BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN032F09

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF74981.1|AF082891_1  cystathionine gamma-synthase isoform 1        345   6e-113   Solanum tuberosum [potatoes]
ref|NP_001234489.1|  cystathionine gamma synthase                       345   7e-113   Solanum lycopersicum
ref|XP_002529997.1|  cystathionine gamma-synthase, putative             340   2e-112   
gb|KJB11075.1|  hypothetical protein B456_001G240000                    343   4e-112   Gossypium raimondii
gb|KJB11079.1|  hypothetical protein B456_001G240300                    342   6e-112   Gossypium raimondii
pdb|1QGN|A  Chain A, Cystathionine Gamma-Synthase From Nicotiana ...    338   2e-111   Nicotiana tabacum [American tobacco]
gb|KHG00425.1|  Cystathionine gamma-synthase, chloroplastic -like...    341   2e-111   Gossypium arboreum [tree cotton]
gb|KHG14739.1|  Cystathionine gamma-synthase, chloroplastic -like...    341   2e-111   Gossypium arboreum [tree cotton]
gb|AJF83863.1|  cystathionine gamma synthase 1                          340   3e-111   Nicotiana tabacum [American tobacco]
gb|ABK96139.1|  unknown                                                 332   9e-111   Populus trichocarpa [western balsam poplar]
ref|XP_009797245.1|  PREDICTED: cystathionine gamma-synthase, chl...    340   9e-111   Nicotiana sylvestris
ref|XP_009628949.1|  PREDICTED: cystathionine gamma-synthase, chl...    338   1e-110   Nicotiana tomentosiformis
ref|XP_009775845.1|  PREDICTED: cystathionine gamma-synthase, chl...    339   1e-110   Nicotiana sylvestris
ref|XP_011085742.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...    338   2e-110   Sesamum indicum [beniseed]
ref|XP_009602123.1|  PREDICTED: cystathionine gamma-synthase, chl...    340   2e-110   Nicotiana tomentosiformis
emb|CBI22246.3|  unnamed protein product                                336   5e-110   Vitis vinifera
gb|AHM22940.1|  cystathionine gamma synthase                            337   5e-110   Nicotiana tabacum [American tobacco]
gb|AGT40329.1|  cystathionine gamma synthase                            337   9e-110   Nicotiana attenuata
ref|XP_002283866.1|  PREDICTED: cystathionine gamma-synthase, chl...    336   1e-109   Vitis vinifera
ref|XP_011035793.1|  PREDICTED: cystathionine gamma-synthase, chl...    335   4e-109   Populus euphratica
gb|AHL84163.1|  cystathionine gamma synthase                            334   7e-109   Nicotiana tabacum [American tobacco]
ref|XP_002323872.1|  cystathionine gamma synthase family protein        334   1e-108   
ref|XP_009592901.1|  PREDICTED: cystathionine gamma-synthase, chl...    334   1e-108   Nicotiana tomentosiformis
ref|XP_006373333.1|  hypothetical protein POPTR_0017s12240g             334   1e-108   Populus trichocarpa [western balsam poplar]
ref|NP_001275144.1|  cystathionine gamma-synthase isoform 2             333   2e-108   Solanum tuberosum [potatoes]
ref|XP_007032603.1|  Pyridoxal phosphate-dependent transferases s...    333   2e-108   
ref|XP_007032602.1|  Pyridoxal phosphate-dependent transferases s...    333   3e-108   
gb|KJB75684.1|  hypothetical protein B456_012G052100                    332   5e-108   Gossypium raimondii
emb|CDP02254.1|  unnamed protein product                                332   7e-108   Coffea canephora [robusta coffee]
ref|XP_010525099.1|  PREDICTED: cystathionine gamma-synthase, chl...    328   8e-108   Tarenaya hassleriana [spider flower]
dbj|BAP47509.1|  cystathionine gamma-synthase                           332   1e-107   Gentiana triflora
ref|XP_011098654.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...    329   6e-107   Sesamum indicum [beniseed]
ref|XP_010029311.1|  PREDICTED: cystathionine gamma-synthase, chl...    329   2e-106   Eucalyptus grandis [rose gum]
emb|CAA56143.1|  CYS1                                                   317   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482629.1|  PREDICTED: cystathionine gamma-synthase, chl...    327   4e-106   Citrus sinensis [apfelsine]
ref|XP_010550033.1|  PREDICTED: cystathionine gamma-synthase, chl...    327   5e-106   Tarenaya hassleriana [spider flower]
gb|EYU44131.1|  hypothetical protein MIMGU_mgv1a002982mg                329   5e-106   Erythranthe guttata [common monkey flower]
gb|KDP27172.1|  hypothetical protein JCGZ_19871                         327   9e-106   Jatropha curcas
ref|XP_010670238.1|  PREDICTED: cystathionine gamma-synthase, chl...    325   3e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007216002.1|  hypothetical protein PRUPE_ppa004232mg             324   4e-105   Prunus persica
ref|XP_008230796.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...    323   7e-105   
ref|XP_006297283.1|  hypothetical protein CARUB_v10013298mg             325   8e-105   
emb|CDY43269.1|  BnaC05g48620D                                          322   1e-104   Brassica napus [oilseed rape]
ref|XP_006408463.1|  hypothetical protein EUTSA_v10020394mg             323   3e-104   Eutrema salsugineum [saltwater cress]
emb|CDY37543.1|  BnaA05g34080D                                          322   3e-104   Brassica napus [oilseed rape]
ref|XP_010463584.1|  PREDICTED: cystathionine gamma-synthase, chl...    323   3e-104   Camelina sativa [gold-of-pleasure]
ref|XP_009147397.1|  PREDICTED: cystathionine gamma-synthase, chl...    322   4e-104   Brassica rapa
ref|XP_010429549.1|  PREDICTED: cystathionine gamma-synthase, chl...    323   5e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006431203.1|  hypothetical protein CICLE_v10011434mg             322   5e-104   
ref|XP_006431204.1|  hypothetical protein CICLE_v10011434mg             322   6e-104   Citrus clementina [clementine]
gb|KHN13598.1|  Cystathionine gamma-synthase, chloroplastic             317   8e-104   Glycine soja [wild soybean]
ref|NP_186761.1|  cystathionine gamma-synthase                          322   8e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CAA64383.1|  cystathionine gamma-synthase                           322   9e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485423.1|  PREDICTED: cystathionine gamma-synthase, chl...    321   2e-103   Camelina sativa [gold-of-pleasure]
gb|KCW56210.1|  hypothetical protein EUGRSUZ_I01959                     321   2e-103   Eucalyptus grandis [rose gum]
gb|KHN11627.1|  Cystathionine gamma-synthase, chloroplastic             313   2e-103   Glycine soja [wild soybean]
gb|AAM13883.1|  putative cystathionine gamma-synthase                   320   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008368433.1|  PREDICTED: cystathionine gamma-synthase, chl...    319   4e-103   
gb|AAC49574.1|  similar to the metB gene product of Escherichia c...    320   6e-103   Arabidopsis thaliana [mouse-ear cress]
gb|EYU34642.1|  hypothetical protein MIMGU_mgv1a004543mg                318   7e-103   Erythranthe guttata [common monkey flower]
ref|XP_009360603.1|  PREDICTED: cystathionine gamma-synthase, chl...    318   8e-103   Pyrus x bretschneideri [bai li]
ref|XP_002882199.1|  hypothetical protein ARALYDRAFT_477417             319   9e-103   
gb|AAC25687.1|  cystathionine gamma-synthase precursor                  319   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003552541.1|  PREDICTED: cystathionine gamma-synthase, chl...    318   1e-102   
gb|AAC19395.1|  cystathionine gamma-synthase                            318   1e-102   Mesembryanthemum crystallinum
emb|CDX91962.1|  BnaC03g32640D                                          315   5e-102   
emb|CDX74285.1|  BnaA03g27620D                                          316   8e-102   
ref|XP_009134628.1|  PREDICTED: cystathionine gamma-synthase, chl...    316   9e-102   Brassica rapa
ref|NP_001237572.1|  cystathionine-gamma-synthase precursor             315   2e-101   
ref|XP_008443381.1|  PREDICTED: cystathionine gamma-synthase, chl...    315   2e-101   Cucumis melo [Oriental melon]
ref|XP_004136690.1|  PREDICTED: cystathionine gamma-synthase, chl...    315   3e-101   Cucumis sativus [cucumbers]
ref|XP_010258325.1|  PREDICTED: cystathionine gamma-synthase, chl...    315   3e-101   Nelumbo nucifera [Indian lotus]
ref|XP_007139535.1|  hypothetical protein PHAVU_008G038100g             313   2e-100   Phaseolus vulgaris [French bean]
ref|NP_001266947.1|  cystathionine gamma-synthase, chloroplastic-...    313   2e-100   Fragaria vesca [alpine strawberry]
gb|AGF95116.1|  cystathionine gamma synthase                            298   5e-100   Prunus persica
ref|NP_001265950.1|  cystathionine gamma-synthase, chloroplastic-...    310   1e-99    Cicer arietinum [garbanzo]
ref|XP_006858075.1|  hypothetical protein AMTR_s00062p00067400          310   2e-99    Amborella trichopoda
ref|XP_010937206.1|  PREDICTED: cystathionine gamma-synthase, chl...    308   2e-98    Elaeis guineensis
ref|XP_010939832.1|  PREDICTED: cystathionine gamma-synthase, chl...    306   4e-98    Elaeis guineensis
ref|XP_010495203.1|  PREDICTED: cystathionine gamma-synthase, chl...    303   4e-98    
gb|ABI34092.1|  cystathionine gamma-synthase                            306   5e-98    Medicago sativa [alfalfa]
ref|XP_010453667.1|  PREDICTED: cystathionine gamma-synthase, chl...    305   8e-98    
ref|XP_003621272.1|  Cystathionine gamma-synthase                       304   3e-97    Medicago truncatula
gb|AGA60137.1|  cystathionine gamma-synthase                            304   3e-97    Lens culinaris
ref|NP_001274915.1|  cystathionine-gamma-synthase                       304   1e-96    
ref|XP_009409044.1|  PREDICTED: cystathionine gamma-synthase, chl...    301   4e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010424106.1|  PREDICTED: cystathionine gamma-synthase, chl...    296   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006400053.1|  hypothetical protein EUTSA_v10015332mg             296   2e-95    
emb|CDX90997.1|  BnaC02g06000D                                          297   5e-95    
emb|CDX69530.1|  BnaA10g18790D                                          293   7e-95    
ref|XP_009122874.1|  PREDICTED: cystathionine gamma-synthase, chl...    292   9e-94    
ref|XP_006400056.1|  hypothetical protein EUTSA_v10013649mg             286   2e-93    
gb|KDO72635.1|  hypothetical protein CISIN_1g0091671mg                  280   6e-93    Citrus sinensis [apfelsine]
ref|XP_006400055.1|  hypothetical protein EUTSA_v10013649mg             286   1e-92    
gb|KDO72629.1|  hypothetical protein CISIN_1g0091673mg                  278   3e-92    Citrus sinensis [apfelsine]
ref|XP_006400054.1|  hypothetical protein EUTSA_v10013649mg             287   9e-92    Eutrema salsugineum [saltwater cress]
tpg|DAA45549.1|  TPA: hypothetical protein ZEAMMB73_196241              280   9e-92    
tpg|DAA45550.1|  TPA: hypothetical protein ZEAMMB73_196241              281   2e-91    
gb|EEC75352.1|  hypothetical protein OsI_11784                          278   4e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_009404092.1|  PREDICTED: cystathionine gamma-synthase, chl...    288   5e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF82119.1|  unknown                                                 281   1e-90    Zea mays [maize]
gb|KEH25015.1|  cystathionine gamma-synthase                            284   2e-90    Medicago truncatula
gb|ABF96222.1|  Cys/Met metabolism PLP-dependent enzyme family pr...    280   2e-90    Oryza sativa Japonica Group [Japonica rice]
gb|EEE59137.1|  hypothetical protein OsJ_11031                          279   3e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465206.1|  hypothetical protein SORBIDRAFT_01g034130          279   4e-90    
ref|XP_003618534.1|  Cystathionine-gamma-synthase                       284   4e-90    Medicago truncatula
gb|AAG38873.1|AF076495_1  cystathionine gamma-synthase                  280   6e-90    Oryza sativa [red rice]
ref|XP_010499872.1|  PREDICTED: cystathionine gamma-synthase, chl...    281   6e-90    Camelina sativa [gold-of-pleasure]
ref|NP_001050220.1|  Os03g0376100                                       280   7e-90    
gb|EMT23437.1|  Cystathionine gamma-synthase, chloroplastic             284   8e-90    
gb|ACF83809.1|  unknown                                                 278   2e-89    Zea mays [maize]
ref|XP_003557832.1|  PREDICTED: cystathionine gamma-synthase, chl...    282   5e-89    
