCQYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYY  134

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHP----MGVFAYSLSP  434
            G PLRPGE  C +Y + G CKFG +CKF HP    + + A SL+P
Sbjct  135  GYPLRPGERECTYYIKTGQCKFGATCKFHHPQPGNIQIPAQSLAP  179


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +3

Query  162  ERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPI  341
            E E+V+PERP + +C +Y++TG C +G+ CR++HPR+R              P R G+P+
Sbjct  39   ETESVYPERPNEQDCMYYLRTGWCGYGARCRYNHPRDRSAVLGAPRAGGAEYPERVGQPL  98

Query  342  CIFYSRYGICKFGPSCKFDHP  404
            C +Y R G CKFG SCK+ HP
Sbjct  99   CQYYMRTGTCKFGASCKYHHP  119



>gb|KHF99697.1| hypothetical protein F383_18975 [Gossypium arboreum]
Length=470

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 93/158 (59%), Gaps = 4/158 (3%)
 Frame = +3

Query  6    QGPSNYSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQV----YGTSRAIEREN  173
            QG  +++P   P G  + P    S   G+   +       GS Q     +  S  I+ E 
Sbjct  228  QGVPSWNPYPGPVGYGTQPTVPSSSTFGATPLSPSATAYTGSHQFVPSSFEPSSNIQEEV  287

Query  174  VFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFY  353
             FPERPGQPECQ+YMKTG CK+GS CR+HHP E   P  D +LSP+GLPLRPG P C  Y
Sbjct  288  SFPERPGQPECQYYMKTGRCKYGSSCRYHHPPEVFAPKADVILSPLGLPLRPGAPTCTHY  347

Query  354  SRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            ++ G+CKFG +C+FDHPMG  +YS S S   D P   +
Sbjct  348  TQRGMCKFGAACRFDHPMGTLSYSPSASSLADMPVAPY  385


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PER GQP CQ+YM+TG CKFG+ C++HHP++         L+  G PLRPGE  C +Y 
Sbjct  84   YPERAGQPVCQYYMRTGACKFGASCKYHHPKQGGGSVSSVPLNYYGYPLRPGEKECSYYV  143

Query  357  RYGICKFGPSCKFDHPMGVFAYSLSPSPS  443
            + G CKFG +CKF HP        +PSP+
Sbjct  144  KTGQCKFGTTCKFHHPAPPAMQVPAPSPA  172


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 8/80 (10%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG----LPLRPGEPIC  344
            +PERP + +C +Y++TG C +GS CRF+HPR+R       M +  G     P R G+P+C
Sbjct  38   YPERPDEADCIYYLRTGFCGYGSKCRFNHPRDRA----GVMGAGRGGVGEYPERAGQPVC  93

Query  345  IFYSRYGICKFGPSCKFDHP  404
             +Y R G CKFG SCK+ HP
Sbjct  94   QYYMRTGACKFGASCKYHHP  113



>gb|KHG21967.1| hypothetical protein F383_08187 [Gossypium arboreum]
Length=432

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 102/172 (59%), Gaps = 23/172 (13%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGT-----------------  149
            Y P++   G+V +PG+++     S + + G +   G++ +YG                  
Sbjct  179  YGPVLFSPGVVPIPGWSHYSAPVSPALSPGAQPAVGATSLYGLTQLSSSAPSLAGPYSSL  238

Query  150  ------SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
                  S + ++E  FPERPG+PECQ+Y++TG+CKFGS CR+HHPR++++   +C+LSP+
Sbjct  239  PSSTGPSSSNQKEQTFPERPGEPECQYYLRTGNCKFGSSCRYHHPRDKVVQQTNCILSPM  298

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            GLPLRPG   C FY + G CKFG +CKFDHP+G   YS S S   D P   +
Sbjct  299  GLPLRPGVQPCAFYLQNGHCKFGSTCKFDHPIGTMRYSPSASSLIDIPVAPY  350


 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 7/89 (8%)
 Frame = +3

Query  156  AIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGE  335
            ++     +PERPG P+C +YM+TG C +G+ CR++HPR R         +    P RPGE
Sbjct  39   SLRGTESYPERPGVPDCVYYMRTGFCGYGNRCRYNHPRNRAAVEAAVRAT-GEYPERPGE  97

Query  336  PI------CIFYSRYGICKFGPSCKFDHP  404
            P       C +Y + G CKFG +CKF HP
Sbjct  98   PACQGEKECSYYLKTGQCKFGVTCKFHHP  126


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 6/37 (16%)
 Frame = +3

Query  177  FPERPGQP------ECQFYMKTGDCKFGSVCRFHHPR  269
            +PERPG+P      EC +Y+KTG CKFG  C+FHHP+
Sbjct  91   YPERPGEPACQGEKECSYYLKTGQCKFGVTCKFHHPQ  127



>ref|XP_009142498.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Brassica rapa]
Length=456