gb|AAL82522.1|AC084766_8  putative cystathionine gamma synthase         280   5e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010478750.1|  PREDICTED: cystathionine gamma-synthase, chl...    278   9e-89    Camelina sativa [gold-of-pleasure]
gb|AAG51206.1|AC051630_3  cystathionine gamma-synthase, putative;...    277   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001104875.1|  cystathionine gamma-synthase1                      281   1e-88    
ref|XP_010461154.1|  PREDICTED: cystathionine gamma-synthase, chl...    278   2e-88    Camelina sativa [gold-of-pleasure]
ref|NP_174600.1|  Pyridoxal phosphate (PLP)-dependent transferase...    277   3e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461152.1|  PREDICTED: cystathionine gamma-synthase, chl...    278   3e-88    Camelina sativa [gold-of-pleasure]
gb|ABF96221.1|  Cys/Met metabolism PLP-dependent enzyme family pr...    280   4e-88    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ84799.1|  predicted protein                                      280   5e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001130426.1|  uncharacterized protein LOC100191523               278   1e-87    Zea mays [maize]
ref|XP_004984247.1|  PREDICTED: cystathionine gamma-synthase, chl...    279   1e-87    Setaria italica
gb|AFW87953.1|  LOW QUALITY PROTEIN: hypothetical protein ZEAMMB7...    278   1e-87    
gb|AAB61348.1|  cystathionine gamma-synthase                            278   2e-87    Zea mays [maize]
ref|XP_009772869.1|  PREDICTED: LOW QUALITY PROTEIN: cystathionin...    275   6e-87    Nicotiana sylvestris
ref|XP_010937207.1|  PREDICTED: cystathionine gamma-synthase, chl...    275   5e-86    Elaeis guineensis
gb|ABR16369.1|  unknown                                                 275   5e-86    Picea sitchensis
ref|XP_008800507.1|  PREDICTED: cystathionine gamma-synthase, chl...    261   1e-85    Phoenix dactylifera
ref|XP_004172088.1|  PREDICTED: cystathionine gamma-synthase, chl...    252   5e-82    
gb|KJB75687.1|  hypothetical protein B456_012G052100                    262   5e-81    Gossypium raimondii
ref|XP_001761633.1|  predicted protein                                  259   1e-79    
ref|XP_002965872.1|  hypothetical protein SELMODRAFT_143363             257   1e-79    
ref|XP_002983120.1|  hypothetical protein SELMODRAFT_155550             257   1e-79    
ref|XP_001772529.1|  predicted protein                                  255   3e-78    
ref|XP_009602125.1|  PREDICTED: cystathionine gamma-synthase, chl...    251   1e-76    Nicotiana tomentosiformis
ref|XP_009775846.1|  PREDICTED: cystathionine gamma-synthase, chl...    249   3e-76    Nicotiana sylvestris
ref|XP_003561880.1|  PREDICTED: cystathionine gamma-synthase, chl...    246   3e-75    Brachypodium distachyon [annual false brome]
ref|XP_003057119.1|  predicted protein                                  242   4e-75    Micromonas pusilla CCMP1545
gb|EMS45856.1|  Cystathionine gamma-synthase, chloroplastic             248   6e-74    Triticum urartu
gb|EMT09613.1|  Cystathionine gamma-synthase, chloroplastic             241   7e-74    
dbj|BAJ93384.1|  predicted protein                                      241   1e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS47533.1|  Cystathionine gamma-synthase, chloroplastic             241   1e-73    Triticum urartu
ref|XP_004983123.1|  PREDICTED: cystathionine gamma-synthase, chl...    239   3e-73    Setaria italica
ref|NP_001064539.1|  Os10g0399200                                       239   6e-73    
gb|EMT09614.1|  Cystathionine gamma-synthase, chloroplastic             239   1e-72    
gb|EAY78389.1|  hypothetical protein OsI_33476                          238   2e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_002467292.1|  hypothetical protein SORBIDRAFT_01g023050          237   8e-72    Sorghum bicolor [broomcorn]
ref|XP_008666693.1|  PREDICTED: cystathionine gamma-synthase, chl...    236   2e-71    Zea mays [maize]
ref|XP_008666694.1|  PREDICTED: cystathionine gamma-synthase, chl...    235   3e-71    Zea mays [maize]
tpg|DAA50063.1|  TPA: hypothetical protein ZEAMMB73_244612              235   3e-71    
gb|EAY78386.1|  hypothetical protein OsI_33473                          234   6e-71    Oryza sativa Indica Group [Indian rice]
ref|NP_001064540.1|  Os10g0399700                                       234   1e-70    
gb|AAK50404.1|AC021891_5  Putative O-succinylhomoserine (thiol)-l...    234   1e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007510517.1|  cystathionine gamma-synthase                       232   3e-70    Bathycoccus prasinos
ref|XP_005651362.1|  cystathionine gamma-synthase                       233   4e-70    Coccomyxa subellipsoidea C-169
ref|XP_003081090.1|  O-succinylhomoserine (ISS)                         227   5e-70    
ref|XP_006661751.1|  PREDICTED: cystathionine gamma-synthase, chl...    231   1e-69    Oryza brachyantha
ref|XP_001419722.1|  cystathione gamma synthase                         229   3e-69    Ostreococcus lucimarinus CCE9901
emb|CEF98968.1|  Pyridoxal phosphate-dependent transferase, major...    228   8e-69    Ostreococcus tauri
ref|XP_006662330.1|  PREDICTED: cystathionine gamma-synthase, chl...    229   8e-69    
ref|XP_005846526.1|  hypothetical protein CHLNCDRAFT_24830              227   8e-69    Chlorella variabilis
ref|XP_002506028.1|  predicted protein                                  225   2e-68    Micromonas commoda
gb|AFW87952.1|  hypothetical protein ZEAMMB73_590146                    222   7e-68    
gb|KDD72103.1|  Cys/Met metabolism PLP-dependent enzyme                 216   3e-67    Helicosporidium sp. ATCC 50920
gb|KIZ06880.1|  cystathionine gamma-synthase                            234   3e-67    Monoraphidium neglectum
gb|EMT05299.1|  Cystathionine gamma-synthase, chloroplastic             221   2e-65    
ref|XP_001695742.1|  cystathionine gamma-synthase                       218   1e-64    Chlamydomonas reinhardtii
ref|XP_002953537.1|  hypothetical protein VOLCADRAFT_75793              216   7e-64    Volvox carteri f. nagariensis
gb|EEC80304.1|  hypothetical protein OsI_22339                          209   3e-62    Oryza sativa Indica Group [Indian rice]
ref|XP_011397361.1|  Cystathionine gamma-synthase, chloroplastic        208   9e-62    Auxenochlorella protothecoides
ref|XP_007024260.1|  Pyridoxal phosphate (PLP)-dependent transfer...    204   1e-61    
gb|EEE65425.1|  hypothetical protein OsJ_20780                          206   4e-61    Oryza sativa Japonica Group [Japonica rice]
ref|WP_012828513.1|  cystathionine gamma-synthase                       206   6e-61    Haliangium ochraceum
gb|EMT09615.1|  Cystathionine gamma-synthase, chloroplastic             209   8e-61    
gb|ETW97684.1|  hypothetical protein ETSY2_44200                        199   4e-60    Candidatus Entotheonella gemina
ref|WP_029671929.1|  cystathionine gamma-synthase                       203   1e-59    
ref|WP_006563164.1|  cystathionine gamma-synthase                       203   1e-59    Oscillochloris trichoides
dbj|BAD37853.1|  putative O-succinylhomoserine (thiol)-lyase            202   7e-59    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ15990.1|  hypothetical protein OsJ_31434                          202   1e-58    Oryza sativa Japonica Group [Japonica rice]
ref|WP_015940702.1|  cystathionine gamma-synthase                       199   4e-58    Chloroflexus aggregans
ref|WP_020740637.1|  cystathionine beta-lyase                           199   4e-58    
ref|WP_034419446.1|  cystathionine gamma-synthase                       198   9e-58    
ref|WP_012257342.1|  MULTISPECIES: cystathionine gamma-synthase         198   1e-57    Chloroflexus aurantiacus
ref|WP_031459521.1|  cystathionine gamma-synthase                       197   2e-57    Chloroflexus sp. MS-G
ref|WP_012240206.1|  cystathionine gamma-synthase                       197   3e-57    Sorangium cellulosum
ref|WP_028458069.1|  cystathionine gamma-synthase                       197   4e-57    Chloroflexus sp. Y-396-1
ref|WP_041903797.1|  cystathionine gamma-synthase                       196   6e-57    
ref|WP_012174821.1|  cystathionine gamma-synthase                       189   2e-54    Desulfococcus oleovorans
gb|ABB47533.1|  Cys/Met metabolism PLP-dependent enzyme family pr...    190   3e-54    Oryza sativa Japonica Group [Japonica rice]
ref|WP_007334081.1|  cystathionine gamma-synthase                       187   3e-53    Rhodopirellula baltica
ref|WP_007324756.1|  cystathionine gamma-synthase                       187   3e-53    Rhodopirellula baltica
ref|WP_011120920.1|  cystathionine gamma-synthase                       187   3e-53    Rhodopirellula baltica
ref|WP_008655459.1|  methionine gamma-lyase                             186   6e-53    Rhodopirellula europaea
ref|WP_007339059.1|  methionine gamma-lyase                             185   2e-52    Rhodopirellula baltica
ref|WP_002653306.1|  cystathionine gamma-synthase                       184   2e-52    Blastopirellula marina
gb|KJB75686.1|  hypothetical protein B456_012G052100                    185   3e-52    Gossypium raimondii
ref|WP_037466783.1|  cystathionine gamma-synthase                       182   1e-51    
ref|WP_014432877.1|  cystathionine gamma-synthase                       179   2e-50    Caldilinea aerophila
ref|WP_008695126.1|  methionine gamma-lyase                             177   8e-50    Rhodopirellula maiorica
ref|WP_009709642.1|  cystathionine gamma-synthase                       176   4e-49    Desmospora sp. 8437
ref|WP_012912576.1|  cystathionine gamma-synthase                       175   6e-49    Pirellula staleyi
gb|KHD07814.1|  Cys/Met metabolism pyridoxal-phosphate-dependent ...    175   6e-49    
ref|WP_044251002.1|  cystathionine gamma-synthase                       175   1e-48    Rhodopirellula sp. SWK7
gb|EMI46706.1|  methionine gamma-lyase                                  175   1e-48    Rhodopirellula sp. SWK7
ref|WP_036745737.1|  hypothetical protein                               173   2e-48    
ref|WP_044302136.1|  cystathionine gamma-synthase                       172   5e-48    
gb|EMI56348.1|  cystathionine gamma synthase                            173   8e-48    Rhodopirellula sallentina SM41
gb|KIG18323.1|  Cystathionine gamma-synthase                            172   1e-47    Enhygromyxa salina
ref|XP_005702997.1|  cystathionine gamma-synthase                       174   1e-47    Galdieria sulphuraria
gb|EMS50136.1|  Cystathionine gamma-synthase, chloroplastic             163   2e-47    Triticum urartu
ref|WP_027178852.1|  cystathionine gamma-synthase                       171   2e-47    Desulfovibrio bastinii
ref|WP_009034610.1|  cystathionine gamma-synthase                       168   3e-46    Indibacter alkaliphilus
dbj|BAL55052.1|  cystathionine gamma-lyase                              167   4e-46    uncultured Acidobacteria bacterium
ref|WP_018150728.1|  methionine gamma-lyase                             167   6e-46    Leeia oryzae
ref|WP_006976115.1|  cystathionine gamma-synthase                       166   1e-45    
ref|WP_028852232.1|  cystathionine beta-lyase                           165   3e-45    Thermocrispum municipale
ref|WP_016987095.1|  cystathionine beta-lyase                           165   5e-45    Pseudomonas
ref|WP_015243721.1|  cystathionine gamma-synthase                       165   5e-45    Singulisphaera acidiphila
ref|WP_034152361.1|  cystathionine beta-lyase                           165   5e-45    Pseudomonas fluorescens
ref|WP_042342462.1|  methionine gamma-lyase                             165   6e-45    
ref|WP_012501926.1|  cystathionine beta-lyase                           164   7e-45    Chlorobaculum parvum
ref|WP_013905610.1|  cystathionine beta-lyase                           164   9e-45    Pyrococcus yayanosii
ref|WP_007412771.1|  cystathionine gamma-synthase                       164   9e-45    Pedosphaera parvula
ref|WP_004068005.1|  cystathionine beta-lyase                           164   1e-44    Thermococcus litoralis
ref|WP_035663612.1|  cystathionine gamma-synthase                       164   1e-44    Bacillus akibai
ref|WP_043248620.1|  cystathionine beta-lyase                           163   2e-44    Pseudomonas knackmussii
ref|WP_034633929.1|  cystathionine gamma-synthase                       157   2e-44    
ref|WP_017437713.1|  methionine gamma-lyase                             163   2e-44    Parageobacillus caldoxylosilyticus