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +3

Query  87   GSVSSAEGQKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHP  266
            G+ S     +L++ +  VY +     +E  FPERPG+PECQ+Y+KTGDCKFG+ C+FHHP
Sbjct  255  GAASLYGVTQLSSTTPGVYPSGVVTLKEESFPERPGEPECQYYLKTGDCKFGTSCKFHHP  314

Query  267  RERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPST  446
            R+R+ P P+C LS IGLPLRPG   C FY + G CKFG +CKFDHP+G   Y+ S S   
Sbjct  315  RDRVPPRPNCDLSSIGLPLRPGVQRCSFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLA  374

Query  447  DAPAGQF  467
            DAP   +
Sbjct  375  DAPVAPY  381


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI--PPPDCMLS  305
            + V  T RA  +   +PER G   CQFY+KTG CKFG+ C+F+HPR            L+
Sbjct  81   ASVEATVRATGQ---YPERIGALPCQFYLKTGTCKFGASCKFNHPRNAAAGGSMTHVPLN  137

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
              G P+R GE  C ++ + G CKFG +CKF HP
Sbjct  138  IYGYPVRQGENECSYFLKTGQCKFGITCKFHHP  170


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPIC  344
               +P+R G P+C +YM+TG C +GS CRF+HP +R     +  +   G  P R G   C
Sbjct  45   SETYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDRAS--VEATVRATGQYPERIGALPC  102

Query  345  IFYSRYGICKFGPSCKFDHPMGVFA  419
             FY + G CKFG SCKF+HP    A
Sbjct  103  QFYLKTGTCKFGASCKFNHPRNAAA  127



>emb|CDX80137.1| BnaA05g00190D [Brassica napus]
Length=456

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +3

Query  87   GSVSSAEGQKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHP  266
            G+ S     +L++ +  VY +     +E  FPERPG+PECQ+Y+KTGDCKFG+ C+FHHP
Sbjct  255  GAASLYGVTQLSSTTPGVYPSGVVTLKEESFPERPGEPECQYYLKTGDCKFGTSCKFHHP  314

Query  267  RERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPST  446
            R+R+ P P+C LS IGLPLRPG   C FY + G CKFG +CKFDHP+G   Y+ S S   
Sbjct  315  RDRVPPRPNCDLSSIGLPLRPGVQRCSFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLA  374

Query  447  DAPAGQF  467
            DAP   +
Sbjct  375  DAPVAPY  381


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI--PPPDCMLS  305
            + V  T RA  +   +PER G   CQFY+KTG CKFG+ C+F+HPR            L+
Sbjct  81   ASVEATVRATGQ---YPERMGALPCQFYLKTGTCKFGASCKFNHPRNAAAGGSMTHVPLN  137

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
              G P+R GE  C ++ + G CKFG +CKF HP
Sbjct  138  IYGYPVRQGENECSYFLKTGQCKFGITCKFHHP  170


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPIC  344
               +P+R G P+C +YM+TG C +GS CRF+HP +R     +  +   G  P R G   C
Sbjct  45   SETYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDRAS--VEATVRATGQYPERMGALPC  102

Query  345  IFYSRYGICKFGPSCKFDHPMGVFA  419
             FY + G CKFG SCKF+HP    A
Sbjct  103  QFYLKTGTCKFGASCKFNHPRNAAA  127



>ref|XP_009142499.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Brassica rapa]
Length=455

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +3

Query  87   GSVSSAEGQKLTAGSSQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHP  266
            G+ S     +L++ +  VY +     +E  FPERPG+PECQ+Y+KTGDCKFG+ C+FHHP
Sbjct  254  GAASLYGVTQLSSTTPGVYPSGVVTLKEESFPERPGEPECQYYLKTGDCKFGTSCKFHHP  313

Query  267  RERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPST  446
            R+R+ P P+C LS IGLPLRPG   C FY + G CKFG +CKFDHP+G   Y+ S S   
Sbjct  314  RDRVPPRPNCDLSSIGLPLRPGVQRCSFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLA  373

Query  447  DAPAGQF  467
            DAP   +
Sbjct  374  DAPVAPY  380


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLI--PPPDCMLS  305
            + V  T RA  +   +PER G   CQFY+KTG CKFG+ C+F+HPR            L+
Sbjct  80   ASVEATVRATGQ---YPERIGALPCQFYLKTGTCKFGASCKFNHPRNAAAGGSMTHVPLN  136

Query  306  PIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
              G P+R GE  C ++ + G CKFG +CKF HP
Sbjct  137  IYGYPVRQGENECSYFLKTGQCKFGITCKFHHP  169


 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPIC  344
               +P+R G P+C +YM+TG C +GS CRF+HP +R     +  +   G  P R G   C
Sbjct  44   SETYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDRAS--VEATVRATGQYPERIGALPC  101

Query  345  IFYSRYGICKFGPSCKFDHPMGVFA  419
             FY + G CKFG SCKF+HP    A
Sbjct  102  QFYLKTGTCKFGASCKFNHPRNAAA  126



>emb|CDY53022.1| BnaC04g00080D [Brassica napus]
Length=458

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 93/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGTSRAIERENVFPERPGQP  200
            ++P   P      PG  ++  L  V+     +L++ +  VY +     +E  FPERP +P
Sbjct  237  WNPYSAPVSPALSPGAQHAASLYGVT-----QLSSTTPGVYPSGVVTLKEESFPERPAEP  291

Query  201  ECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYSRYGICKFG  380
            ECQ+Y+KTGDCKFG+ C+FHHPR+R+ P P+C LS +GLPLRPG   C FY + G CKFG
Sbjct  292  ECQYYLKTGDCKFGTSCKFHHPRDRVPPRPNCDLSSVGLPLRPGVQRCTFYVQNGFCKFG  351

Query  381  PSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
             +CKFDHP+G   Y+ S S   DAP   +
Sbjct  352  STCKFDHPVGTIRYNPSASSLADAPVAPY  380


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 56/97 (58%), Gaps = 14/97 (14%)
 Frame = +3

Query  132  SQVYGTSRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERL------IPPPD  293
            + V  T RA  +   +PER G   CQFY+KTG CKFG+ C+F+HPR         +P   
Sbjct  81   ASVEATVRATGQ---YPERLGALPCQFYLKTGTCKFGASCKFNHPRNAAGGSMTHVP---  134

Query  294  CMLSPIGLPLRPGEPICIFYSRYGICKFGPSCKFDHP  404
              L+  G P+R GE  C ++ + G CKFG +CKF HP
Sbjct  135  --LNIYGYPVRQGENECSYFLKTGQCKFGITCKFHHP  169


 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 3/92 (3%)
 Frame = +3

Query  168  ENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIG-LPLRPGEPIC  344
               +P+R G P+C +YM+TG C +GS CRF+HP +R     +  +   G  P R G   C
Sbjct  45   SEAYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDRAS--VEATVRATGQYPERLGALPC  102

Query  345  IFYSRYGICKFGPSCKFDHPMGVFAYSLSPSP  440
             FY + G CKFG SCKF+HP      S++  P
Sbjct  103  QFYLKTGTCKFGASCKFNHPRNAAGGSMTHVP  134



>gb|KJB47069.1| hypothetical protein B456_008G009500 [Gossypium raimondii]
Length=475

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 102/172 (59%), Gaps = 23/172 (13%)
 Frame = +3

Query  21   YSPLMVPQGMVSVPGYAYSGQLGSVSSAEGQKLTAGSSQVYGT-----------------  149
            Y P++   G+V +PG+++     S   + G +   G++ +YG                  
Sbjct  218  YGPVLFSPGVVPIPGWSHYSAPVSPVLSPGAQPGVGATSLYGLTQLSSSTPSLAGPYPSL  277

Query  150  ------SRAIERENVFPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPI  311
                  S + +++  FPERPG+PECQ+Y++TGDCKFGS CR+HHPR+R++P  +C+LSP+
Sbjct  278  PSSTGPSSSNQKDQTFPERPGEPECQYYLRTGDCKFGSTCRYHHPRDRVVPRTNCILSPM  337

Query  312  GLPLRPGEPICIFYSRYGICKFGPSCKFDHPMGVFAYSLSPSPSTDAPAGQF  467
            GLPLRPG   C FY + G CKFG +CKFDHP+G   Y+ S S   D P   +
Sbjct  338  GLPLRPGVQPCSFYLQNGHCKFGSTCKFDHPVGPMRYNPSASSFIDMPVAPY  389


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG+P CQFY+KTG CKFG+ C+FHHP+          L+  G PLRPGE  C +Y 
Sbjct  90   YPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSHVPLNIYGYPLRPGEEECSYYL  149

Query  357  RYGICKFGPSCKFDHP  404
            + G CKFG +CKF HP
Sbjct  150  KMGQCKFGVTCKFHHP  165


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPICIFYS  356
            +PERPG P+C +YM+TG C +GS CR++HPR R         +    P RPGEP C FY 
Sbjct  45   YPERPGVPDCVYYMRTGLCGYGSRCRYNHPRNRAAVEAAVRAT-GEYPERPGEPACQFYL  103

Query  357  RYGICKFGPSCKFDH-----------PMGVFAYSLSP  434
            + G CKFG SCKF H           P+ ++ Y L P
Sbjct  104  KTGTCKFGASCKFHHPKHGGGSFSHVPLNIYGYPLRP  140


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  177  FPERPGQPECQFYMKTGDCKFGSVCRFHHPR  269
            +P RPG+ EC +Y+K G CKFG  C+FHHP+
Sbjct  136  YPLRPGEEECSYYLKMGQCKFGVTCKFHHPQ  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500