ref|WP_015374550.1|  MULTISPECIES: cystathionine gamma-synthase         163   2e-44    Bacillaceae
ref|WP_042411373.1|  methionine gamma-lyase                             163   2e-44    Bacillaceae
ref|WP_014322773.1|  cystathionine gamma-synthase                       163   3e-44    Desulfovibrio desulfuricans
dbj|GAM27720.1|  hypothetical protein SAMD00019534_108960               162   3e-44    Acytostelium subglobosum LB1
ref|WP_043903364.1|  methionine gamma-lyase                             163   3e-44    Parageobacillus genomosp. 1
gb|EWG07846.1|  hypothetical protein ASUL_02344                         162   4e-44    Candidatus Aramenus sulfurataquae
ref|WP_042681523.1|  cystathionine gamma-synthase                       162   4e-44    Thermococcus paralvinellae
ref|WP_008085129.1|  cystathionine beta-lyase                           162   5e-44    Pseudomonas sp. GM80
ref|WP_041961175.1|  methionine gamma-lyase                             158   5e-44    
ref|WP_027621174.1|  cystathionine beta-lyase                           162   6e-44    Pseudomonas sp. URHB0015
ref|WP_007999877.1|  cystathionine beta-lyase                           162   6e-44    Pseudomonas sp. GM49
ref|WP_038368044.1|  cystathionine beta-lyase                           162   7e-44    Pseudomonas chlororaphis
ref|WP_007931537.1|  cystathionine beta-lyase                           162   7e-44    Pseudomonas
ref|WP_009858211.1|  cystathionine beta-lyase                           162   8e-44    Rubrivivax benzoatilyticus
ref|WP_028940547.1|  cystathionine beta-lyase                           161   9e-44    Pseudomonas umsongensis
ref|WP_018926010.1|  MULTISPECIES: cystathionine beta-lyase             161   9e-44    Pseudomonas
ref|WP_019649893.1|  cystathionine beta-lyase                           161   9e-44    Pseudomonas sp. 45MFCol3.1
ref|WP_009042798.1|  cystathionine beta-lyase                           161   1e-43    Pseudomonas
ref|WP_008039031.1|  cystathionine beta-lyase                           161   1e-43    Pseudomonas sp. GM67
ref|WP_008019625.1|  cystathionine beta-lyase                           161   1e-43    Pseudomonas sp. GM55
ref|WP_043269495.1|  cystathionine beta-lyase                           161   1e-43    Pseudomonas
ref|WP_008027244.1|  cystathionine beta-lyase                           161   1e-43    Pseudomonas sp. GM60
ref|WP_010169730.1|  cystathionine beta-lyase                           161   1e-43    Pseudomonas sp. PAMC 25886
ref|WP_043317852.1|  cystathionine beta-lyase                           161   1e-43    Pseudomonas sp. PI1
ref|WP_007918059.1|  MULTISPECIES: cystathionine beta-lyase             161   1e-43    Pseudomonas
ref|WP_006965184.1|  cystathionine gamma-synthase MetB                  161   1e-43    Desulfotignum phosphitoxidans
ref|WP_012020635.1|  hypothetical protein                               160   2e-43    Metallosphaera sedula
ref|WP_027362967.1|  cystathionine gamma-synthase                       160   2e-43    Desulfospira joergensenii
ref|WP_024334154.1|  cystathionine gamma-synthase                       160   2e-43    Desulfotignum balticum
ref|WP_017338177.1|  cystathionine beta-lyase                           160   2e-43    Pseudomonas fluorescens
ref|WP_008006048.1|  cystathionine beta-lyase                           160   2e-43    Pseudomonas sp. GM50
ref|WP_026964173.1|  methionine gamma-lyase                             160   2e-43    Alicyclobacillus pomorum
ref|WP_027613062.1|  cystathionine beta-lyase                           160   2e-43    Pseudomonas sp. URIL14HWK12:I6
ref|WP_018718898.1|  hypothetical protein                               160   2e-43    Arhodomonas aquaeolei
ref|WP_008069856.1|  cystathionine beta-lyase                           160   2e-43    Pseudomonas sp. GM79
ref|WP_016979942.1|  cystathionine beta-lyase                           160   3e-43    Pseudomonas fluorescens
ref|WP_030162325.1|  cystathionine beta-lyase                           160   3e-43    Glycomyces sp. NRRL B-16210
ref|WP_025856711.1|  cystathionine beta-lyase                           160   3e-43    Pseudomonas sp. CHM02
ref|WP_007896198.1|  cystathionine beta-lyase                           160   3e-43    Pseudomonas sp. GM102
ref|WP_007957389.1|  cystathionine beta-lyase                           160   3e-43    Pseudomonas
gb|AIF70130.1|  cystathionine beta-lyase                                160   3e-43    Palaeococcus pacificus DY20341
ref|WP_011334626.1|  cystathionine beta-lyase                           160   3e-43    Pseudomonas
ref|WP_003247687.1|  MULTISPECIES: methionine gamma-lyase               160   3e-43    Bacillaceae
gb|EZP32506.1|  cystathionine gamma-lyase                               160   3e-43    Pseudomonas sp. RIT288
ref|WP_007945159.1|  cystathionine beta-lyase                           160   4e-43    Pseudomonas sp. GM21
ref|WP_041062583.1|  cystathionine beta-lyase                           160   4e-43    Pseudomonas
ref|WP_007965729.1|  cystathionine beta-lyase                           160   4e-43    Pseudomonas sp. GM30
ref|WP_039108500.1|  cystathionine gamma-synthase                       159   4e-43    Flavobacterium sp. AED
ref|WP_038983351.1|  cystathionine beta-lyase                           160   4e-43    Pseudomonas
ref|WP_013905650.1|  cystathionine beta-lyase                           159   4e-43    Pyrococcus yayanosii
ref|WP_018399711.1|  hypothetical protein                               159   4e-43    
ref|WP_021273496.1|  cystathionine beta-lyase                           159   4e-43    
ref|WP_033100917.1|  methionine gamma-lyase                             160   5e-43    
ref|WP_039766902.1|  cystathionine beta-lyase                           159   5e-43    
ref|WP_042606757.1|  cystathionine beta-lyase                           159   5e-43    
ref|WP_030130242.1|  cystathionine beta-lyase                           159   5e-43    
ref|WP_033055870.1|  cystathionine beta-lyase                           159   5e-43    
ref|WP_003353106.1|  methionine gamma-lyase                             159   5e-43    
ref|WP_019579019.1|  O-succinylhomoserine sulfhydrylase                 159   5e-43    
ref|WP_036175292.1|  methionine gamma-lyase                             159   5e-43    
ref|WP_013467658.1|  cystathionine beta-lyase                           159   6e-43    
ref|WP_017520122.1|  cystathionine beta-lyase                           159   6e-43    
ref|WP_028848831.1|  cystathionine beta-lyase                           159   6e-43    
ref|WP_025111620.1|  cystathionine beta-lyase                           159   6e-43    
gb|EPZ51796.1|  cystathionine beta-lyase                                159   6e-43    
ref|WP_017475516.1|  cystathionine beta-lyase                           159   6e-43    
ref|WP_038849655.1|  cystathionine beta-lyase                           159   6e-43    
ref|WP_040313960.1|  cystathionine gamma-synthase                       159   6e-43    
ref|WP_022588007.1|  cystathionine beta-lyase                           159   7e-43    
ref|WP_007987063.1|  cystathionine beta-lyase                           159   8e-43    
ref|WP_007420916.1|  cystathionine beta-lyase                           159   8e-43    
ref|WP_027608451.1|  cystathionine beta-lyase                           159   8e-43    
ref|WP_003225733.1|  cystathionine beta-lyase                           159   9e-43    
ref|WP_010456815.1|  cystathionine beta-lyase                           159   9e-43    
ref|WP_033896563.1|  cystathionine beta-lyase                           159   9e-43    
ref|WP_009615241.1|  putative cystathionine gamma-lyase                 159   9e-43    
ref|WP_014163641.1|  cystathionine gamma-synthase                       159   9e-43    
ref|WP_044461938.1|  cystathionine beta-lyase                           159   9e-43    
ref|WP_017906920.1|  cystathionine beta-lyase                           159   1e-42    
ref|WP_019690673.1|  cystathionine beta-lyase                           159   1e-42    
ref|WP_007936634.1|  cystathionine beta-lyase                           159   1e-42    
ref|WP_008436288.1|  cystathionine beta-lyase                           158   1e-42    
ref|WP_007976078.1|  MULTISPECIES: cystathionine beta-lyase             158   1e-42    
ref|WP_015135413.1|  Cys/Met metabolism pyridoxal-phosphate-depen...    158   1e-42    
ref|WP_035669220.1|  cystathionine gamma-synthase                       158   1e-42    
ref|WP_011629355.1|  cystathionine gamma-synthase                       158   1e-42    
ref|WP_022541518.1|  cystathionine gamma-lyase                          158   1e-42    
ref|WP_016970165.1|  cystathionine beta-lyase                           158   1e-42    
ref|WP_040067071.1|  cystathionine beta-lyase                           158   2e-42    
ref|WP_041821429.1|  cystathionine gamma-synthase                       158   2e-42    
ref|WP_015475134.1|  cystathionine gamma-lyase                          158   2e-42    
ref|WP_018664726.1|  methionine gamma-lyase                             158   2e-42    
ref|WP_012724563.1|  cystathionine beta-lyase                           158   2e-42    
ref|WP_034742830.1|  cystathionine gamma-synthase                       158   2e-42    
ref|WP_025805270.1|  cystathionine beta-lyase                           158   2e-42    
dbj|BAB05455.1|  cystathionine gamma-lyase                              158   2e-42    
ref|WP_003351060.1|  methionine gamma-lyase                             158   2e-42    
ref|WP_016702204.1|  O-succinylhomoserine sulfhydrylase                 157   2e-42    
gb|KFH67597.1|  cystathionine gamma-lyase                               158   2e-42    
ref|WP_040492800.1|  cystathionine gamma-synthase                       157   2e-42    
ref|WP_027310268.1|  cystathionine gamma-synthase                       157   2e-42    
ref|WP_012927864.1|  cystathionine gamma-synthase                       157   3e-42    
ref|WP_011320837.1|  cystathionine beta-lyase                           157   3e-42    
ref|WP_013276329.1|  methionine gamma-lyase                             157   3e-42    
ref|WP_039763077.1|  cystathionine beta-lyase                           157   3e-42    
ref|WP_003173743.1|  cystathionine beta-lyase                           157   3e-42    
ref|WP_035636324.1|  cystathionine gamma-synthase                       157   3e-42    
ref|WP_009047777.1|  cystathionine beta-lyase                           157   3e-42    
ref|WP_040371317.1|  cystathionine gamma-synthase                       157   3e-42    
ref|WP_008049666.1|  cystathionine beta-lyase                           157   3e-42    
ref|XP_005818465.1|  hypothetical protein GUITHDRAFT_159042             158   3e-42    
ref|WP_008061126.1|  cystathionine beta-lyase                           157   3e-42    
ref|WP_028681905.1|  cystathionine beta-lyase                           157   3e-42    
ref|WP_036317152.1|  cystathionine gamma-synthase                       151   4e-42    
ref|WP_003348109.1|  methionine gamma-lyase                             157   4e-42    
ref|WP_034134968.1|  cystathionine beta-lyase                           157   4e-42    
ref|WP_016775028.1|  cystathionine beta-lyase                           157   4e-42    
ref|WP_032880897.1|  cystathionine beta-lyase                           157   4e-42    
ref|WP_023968374.1|  cystathionine beta-lyase                           157   4e-42    
ref|WP_019408015.1|  cystathionine beta-lyase                           157   4e-42    
ref|WP_003191636.1|  cystathionine beta-lyase                           157   4e-42    
ref|WP_024013201.1|  cystathionine beta-lyase                           157   4e-42    
ref|WP_021328787.1|  Cys/Met metabolism pyridoxal-phosphate-depen...    157   4e-42    
gb|EPR30603.1|  Cys/Met metabolism pyridoxal-phosphate-dependent ...    157   5e-42    
ref|WP_038580993.1|  cystathionine beta-lyase                           157   5e-42    
ref|WP_035525686.1|  methionine gamma-lyase                             157   5e-42    
ref|XP_004336485.1|  cystathionine gammasynthase                        157   5e-42    
ref|WP_032897041.1|  cystathionine beta-lyase                           157   5e-42    
ref|WP_009071473.1|  hypothetical protein                               156   5e-42    
ref|WP_015258491.1|  cystathionine gamma-synthase - like protein        157   5e-42    
ref|WP_021279072.1|  Cys/Met metabolism PLP-dependent enzyme            157   5e-42    
ref|WP_019817159.1|  MULTISPECIES: putative cystathionine gamma-s...    157   5e-42    
ref|WP_035512337.1|  cystathionine gamma-synthase                       157   6e-42    
ref|WP_020302292.1|  putative cystathionine gamma-synthase              156   6e-42    
ref|WP_004044791.1|  cystathionine beta-lyase                           157   6e-42    
ref|WP_009610068.1|  cystathionine beta-lyase                           157   6e-42    
ref|WP_015893710.1|  methionine gamma-lyase                             157   6e-42    
ref|WP_011025811.1|  cystathionine beta-lyase                           156   6e-42    
ref|WP_014718631.1|  MULTISPECIES: cystathionine beta-lyase             156   6e-42    
ref|WP_014801280.1|  Cys/Met metabolism pyridoxal-phosphate-depen...    157   6e-42    
ref|WP_004066012.1|  MULTISPECIES: cystathionine gamma-synthase         156   6e-42    
ref|WP_029140133.1|  cystathionine gamma-synthase                       156   7e-42    
ref|WP_042205508.1|  methionine gamma-lyase                             157   7e-42    
gb|KDO72637.1|  hypothetical protein CISIN_1g0091671mg                  147   7e-42    
ref|WP_003215115.1|  cystathionine beta-lyase                           156   7e-42    
ref|WP_028308971.1|  methionine gamma-lyase                             156   7e-42    
ref|WP_007506076.1|  methionine gamma-lyase                             156   7e-42    
ref|WP_028616324.1|  cystathionine beta-lyase                           156   7e-42    
ref|WP_018989636.1|  cystathionine gamma-synthase                       156   7e-42    
ref|WP_044871042.1|  cystathionine beta-lyase                           156   8e-42    
ref|WP_032413379.1|  cystathionine gamma-synthase                       156   8e-42    
ref|WP_006423786.1|  methionine gamma-lyase                             156   8e-42    
ref|WP_014387246.1|  cystathionine beta-lyase                           156   8e-42    
ref|WP_036599226.1|  methionine gamma-lyase                             156   9e-42    
ref|WP_017731179.1|  hypothetical protein                               156   9e-42    
ref|WP_041480052.1|  cystathionine beta-lyase                           156   9e-42    
ref|WP_034119841.1|  cystathionine beta-lyase                           156   9e-42    
ref|WP_035127615.1|  cystathionine gamma-synthase                       155   9e-42    
ref|WP_039837665.1|  methionine gamma-lyase                             156   1e-41    
ref|WP_005787968.1|  cystathionine beta-lyase                           156   1e-41    
ref|WP_034150558.1|  cystathionine beta-lyase                           156   1e-41    
ref|WP_038611749.1|  cystathionine beta-lyase                           156   1e-41    
ref|WP_009989477.1|  hypothetical protein                               155   1e-41    
ref|WP_004974217.1|  MULTISPECIES: cystathionine gamma-synthase         155   1e-41    
ref|WP_010932383.1|  cystathionine beta-lyase                           155   1e-41    
ref|WP_032902946.1|  cystathionine beta-lyase                           155   1e-41    
ref|WP_017252446.1|  methionine gamma-lyase                             156   1e-41    
ref|WP_007720575.1|  methionine gamma-lyase                             156   1e-41    
gb|AAV49994.1|  putative cystathionine gamma-synthase                   151   1e-41    
ref|WP_010448363.1|  cystathionine beta-lyase                           155   1e-41    
ref|WP_008148631.1|  cystathionine beta-lyase                           155   1e-41    
ref|WP_035377727.1|  methionine gamma-lyase                             155   1e-41    
ref|WP_043864321.1|  cystathionine beta-lyase                           155   2e-41    
ref|WP_042787869.1|  cystathionine gamma-synthase                       155   2e-41    
ref|WP_024766754.1|  cystathionine beta-lyase                           155   2e-41    
ref|WP_038995966.1|  cystathionine beta-lyase                           155   2e-41    
ref|WP_026716757.1|  cystathionine gamma-synthase                       155   2e-41    
ref|WP_024075784.1|  cystathionine beta-lyase                           155   2e-41    
ref|WP_017216112.1|  methionine gamma-lyase                             155   2e-41    
ref|WP_034733831.1|  cystathionine beta-lyase                           155   2e-41    
ref|WP_041072964.1|  methionine gamma-lyase                             155   2e-41    
ref|WP_039790759.1|  methionine gamma-lyase                             155   2e-41    
ref|WP_039113148.1|  MULTISPECIES: cystathionine gamma-synthase         155   2e-41    
ref|WP_008576394.1|  MULTISPECIES: cystathionine gamma-synthase         155   2e-41    
ref|WP_020796352.1|  MULTISPECIES: cystathionine beta-lyase/cysta...    155   2e-41    
ref|WP_044273377.1|  cystathionine beta-lyase                           155   3e-41    
ref|WP_043047775.1|  cystathionine beta-lyase                           155   3e-41    
ref|XP_004341366.1|  Cys/Met metabolism PLPdependent enzyme super...    155   3e-41    
ref|WP_027922429.1|  cystathionine beta-lyase                           155   3e-41    
ref|WP_026697988.1|  cystathionine gamma-synthase                       155   3e-41    
ref|XP_003284098.1|  cystathionine gamma-lyase                          155   3e-41    
ref|WP_017127486.1|  cystathionine beta-lyase                           155   3e-41    
ref|WP_010371197.1|  methionine gamma-lyase                             155   3e-41    
ref|WP_010606739.1|  methionine gamma-lyase                             155   3e-41    
ref|WP_012958583.1|  cystathionine gamma-synthase                       154   3e-41    
ref|WP_004968670.1|  cystathionine gamma-synthase                       154   3e-41    
ref|WP_022954040.1|  cystathionine gamma-synthase                       155   3e-41    
ref|WP_007274716.1|  cystathionine gamma-synthase                       154   3e-41    
ref|WP_026989801.1|  cystathionine gamma-synthase                       154   3e-41    
ref|WP_013776954.1|  hypothetical protein                               154   3e-41    
gb|EFA79937.1|  cystathionine gamma-lyase                               154   4e-41    
ref|WP_029166632.1|  cystathionine gamma-synthase                       154   4e-41    
ref|WP_042565513.1|  cystathionine gamma-synthase                       154   4e-41    
ref|XP_005718068.1|  Cystathionine gamma-synthase, Rhodoplastic CGS1    156   4e-41    
ref|WP_010226471.1|  MULTISPECIES: cystathionine beta-lyase             154   4e-41    
ref|WP_034040647.1|  cystathionine beta-lyase                           153   4e-41    
ref|WP_020611640.1|  methionine gamma-lyase                             154   4e-41    
ref|WP_001242786.1|  cystathionine beta-lyase                           154   4e-41    
ref|WP_013749046.1|  cystathionine beta-lyase                           154   4e-41    
gb|EDY06437.1|  Cystathionine gamma-synthase                            154   4e-41    
ref|WP_032885295.1|  cystathionine beta-lyase                           154   4e-41    
ref|WP_011997433.1|  cystathionine beta-lyase                           154   5e-41    
ref|WP_025333516.1|  methionine gamma-lyase                             154   5e-41    
ref|WP_022627231.1|  cystathionine gamma-synthase                       154   5e-41    
ref|WP_029459526.1|  cystathionine beta-lyase                           154   5e-41    
ref|WP_040262032.1|  cystathionine beta-lyase                           154   5e-41    
ref|WP_004967707.1|  cystathionine gamma-synthase                       151   6e-41    
ref|WP_042413936.1|  cystathionine gamma-synthase                       154   6e-41    
ref|WP_042360073.1|  cystathionine gamma-synthase                       154   6e-41    
ref|WP_025688083.1|  methionine gamma-lyase                             154   6e-41    
gb|EGQ26448.1|  cystathionine beta-lyase                                154   6e-41    
ref|WP_035499224.1|  cystathionine gamma-synthase                       154   6e-41    
ref|WP_039497091.1|  methionine gamma-lyase                             154   6e-41    
ref|WP_025151570.1|  methionine gamma-lyase                             154   6e-41    
ref|WP_035617629.1|  cystathionine gamma-synthase                       154   6e-41    
ref|WP_022542028.1|  cystathionine gamma-synthase                       154   6e-41    
ref|WP_035532807.1|  cystathionine gamma-synthase                       154   6e-41    
emb|CBH39218.1|  Cys/Met metabolism PLP-dependent enzyme family p...    154   7e-41    
ref|WP_020881569.1|  Cys/Met metabolism pyridoxal-phosphate-depen...    154   7e-41    
ref|WP_003755281.1|  cystathionine beta-lyase                           153   7e-41    
ref|WP_043680596.1|  methionine gamma-lyase                             154   7e-41    
ref|WP_027068312.1|  cystathionine gamma-synthase                       154   7e-41    
ref|WP_025703025.1|  methionine gamma-lyase                             154   7e-41    
ref|WP_034104975.1|  cystathionine beta-lyase                           154   7e-41    
ref|WP_036184693.1|  methionine gamma-lyase                             154   8e-41    
ref|WP_014645136.1|  cystathionine gamma-synthase                       154   8e-41    
ref|WP_010567973.1|  cystathionine beta-lyase                           153   8e-41    
ref|WP_040933890.1|  cystathionine beta-lyase                           153   8e-41    
ref|WP_010958610.1|  cystathionine beta-lyase                           153   9e-41    
ref|WP_028629512.1|  cystathionine beta-lyase                           153   9e-41    
ref|WP_017131917.1|  cystathionine beta-lyase                           153   9e-41    
ref|WP_028621680.1|  cystathionine beta-lyase                           153   9e-41    
ref|WP_007136971.1|  cystathionine beta-lyase                           153   1e-40    
ref|WP_020024560.1|  hypothetical protein                               153   1e-40    
ref|WP_025693850.1|  methionine gamma-lyase                             154   1e-40    
ref|WP_006205341.1|  cystathionine beta-lyase                           153   1e-40    
ref|WP_020596913.1|  cystathionine gamma-synthase                       153   1e-40    
ref|WP_040759024.1|  methionine gamma-lyase                             153   1e-40    
ref|WP_035348276.1|  methionine gamma-lyase                             153   1e-40    
ref|WP_035354326.1|  methionine gamma-lyase                             153   1e-40    
dbj|GAM21339.1|  hypothetical protein SAMD00019534_045140               153   1e-40    
gb|KFP71606.1|  Cystathionine gamma-lyase                               152   1e-40    
ref|WP_028102445.1|  cystathionine beta-lyase                           153   1e-40    
ref|WP_018183406.1|  cystathionine beta-lyase                           153   1e-40    
ref|WP_008589591.1|  cystathionine gamma-synthase                       153   1e-40    
ref|WP_042559531.1|  cystathionine beta-lyase                           153   1e-40    
ref|WP_005769800.1|  cystathionine beta-lyase                           153   1e-40    
ref|WP_024918011.1|  cystathionine beta-lyase                           153   1e-40    
ref|WP_034009517.1|  cystathionine beta-lyase                           153   1e-40    
ref|WP_040953457.1|  cystathionine beta-lyase                           152   2e-40    
ref|WP_005225940.1|  cystathionine beta-lyase                           152   2e-40    
ref|XP_009070878.1|  PREDICTED: cystathionine gamma-lyase               152   2e-40    
ref|WP_016858626.1|  cystathionine beta-lyase                           152   2e-40    
ref|WP_031686325.1|  cystathionine beta-lyase                           153   2e-40    
gb|KIX20649.1|  cystathionine gamma-synthase                            152   2e-40    
ref|WP_031932553.1|  methionine gamma-lyase                             153   2e-40    
gb|EOR96462.1|  Cystathionine gamma-synthase                            153   2e-40    
ref|WP_003157910.1|  cystathionine gamma-lyase                          152   2e-40    
ref|WP_003439353.1|  cystathionine gamma-synthase                       152   2e-40    
ref|WP_038694680.1|  methionine gamma-lyase                             153   2e-40    
ref|WP_006929373.1|  methionine gamma-lyase                             152   2e-40    



>gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 [Solanum tuberosum]
Length=539

 Score =   345 bits (884),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGPEKLVSV+RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAH
Sbjct  366  GCISGPEKLVSVIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAH  425

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+ VYYPGLPSHPE+H+AKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGG
Sbjct  426  PKVKHVYYPGLPSHPEYHLAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGG  485

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGI+DNLVRFSFGVEDFEDVKADVLQAL++I
Sbjct  486  CESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI  539



>ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycopersicum]
 gb|AAR92031.1| cystathionine gamma synthase [Solanum lycopersicum]
Length=540

 Score =   345 bits (884),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGPEKLVSV+RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAH
Sbjct  367  GCISGPEKLVSVIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAH  426

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+ VYYPGLPSHPE+H+AKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGG
Sbjct  427  PKVKHVYYPGLPSHPEYHLAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGG  486

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGI+DNLVRFSFGVEDFEDVKADVLQAL++I
Sbjct  487  CESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI  540



>ref|XP_002529997.1| cystathionine gamma-synthase, putative [Ricinus communis]
 gb|EEF32359.1| cystathionine gamma-synthase, putative, partial [Ricinus communis]
Length=425

 Score =   340 bits (871),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS +RNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAH
Sbjct  252  GCISGSAKLVSEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAH  311

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+ VYYPGLPSHPE+HIAK+QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGG
Sbjct  312  PKVKHVYYPGLPSHPEYHIAKRQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGG  371

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ+ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  372  CESIVDQPAIMSYWDLTQSEREKYGIKDNLVRFSFGVEDFEDMKADILQALETI  425



>gb|KJB11075.1| hypothetical protein B456_001G240000 [Gossypium raimondii]
Length=544

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGPEKL++ +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH
Sbjct  371  GCISGPEKLITEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  430

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+VRRVYYPGLPSHPEH IAK+QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGG
Sbjct  431  PRVRRVYYPGLPSHPEHEIAKQQMTGFGGVVSFEVDGDLMTTKKFVDALKIPYIAPSFGG  490

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+QAER  YGI DNLVRFSFGVEDFED+KADVLQALETI
Sbjct  491  CESIVDQPAIMSYWDLSQAERRKYGIEDNLVRFSFGVEDFEDLKADVLQALETI  544



>gb|KJB11079.1| hypothetical protein B456_001G240300 [Gossypium raimondii]
Length=546

 Score =   342 bits (878),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGPEKL++ +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH
Sbjct  373  GCISGPEKLITEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  432

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+VRRVYYPGLPSHPEH IAK+QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGG
Sbjct  433  PRVRRVYYPGLPSHPEHEIAKQQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGG  492

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+QAER  YGI DNLVRFSFGVEDFED+KADVLQALETI
Sbjct  493  CESIVDQPAIMSYWDLSQAERRKYGIEDNLVRFSFGVEDFEDLKADVLQALETI  546



>pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|B Chain B, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|C Chain C, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|D Chain D, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|E Chain E, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|F Chain F, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|G Chain G, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1QGN|H Chain H, Cystathionine Gamma-Synthase From Nicotiana Tabacum
 pdb|1I41|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I41|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Appa
 pdb|1I43|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I43|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ppca
 pdb|1I48|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 pdb|1I48|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor 
Ctcpo
 gb|AAD16143.1| cystathionine gamma-synthase precursor [Nicotiana tabacum]
Length=445

 Score =   338 bits (866),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP KLVS +RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAH
Sbjct  272  GCISGPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAH  331

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGL SHPEHHIAKKQMTGFGG VSFE+DGDL+TTAKFVDALKIPYIAPSFGG
Sbjct  332  PKVRHVYYPGLQSHPEHHIAKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIPYIAPSFGG  391

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  392  CESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  445



>gb|KHG00425.1| Cystathionine gamma-synthase, chloroplastic -like protein [Gossypium 
arboreum]
Length=539

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG EKLV+ +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH
Sbjct  365  GCISGSEKLVTEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  424

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V+RVYYPGLPSHPEH IAK+QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGG
Sbjct  425  PRVKRVYYPGLPSHPEHEIAKRQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGG  484

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+QAER+ YGI+DNL+RFSFGVEDFED+KAD+LQALETI
Sbjct  485  CESIVDQPAIMSYWDLSQAERSKYGILDNLIRFSFGVEDFEDLKADILQALETI  538



>gb|KHG14739.1| Cystathionine gamma-synthase, chloroplastic -like protein [Gossypium 
arboreum]
Length=547

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGPEKL++ +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE LEAH
Sbjct  374  GCISGPEKLITEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEALEAH  433

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+VRRVYYPGLPSHPEH IAK+QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGG
Sbjct  434  PRVRRVYYPGLPSHPEHEIAKQQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGG  493

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+QAER  YGI DNLVRFSFGVEDFED+KADVLQALETI
Sbjct  494  CESIVDQPAIMSYWDLSQAERRKYGIEDNLVRFSFGVEDFEDLKADVLQALETI  547



>gb|AJF83863.1| cystathionine gamma synthase 1 [Nicotiana tabacum]
Length=537

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP KLVSV+RNLHHILGG LNPNAAYLIIRGMKTLHLR+QQQNSTALRMAE+LEAH
Sbjct  364  GCISGPVKLVSVIRNLHHILGGALNPNAAYLIIRGMKTLHLRLQQQNSTALRMAEILEAH  423

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGL SHPEHHIAKKQMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGG
Sbjct  424  PKVRHVYYPGLQSHPEHHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGG  483

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  484  CESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  537



>gb|ABK96139.1| unknown [Populus trichocarpa]
Length=310

 Score =   332 bits (850),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K+VS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAH
Sbjct  134  GCISGSTKVVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAH  193

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGLPSHPEHHIAKKQMTGFGGVVSFE+DGDL  T+KFVDALKIPYIAPSFGG
Sbjct  194  PKVRCVYYPGLPSHPEHHIAKKQMTGFGGVVSFEVDGDLFITSKFVDALKIPYIAPSFGG  253

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+++ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  254  CESIVDQPAIMSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI  307



>ref|XP_009797245.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana 
sylvestris]
Length=552

 Score =   340 bits (871),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGPEKLVSVVRNLHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTA R+AE+LEAH
Sbjct  379  GCISGPEKLVSVVRNLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTAQRIAEILEAH  438

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGLPSHPEH +AKKQMTGFGGVVSFE+DGDL+TTAKF+DALKIPYIAPSFGG
Sbjct  439  PKVRCVYYPGLPSHPEHQLAKKQMTGFGGVVSFEVDGDLLTTAKFIDALKIPYIAPSFGG  498

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGI+DNLVRFSFGVEDFED+KAD+LQAL+TI
Sbjct  499  CESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKADILQALDTI  552



>ref|XP_009628949.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=527

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP +LVSVVRNLHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAH
Sbjct  354  GCISGPLELVSVVRNLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAH  413

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+ VYYPGL SHPE+HIAKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGG
Sbjct  414  PKVKHVYYPGLQSHPEYHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGG  473

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGIMDNLVRFSFGVEDFEDVKADVLQALE+I
Sbjct  474  CESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFEDVKADVLQALESI  527



>ref|XP_009775845.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Nicotiana sylvestris]
Length=538

 Score =   339 bits (869),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP KLVS +RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAH
Sbjct  365  GCISGPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAH  424

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGL SHPEHHIAKKQMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGG
Sbjct  425  PKVRHVYYPGLQSHPEHHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGG  484

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  485  CESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  538



>ref|XP_011085742.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase 
1, chloroplastic-like [Sesamum indicum]
Length=543

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISGPEKL+SVVRNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQN+TA RMAE+LEAH
Sbjct  370  GSISGPEKLISVVRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNTTAQRMAEILEAH  429

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVRRVYYPGL SHPEH +AK+QM GFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGG
Sbjct  430  PKVRRVYYPGLASHPEHELAKRQMNGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGG  489

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q+ERA YGIMDNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  490  CESIVDQPAIMSYWDLSQSERAKYGIMDNLVRFSFGVEDFEDLKADILQALETI  543



>ref|XP_009602123.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Nicotiana tomentosiformis]
Length=601

 Score =   340 bits (872),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP KLVSV+RNLHHILGG LNPNAAYLIIRGMKTLHLR+QQQNSTALRMAE+LEAH
Sbjct  428  GCISGPVKLVSVIRNLHHILGGALNPNAAYLIIRGMKTLHLRLQQQNSTALRMAEILEAH  487

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGL SHPEHHIAKKQMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGG
Sbjct  488  PKVRHVYYPGLQSHPEHHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGG  547

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  548  CESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  601



>emb|CBI22246.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG EKLVS +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAH
Sbjct  324  GCISGSEKLVSTIRNLHHVLGGVLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAH  383

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+ VYYPGLPSHPEHHIAK+QMTGFGGVVSFE+DGDL TT KFVDALKIPYIAPSFGG
Sbjct  384  PKVKCVYYPGLPSHPEHHIAKRQMTGFGGVVSFEVDGDLTTTIKFVDALKIPYIAPSFGG  443

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL Q+ERA YGI DNLVRFSFGVEDFED+KAD+LQALE+I
Sbjct  444  CESIVDQPAIMSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKADILQALESI  497



>gb|AHM22940.1| cystathionine gamma synthase [Nicotiana tabacum]
Length=540

 Score =   337 bits (865),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP KLVS +RNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAH
Sbjct  367  GCISGPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAH  426

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGL SHPEHHIAKKQMTGFGG VSFE+DGDL+TTAKFVDALKIPYIAPSFGG
Sbjct  427  PKVRHVYYPGLQSHPEHHIAKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIPYIAPSFGG  486

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  487  CESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  540



>gb|AGT40329.1| cystathionine gamma synthase [Nicotiana attenuata]
Length=553

 Score =   337 bits (864),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGPEKLVSVVRNLHHILGG +NPNAAYLIIRGMKTLHLR++QQNSTA R+AE+LEAH
Sbjct  380  GCISGPEKLVSVVRNLHHILGGAINPNAAYLIIRGMKTLHLRIKQQNSTAQRIAEILEAH  439

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGLPSHPEH +AKKQMTGFGGVVSFE+DGDL+TTAKF+DALKIPYIAPSFGG
Sbjct  440  PKVRCVYYPGLPSHPEHQLAKKQMTGFGGVVSFEVDGDLLTTAKFIDALKIPYIAPSFGG  499

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGI+DNLVRFSFGVEDFED+KAD+LQALE I
Sbjct  500  CESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKADILQALEAI  553



>ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Vitis 
vinifera]
Length=531

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG EKLVS +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAH
Sbjct  358  GCISGSEKLVSTIRNLHHVLGGVLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAH  417

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+ VYYPGLPSHPEHHIAK+QMTGFGGVVSFE+DGDL TT KFVDALKIPYIAPSFGG
Sbjct  418  PKVKCVYYPGLPSHPEHHIAKRQMTGFGGVVSFEVDGDLTTTIKFVDALKIPYIAPSFGG  477

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL Q+ERA YGI DNLVRFSFGVEDFED+KAD+LQALE+I
Sbjct  478  CESIVDQPAIMSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKADILQALESI  531



>ref|XP_011035793.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Populus 
euphratica]
Length=543

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K+VS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAH
Sbjct  367  GCISGSTKVVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAH  426

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGLPSHPEHHIAKKQMTGFGGVVSFE+DGDL+ T+KFVDALKIPYIAPSFGG
Sbjct  427  PKVRCVYYPGLPSHPEHHIAKKQMTGFGGVVSFEVDGDLLITSKFVDALKIPYIAPSFGG  486

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+++ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  487  CESIVDQPAIMSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI  540



>gb|AHL84163.1| cystathionine gamma synthase [Nicotiana tabacum]
Length=527

 Score =   334 bits (856),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP+KLVSVVRNLHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTA R+AE+LEAH
Sbjct  354  GCISGPDKLVSVVRNLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTAQRIAEILEAH  413

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGL SHPEH +AKKQMTGFGGVVSFE+DGDL+TTAKF+DALKIPYIAPSFGG
Sbjct  414  PKVRCVYYPGLQSHPEHQLAKKQMTGFGGVVSFEVDGDLLTTAKFIDALKIPYIAPSFGG  473

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGI+DNLVRFSFGVEDFED+KAD+LQALE I
Sbjct  474  CESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKADILQALEAI  527



>ref|XP_002323872.1| cystathionine gamma synthase family protein [Populus trichocarpa]
 gb|EEF04005.1| cystathionine gamma synthase family protein [Populus trichocarpa]
Length=532

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K+VS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAH
Sbjct  356  GCISGSTKVVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAH  415

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGLPSHPEHHIAKKQMTGFGGVVSFE+DGDL  T+KFVDALKIPYIAPSFGG
Sbjct  416  PKVRCVYYPGLPSHPEHHIAKKQMTGFGGVVSFEVDGDLFITSKFVDALKIPYIAPSFGG  475

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+++ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  476  CESIVDQPAIMSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI  529



>ref|XP_009592901.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=553

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP+KLVSVVRNLHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTA R+AE+LEAH
Sbjct  380  GCISGPDKLVSVVRNLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTAQRIAEILEAH  439

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGL SHPEH +AKKQMTGFGGVVSFE+DGDL+TTAKF+DALKIPYIAPSFGG
Sbjct  440  PKVRCVYYPGLQSHPEHQLAKKQMTGFGGVVSFEVDGDLLTTAKFIDALKIPYIAPSFGG  499

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGI+DNLVRFSFGVEDFED+KAD+LQALE I
Sbjct  500  CESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKADILQALEAI  553



>ref|XP_006373333.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa]
 gb|ERP51130.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa]
Length=548

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K+VS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAH
Sbjct  372  GCISGSTKVVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAH  431

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGLPSHPEHHIAKKQMTGFGGVVSFE+DGDL  T+KFVDALKIPYIAPSFGG
Sbjct  432  PKVRCVYYPGLPSHPEHHIAKKQMTGFGGVVSFEVDGDLFITSKFVDALKIPYIAPSFGG  491

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+++ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  492  CESIVDQPAIMSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI  545



>ref|NP_001275144.1| cystathionine gamma-synthase isoform 2 [Solanum tuberosum]
 gb|AAF74982.1|AF082892_1 cystathionine gamma-synthase isoform 2 [Solanum tuberosum]
Length=540

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP+KLVS VR LHHILGG +NPNAAYLIIRGMKTLHLRVQQQNSTA R+AE+LEAH
Sbjct  367  GCISGPDKLVSAVRTLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSTAQRIAEILEAH  426

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGLPSHPE+H+AK+QMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGG
Sbjct  427  PKVRCVYYPGLPSHPEYHLAKRQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGG  486

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL ++ERA YGIMDNLVRFSFGVEDFED+KAD+LQALE++
Sbjct  487  CESIVDQPAIMSYWDLKESERAKYGIMDNLVRFSFGVEDFEDLKADILQALESM  540



>ref|XP_007032603.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY03529.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 2 [Theobroma cacao]
Length=541

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG EKL++ +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAL+MA+VLEAH
Sbjct  368  GCVSGSEKLITEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALKMAKVLEAH  427

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V+RVYYPGLPSHPEH IAK QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGG
Sbjct  428  PRVKRVYYPGLPSHPEHEIAKLQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGG  487

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQAER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  488  CESIVDQPAIMSYWDLTQAERRKYGIEDNLVRFSFGVEDFEDLKADILQALETI  541



>ref|XP_007032602.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY03528.1| Pyridoxal phosphate-dependent transferases superfamily protein 
isoform 1 [Theobroma cacao]
Length=559

 Score =   333 bits (854),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG EKL++ +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAL+MA+VLEAH
Sbjct  386  GCVSGSEKLITEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALKMAKVLEAH  445

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V+RVYYPGLPSHPEH IAK QMTGFGGVVSFE+DGDLMTT KFVDALKIPYIAPSFGG
Sbjct  446  PRVKRVYYPGLPSHPEHEIAKLQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAPSFGG  505

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQAER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  506  CESIVDQPAIMSYWDLTQAERRKYGIEDNLVRFSFGVEDFEDLKADILQALETI  559



>gb|KJB75684.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=539

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG EKLV+ +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH
Sbjct  365  GCISGSEKLVTEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  424

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V+RVYYPGLPSHPEH IAK+QMTGFGGVVSFE+DGDL TT KFVDALKIPYIAPSFGG
Sbjct  425  PRVKRVYYPGLPSHPEHEIAKRQMTGFGGVVSFEVDGDLTTTIKFVDALKIPYIAPSFGG  484

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVD PAIMSYWDL++AER+ YGI+DNL+RFSFGVEDFED+KAD+LQALE+I
Sbjct  485  CESIVDPPAIMSYWDLSRAERSKYGILDNLIRFSFGVEDFEDLKADILQALESI  538



>emb|CDP02254.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   332 bits (852),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGPEKLVSVVR++HHILGGTLNPNAAYLIIRGMKTL LRV QQNSTA RMAE+LEAH
Sbjct  379  GCISGPEKLVSVVRDMHHILGGTLNPNAAYLIIRGMKTLDLRVHQQNSTASRMAEILEAH  438

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVRRVYYPGL SHPEHH+AK+QMTGFGGVVSFE+DG+L TTAKFVDAL+IPYIAPSFGG
Sbjct  439  PKVRRVYYPGLASHPEHHLAKRQMTGFGGVVSFEVDGELYTTAKFVDALRIPYIAPSFGG  498

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL Q+ERA YGI+DNLVRFSFGVE FED+KAD+LQALETI
Sbjct  499  CESIVDQPAIMSYWDLPQSERAKYGIVDNLVRFSFGVEGFEDLKADILQALETI  552



>ref|XP_010525099.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Tarenaya 
hassleriana]
Length=424

 Score =   328 bits (841),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP KLVS +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRV+QQNSTALRMA++LEAH
Sbjct  251  GCISGPMKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVKQQNSTALRMAQILEAH  310

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH IAK+QMTGFGGVVSFEIDGDL TT KFVDALKIPYIAPSFGG
Sbjct  311  PKVSHVYYPGLPSHPEHDIAKRQMTGFGGVVSFEIDGDLDTTIKFVDALKIPYIAPSFGG  370

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ ER  YGI DNL+RFSFGVEDFEDVKADVLQAL+ I
Sbjct  371  CESIVDQPAIMSYWDLTQEERLKYGIKDNLIRFSFGVEDFEDVKADVLQALDAI  424



>dbj|BAP47509.1| cystathionine gamma-synthase [Gentiana triflora]
Length=553

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGPEK++SV+R LHHI+GG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LE H
Sbjct  380  GCISGPEKVISVIRTLHHIMGGALNPNAAYLIIRGMKTLHLRVQQQNSTASRMAEILEGH  439

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVRRVYYPGL SHPEH +AKKQMTGFGGVVSFE+DGDL+TTAKF+DALKIPYIAPSFGG
Sbjct  440  PKVRRVYYPGLKSHPEHTLAKKQMTGFGGVVSFEVDGDLLTTAKFIDALKIPYIAPSFGG  499

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL QA+RA YGI+DNLVRFSFGVE FED+K D+LQALETI
Sbjct  500  CESIVDQPAIMSYWDLCQADRAKYGILDNLVRFSFGVEVFEDIKNDILQALETI  553



>ref|XP_011098654.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase 
1, chloroplastic [Sesamum indicum]
Length=532

 Score =   329 bits (844),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISGPEKL+S VRNLHHILGG LNPNAAYL+IRGMKTLHLRVQQQNSTA RM E+LEAH
Sbjct  359  GSISGPEKLISAVRNLHHILGGALNPNAAYLLIRGMKTLHLRVQQQNSTAQRMVEILEAH  418

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+RRVYYPGL SHPEH +AKKQM GFGGVVSFE+DGDL+TTAKFVDAL+IPYIAPSFGG
Sbjct  419  PKIRRVYYPGLASHPEHELAKKQMNGFGGVVSFEVDGDLLTTAKFVDALRIPYIAPSFGG  478

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL  +ERA YGI+DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  479  CESIVDQPAIMSYWDLPPSERAKYGILDNLVRFSFGVEDFEDLKADILQALETI  532



>ref|XP_010029311.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW56209.1| hypothetical protein EUGRSUZ_I01959 [Eucalyptus grandis]
Length=558

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KL++ +RNLHH+LGG LNPNAAYLIIRGMKTLHLRV+QQNSTA RMAE+LEAH
Sbjct  385  GCISGSLKLITEIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVKQQNSTAQRMAEILEAH  444

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGLPSHPEH IAKKQMTGFGGVVSFEIDGDLMTT KFVDALKIPYIAPSFGG
Sbjct  445  PKVKRVYYPGLPSHPEHQIAKKQMTGFGGVVSFEIDGDLMTTIKFVDALKIPYIAPSFGG  504

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+QAER +YGI D+LVRFSFGVED ED+KADVLQALE I
Sbjct  505  CESIVDQPAIMSYWDLSQAERVSYGISDSLVRFSFGVEDLEDLKADVLQALEAI  558



>emb|CAA56143.1| CYS1 [Arabidopsis thaliana]
Length=224

 Score =   317 bits (811),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI G  KLVS +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAH
Sbjct  51   GCICGSLKLVSEIRNLHHVLGGPLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAH  110

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGG
Sbjct  111  PKVSHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGG  170

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  171  CESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  224



>ref|XP_006482629.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Citrus 
sinensis]
Length=541

 Score =   327 bits (839),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG EKLV+ +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAH
Sbjct  368  GCISGSEKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAH  427

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RV+YPGL SHPEHHIA +QMTGFGGVVSFE+DGDL  T KF+DALKIPYIAPSFGG
Sbjct  428  PKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGG  487

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q+ER  YGIMDNLVRFSFGVEDFED+KADVLQAL  I
Sbjct  488  CESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI  541



>ref|XP_010550033.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Tarenaya 
hassleriana]
 ref|XP_010550034.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Tarenaya 
hassleriana]
Length=547

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/174 (88%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS VRNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQNSTALRMAE+LEAH
Sbjct  374  GCISGSLKLVSEVRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQNSTALRMAEILEAH  433

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHPEH IAKKQMTGFGGVVSFE+DGD+  T KFVDALKIPYIAPSFGG
Sbjct  434  PKVSRVYYPGLPSHPEHDIAKKQMTGFGGVVSFEVDGDIEKTIKFVDALKIPYIAPSFGG  493

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADV+ AL++I
Sbjct  494  CESIVDQPAIMSYWDLTQEERLKYGIKDNLVRFSFGVEDFEDVKADVIHALDSI  547



>gb|EYU44131.1| hypothetical protein MIMGU_mgv1a002982mg [Erythranthe guttata]
Length=619

 Score =   329 bits (844),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISGPEKL+S VRNLHH+LGG LNPNAAYLIIRGMKTLHLR+QQQNSTA RMAE+LEAH
Sbjct  446  GSISGPEKLISAVRNLHHVLGGALNPNAAYLIIRGMKTLHLRIQQQNSTAQRMAEILEAH  505

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL SHPEHH+AKKQM GFGGVVSFE+DGDL+ TAKFVDAL+IPYIAPSFGG
Sbjct  506  PKISRVYYPGLASHPEHHLAKKQMNGFGGVVSFEVDGDLLITAKFVDALRIPYIAPSFGG  565

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+ +ERA YGIMDNLVRFSFGVEDFED+KAD+LQALE I
Sbjct  566  CESIVDQPAIMSYWDLSPSERAKYGIMDNLVRFSFGVEDFEDLKADILQALEKI  619



>gb|KDP27172.1| hypothetical protein JCGZ_19871 [Jatropha curcas]
Length=540

 Score =   327 bits (837),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K++S +RNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA+RMAEVLEAH
Sbjct  367  GCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAMRMAEVLEAH  426

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR VYYPGLPSHPEHHIAK+QMTGFGGVVSFE+DGDL TT KFVD+LKIPYIAPSFGG
Sbjct  427  PKVRCVYYPGLPSHPEHHIAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAPSFGG  486

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ESIVDQPAIMSYWDLTQ++R +YGI DNLVRFSFGVE FED+KADVLQALE I
Sbjct  487  VESIVDQPAIMSYWDLTQSQRESYGIKDNLVRFSFGVEAFEDLKADVLQALEAI  540



>ref|XP_010670238.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=543

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG +KL+S +RN+HH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN+TALRMAEVLEAH
Sbjct  370  GCISGSKKLISEIRNMHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNTTALRMAEVLEAH  429

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK++ VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDLMTT KFVDALKI YIAPSFGG
Sbjct  430  PKIKCVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDLMTTIKFVDALKIAYIAPSFGG  489

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+ +ER  YGI DNL+RFSFGVEDFED+KAD+LQALE I
Sbjct  490  CESIVDQPAIMSYWDLSPSERLKYGITDNLIRFSFGVEDFEDLKADILQALEAI  543



>ref|XP_007216002.1| hypothetical protein PRUPE_ppa004232mg [Prunus persica]
 gb|EMJ17201.1| hypothetical protein PRUPE_ppa004232mg [Prunus persica]
Length=522

 Score =   324 bits (831),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS +R LHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMA++LEAH
Sbjct  349  GCISGSLKLVSEIRTLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTASRMAKILEAH  408

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGL SHPEH +AK+QMTGFGGVVSFEIDGDLMTT KFVDAL+IPYIAPSFGG
Sbjct  409  PKVARVYYPGLSSHPEHQLAKRQMTGFGGVVSFEIDGDLMTTIKFVDALRIPYIAPSFGG  468

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q+ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  469  CESIVDQPAIMSYWDLSQSERITYGIKDNLVRFSFGVEDFEDLKADILQALETI  522



>ref|XP_008230796.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase, 
chloroplastic-like [Prunus mume]
Length=522

 Score =   323 bits (829),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLV+ +R LHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMA++LEAH
Sbjct  349  GCISGSLKLVTEIRTLHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTASRMAKILEAH  408

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDLMTT KFVDAL+IPYIAPSFGG
Sbjct  409  PKVAHVYYPGLPSHPEHQLAKRQMTGFGGVVSFEIDGDLMTTIKFVDALRIPYIAPSFGG  468

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q+ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  469  CESIVDQPAIMSYWDLSQSERITYGIKDNLVRFSFGVEDFEDLKADILQALETI  522



>ref|XP_006297283.1| hypothetical protein CARUB_v10013298mg, partial [Capsella rubella]
 gb|EOA30181.1| hypothetical protein CARUB_v10013298mg, partial [Capsella rubella]
Length=589

 Score =   325 bits (834),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI GP KLVS +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQNSTA RMAE+LEAH
Sbjct  416  GCICGPLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQNSTAFRMAEILEAH  475

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGG
Sbjct  476  PKVSHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGG  535

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  536  CESIVDQPAIMSYWDLTQEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  589



>emb|CDY43269.1| BnaC05g48620D [Brassica napus]
Length=492

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI GP K+VS +RNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTA RMAE+LEAH
Sbjct  319  GCICGPLKIVSEIRNLHHVLGGTLNPNAAYLMIRGMKTMHLRVQQQNSTASRMAEILEAH  378

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGL SHPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGG
Sbjct  379  PKVSHVYYPGLASHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGG  438

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  439  CESIVDQPAIMSYWDLTQEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  492



>ref|XP_006408463.1| hypothetical protein EUTSA_v10020394mg [Eutrema salsugineum]
 gb|ESQ49916.1| hypothetical protein EUTSA_v10020394mg [Eutrema salsugineum]
Length=568

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI G  K++S +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQNSTA RMAEVLEAH
Sbjct  395  GCICGSLKVISEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQNSTASRMAEVLEAH  454

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGL SHPEHHIAK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGG
Sbjct  455  PKVSHVYYPGLASHPEHHIAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGG  514

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  515  CESIVDQPAIMSYWDLTQEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  568



>emb|CDY37543.1| BnaA05g34080D [Brassica napus]
Length=530

 Score =   322 bits (825),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI GP K+VS +RNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTA RMAE+LEAH
Sbjct  357  GCICGPLKVVSEIRNLHHVLGGTLNPNAAYLMIRGMKTMHLRVQQQNSTASRMAEILEAH  416

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGL SHPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGG
Sbjct  417  PKVSHVYYPGLASHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGG  476

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ ER  YGI DNLVRFSFG+EDFEDVKADVLQALE I
Sbjct  477  CESIVDQPAIMSYWDLTQEERLKYGIKDNLVRFSFGIEDFEDVKADVLQALEAI  530



>ref|XP_010463584.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=560

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI GP +LVS +RNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTA RMAE+LEAH
Sbjct  387  GCICGPLELVSEIRNLHHVLGGTLNPNAAYLLIRGMKTMHLRVQQQNSTAFRMAEILEAH  446

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QM+GFGGVVSFEIDGD+  T KFVDALKIPYIAPSFGG
Sbjct  447  PKVSHVYYPGLPSHPEHELAKRQMSGFGGVVSFEIDGDIERTIKFVDALKIPYIAPSFGG  506

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  507  CESIVDQPAIMSYWDLTQEERMKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  560



>ref|XP_009147397.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Brassica 
rapa]
Length=530

 Score =   322 bits (825),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI GP K+VS +RNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTA RMAE+LEAH
Sbjct  357  GCICGPLKVVSEIRNLHHVLGGTLNPNAAYLMIRGMKTMHLRVQQQNSTASRMAEILEAH  416

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGL SHPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGG
Sbjct  417  PKVSHVYYPGLASHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGG  476

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ ER  YGI DNLVRFSFG+EDFEDVKADVLQALE I
Sbjct  477  CESIVDQPAIMSYWDLTQEERLKYGIKDNLVRFSFGIEDFEDVKADVLQALEAI  530



>ref|XP_010429549.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Camelina 
sativa]
Length=563

 Score =   323 bits (827),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI GP KLVS +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRV+QQNSTA RMAE+LEAH
Sbjct  390  GCICGPLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVKQQNSTAFRMAEILEAH  449

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QM+GFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGG
Sbjct  450  PKVSHVYYPGLPSHPEHELAKRQMSGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGG  509

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  510  CESIVDQPAIMSYWDLTQEERMKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  563



>ref|XP_006431203.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
 gb|ESR44443.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
Length=537

 Score =   322 bits (825),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG  KLV+ +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAH
Sbjct  364  GSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAH  423

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RV+YPGL SHPEHHIA +QMTGFGGVVSFE+DGDL  T KF+DALKIPYIAPSFGG
Sbjct  424  PKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGG  483

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q+ER  YGIMDNLVRFSFGVEDFED+KADVLQAL  I
Sbjct  484  CESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI  537



>ref|XP_006431204.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
 gb|ESR44444.1| hypothetical protein CICLE_v10011434mg [Citrus clementina]
Length=541

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG  KLV+ +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAH
Sbjct  368  GSISGSGKLVTQIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAH  427

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RV+YPGL SHPEHHIA +QMTGFGGVVSFE+DGDL  T KF+DALKIPYIAPSFGG
Sbjct  428  PKVKRVHYPGLKSHPEHHIATQQMTGFGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGG  487

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q+ER  YGIMDNLVRFSFGVEDFED+KADVLQAL  I
Sbjct  488  CESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI  541



>gb|KHN13598.1| Cystathionine gamma-synthase, chloroplastic [Glycine soja]
Length=390

 Score =   317 bits (811),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K+VS +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMAE+LEAH
Sbjct  217  GCISGSTKVVSQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAELLEAH  276

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDL TT KF+D+LKIPYIA SFGG
Sbjct  277  PKVKRVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDLHTTIKFIDSLKIPYIAASFGG  336

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAI+SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  337  CESIVDQPAILSYWDLPQSERAKYKIYDNLVRFSFGVEDFEDLKADVLQALEAI  390



>ref|NP_186761.1| cystathionine gamma-synthase [Arabidopsis thaliana]
 sp|P55217.3|CGS1_ARATH RecName: Full=Cystathionine gamma-synthase 1, chloroplastic; 
Short=AtCGS1; AltName: Full=METHIONINE OVERACCUMULATION 1; AltName: 
Full=O-succinylhomoserine (thiol)-lyase; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF26162.1|AC008261_19 putative cystathionine gamma-synthase [Arabidopsis thaliana]
 gb|AAB41235.1| cystathionine gamma-synthase [Arabidopsis thaliana]
 dbj|BAA24699.1| cystathionine gamma-synthase [Arabidopsis thaliana]
 gb|AAM19810.1| AT3g01120/T4P13_19 [Arabidopsis thaliana]
 gb|AAO22582.1| putative cystathionine gamma-synthase [Arabidopsis thaliana]
 gb|AEE73612.1| cystathionine gamma-synthase [Arabidopsis thaliana]
Length=563

 Score =   322 bits (825),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI G  KLVS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAH
Sbjct  390  GCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAH  449

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGG
Sbjct  450  PKVSHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGG  509

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  510  CESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  563



>emb|CAA64383.1| cystathionine gamma-synthase [Arabidopsis thaliana]
Length=563

 Score =   322 bits (825),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/174 (86%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI G  KLVS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAH
Sbjct  390  GCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAH  449

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGG
Sbjct  450  PKVSHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGG  509

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  510  CESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  563



>ref|XP_010485423.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Camelina 
sativa]
Length=562

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI GP +LVS +RNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTA RMAE+LEAH
Sbjct  389  GCICGPIELVSEIRNLHHVLGGTLNPNAAYLLIRGMKTMHLRVQQQNSTAFRMAEILEAH  448

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QM+GFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGG
Sbjct  449  PKVSHVYYPGLPSHPEHELAKRQMSGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGG  508

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDLTQ ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  509  CESIVDQPAIMSYWDLTQEERMKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  562



>gb|KCW56210.1| hypothetical protein EUGRSUZ_I01959 [Eucalyptus grandis]
Length=556

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 161/174 (93%), Gaps = 2/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KL++ +RNLHH+LGG LNPNAAYLIIRGMKTLHLRV+QQNSTA RMAE+LEAH
Sbjct  385  GCISGSLKLITEIRNLHHVLGGALNPNAAYLIIRGMKTLHLRVKQQNSTAQRMAEILEAH  444

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK  RVYYPGLPSHPEH IAKKQMTGFGGVVSFEIDGDLMTT KFVDALKIPYIAPSFGG
Sbjct  445  PK--RVYYPGLPSHPEHQIAKKQMTGFGGVVSFEIDGDLMTTIKFVDALKIPYIAPSFGG  502

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+QAER +YGI D+LVRFSFGVED ED+KADVLQALE I
Sbjct  503  CESIVDQPAIMSYWDLSQAERVSYGISDSLVRFSFGVEDLEDLKADVLQALEAI  556



>gb|KHN11627.1| Cystathionine gamma-synthase, chloroplastic [Glycine soja]
Length=311

 Score =   313 bits (801),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K+VS +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAH
Sbjct  138  GCISGSIKVVSQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAH  197

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDL TT KF+D+LKIPYIA SFGG
Sbjct  198  PKVKRVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDLHTTIKFIDSLKIPYIAASFGG  257

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAI+SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  258  CESIVDQPAILSYWDLPQSERAKYKIYDNLVRFSFGVEDFEDLKADVLQALEAI  311



>gb|AAM13883.1| putative cystathionine gamma-synthase [Arabidopsis thaliana]
Length=563

 Score =   320 bits (821),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI G  KLVS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAH
Sbjct  390  GCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAH  449

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGG
Sbjct  450  PKVSHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGG  509

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL Q ER  YGI DNLVRFSFGV+DFEDVKAD+LQALE I
Sbjct  510  CESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVKDFEDVKADILQALEAI  563



>ref|XP_008368433.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Malus 
domestica]
Length=523

 Score =   319 bits (817),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS +R LHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAH
Sbjct  350  GCISGSMKLVSEIRILHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAH  409

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDL  T  FVDALKIPYIAPSFGG
Sbjct  410  PKVAHVYYPGLPSHPEHQLAKRQMTGFGGVVSFEIDGDLTRTINFVDALKIPYIAPSFGG  469

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++R  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  470  CESIVDQPAIMSYWDLSQSDRIKYGIKDNLVRFSFGVEDFEDLKADILQALETI  523



>gb|AAC49574.1| similar to the metB gene product of Escherichia coli; cloned 
by functional complementation of a metB mutant strain of Escherichia 
coli LE392 [Arabidopsis thaliana]
Length=563

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI G  KLVS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAH
Sbjct  390  GCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAH  449

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYP LPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGG
Sbjct  450  PKVSHVYYPALPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGG  509

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  510  CESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  563



>gb|EYU34642.1| hypothetical protein MIMGU_mgv1a004543mg [Erythranthe guttata]
Length=521

 Score =   318 bits (816),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG EKL+S VR LH+I+GG LNPNAAYLIIRGMKTLHLR+QQQNSTA RMAE+LEAH
Sbjct  348  GSISGSEKLISTVRVLHNIIGGALNPNAAYLIIRGMKTLHLRIQQQNSTAQRMAEILEAH  407

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL SHPEH++AK+QM+GFGGVVSFE+DGDL+TT+KF+DAL+IPYIAPSFGG
Sbjct  408  PKITRVYYPGLVSHPEHNLAKRQMSGFGGVVSFEVDGDLLTTSKFIDALRIPYIAPSFGG  467

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q ERA YGIMDNLVRFSFGVEDFED+K D+LQALE I
Sbjct  468  CESIVDQPAIMSYWDLSQKERAKYGIMDNLVRFSFGVEDFEDLKTDILQALEKI  521



>ref|XP_009360603.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Pyrus 
x bretschneideri]
Length=521

 Score =   318 bits (815),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS +R LHHILGG LNPNAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAH
Sbjct  348  GCISGSMKLVSEIRILHHILGGALNPNAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAH  407

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDL  T  FVDALKIPYIAPSFGG
Sbjct  408  PKVAHVYYPGLPSHPEHQLAKRQMTGFGGVVSFEIDGDLTRTINFVDALKIPYIAPSFGG  467

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++R  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  468  CESIVDQPAIMSYWDLSQSDRIKYGIKDNLVRFSFGVEDFEDLKADILQALETI  521



>ref|XP_002882199.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58458.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. 
lyrata]
Length=564

 Score =   319 bits (818),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI G  KLVS +RNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAH
Sbjct  391  GCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAH  450

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGL SHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGG
Sbjct  451  PKVSHVYYPGLASHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGG  510

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  511  CESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  564



>gb|AAC25687.1| cystathionine gamma-synthase precursor [Arabidopsis thaliana]
Length=563

 Score =   319 bits (818),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI G  KLVS +RNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMAE+LEAH
Sbjct  390  GCICGSLKLVSEIRNLHHVLGGPLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAH  449

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIAPSFGG
Sbjct  450  PKVSHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAPSFGG  509

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL Q ER  YGI DNLVRFSFGVEDFEDVKAD+LQALE I
Sbjct  510  CESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI  563



>ref|XP_003552541.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Glycine 
max]
Length=535

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K+VS +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMAE+LEAH
Sbjct  362  GCISGSTKVVSQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAELLEAH  421

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDL TT KF+D+LKIPYIA SFGG
Sbjct  422  PKVKRVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDLHTTIKFIDSLKIPYIAASFGG  481

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAI+SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  482  CESIVDQPAILSYWDLPQSERAKYKIYDNLVRFSFGVEDFEDLKADVLQALEAI  535



>gb|AAC19395.1| cystathionine gamma-synthase [Mesembryanthemum crystallinum]
Length=548

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG + L+S +R  HH+LGGTLNPNAAYL+IRGMKTLHLRVQQQN+TALRMAE+LEAH
Sbjct  375  GCISGSKNLISTIRTFHHVLGGTLNPNAAYLMIRGMKTLHLRVQQQNTTALRMAEILEAH  434

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+ VYYPGLPSHPEH +AK+QMTGFGGVVSFE+DGDL+TTAKFVD+LKI YIAPSFGG
Sbjct  435  PKVKHVYYPGLPSHPEHKLAKRQMTGFGGVVSFEVDGDLLTTAKFVDSLKIAYIAPSFGG  494

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+ ++R  YGI DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  495  CESIVDQPAIMSYWDLSPSDRLKYGIKDNLVRFSFGVEDFEDLKADVLQALEAI  548



>emb|CDX91962.1| BnaC03g32640D [Brassica napus]
Length=483

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI GP K+VS +RNLHH++GGTLNPNAAYLIIRGMKT+HLRVQQQNSTA RMAE+LEAH
Sbjct  310  GCICGPLKVVSEIRNLHHVMGGTLNPNAAYLIIRGMKTMHLRVQQQNSTASRMAEILEAH  369

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGL +HPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGG
Sbjct  370  PKVSHVYYPGLANHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGG  429

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL   ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  430  CESIVDQPAIMSYWDLAPEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  483



>emb|CDX74285.1| BnaA03g27620D [Brassica napus]
Length=544

 Score =   316 bits (810),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI GP K+VS +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQNSTA RMAE+LEAH
Sbjct  371  GCICGPLKVVSEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQNSTASRMAEILEAH  430

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGL +HPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGG
Sbjct  431  PKVSHVYYPGLANHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGG  490

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL   ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  491  CESIVDQPAIMSYWDLAPEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  544



>ref|XP_009134628.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Brassica 
rapa]
Length=545

 Score =   316 bits (810),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI GP K+VS +RNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQNSTA RMAE+LEAH
Sbjct  372  GCICGPLKVVSEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQNSTASRMAEILEAH  431

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGL +HPEHHIAK+QMTGFGGVVSFEIDGD+  T KFVD+LKIPYIAPSFGG
Sbjct  432  PKVSHVYYPGLANHPEHHIAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAPSFGG  491

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL   ER  YGI DNLVRFSFGVEDFEDVKADVLQALE I
Sbjct  492  CESIVDQPAIMSYWDLAPEERLKYGIKDNLVRFSFGVEDFEDVKADVLQALEAI  545



>ref|NP_001237572.1| cystathionine-gamma-synthase precursor [Glycine max]
 gb|AAD34548.1|AF141602_1 cystathionine-gamma-synthase precursor [Glycine max]
Length=536

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K+VS +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAH
Sbjct  363  GCISGSIKVVSQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAH  422

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDL TT KF+D+LKIPYIA SFGG
Sbjct  423  PKVKRVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDLHTTIKFIDSLKIPYIAASFGG  482

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAI+SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  483  CESIVDQPAILSYWDLPQSERAKYKIYDNLVRFSFGVEDFEDLKADVLQALEAI  536



>ref|XP_008443381.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Cucumis 
melo]
Length=544

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP KLVS +RNLHH++GG LNPNAAYLIIRGMKT+HLRVQQQNS+ L+MA +LEAH
Sbjct  371  GCISGPLKLVSEIRNLHHVIGGALNPNAAYLIIRGMKTMHLRVQQQNSSGLKMARLLEAH  430

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK++ VYYPGLPSHPEH +AK+QMTGFGGVVSFE+DGDL TTAKF+D+LKIPYIAPSFGG
Sbjct  431  PKIKCVYYPGLPSHPEHSLAKRQMTGFGGVVSFEVDGDLTTTAKFIDSLKIPYIAPSFGG  490

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWDL Q ER  YGI DNLVRFS G+EDFED+KAD+LQAL+ I
Sbjct  491  CESIIDQPAIMSYWDLNQTERLKYGIKDNLVRFSIGIEDFEDLKADILQALDAI  544



>ref|XP_004136690.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN59542.1| hypothetical protein Csa_3G824870 [Cucumis sativus]
Length=543

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS +RNLHH++GG LNPNAAYLIIRGMKT+HLRVQQQNS+ L+MA +LEAH
Sbjct  370  GCISGSLKLVSEIRNLHHVIGGALNPNAAYLIIRGMKTMHLRVQQQNSSGLKMAMLLEAH  429

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK++ VYYPGLPSHPEH++AK+QMTGFGGVVSFE+DGDLMTTAKF+D+LKIPYIAPSFGG
Sbjct  430  PKIKCVYYPGLPSHPEHNLAKRQMTGFGGVVSFEVDGDLMTTAKFIDSLKIPYIAPSFGG  489

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWDL Q ER  YGI DNLVRFS G+EDFED+KAD+LQAL+ I
Sbjct  490  CESIIDQPAIMSYWDLNQTERLKYGIKDNLVRFSIGIEDFEDLKADILQALDAI  543



>ref|XP_010258325.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Nelumbo 
nucifera]
Length=535

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH
Sbjct  361  GCISGSAKLVSEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  420

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGL SHP+HHIAKKQM+GFGGVVSFEIDGD   T KF+D+LKIPYIAPSFGG
Sbjct  421  PKVTRVYYPGLASHPDHHIAKKQMSGFGGVVSFEIDGDFEKTKKFIDSLKIPYIAPSFGG  480

Query  361  CESIVDQPAIMSYWDLTQAERA-AYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPA+MSYWDL QAER   + I DNLVRFS GVEDFED+KADVLQALE I
Sbjct  481  CESIVDQPALMSYWDLNQAERTNEFSIRDNLVRFSVGVEDFEDLKADVLQALENI  535



>ref|XP_007139535.1| hypothetical protein PHAVU_008G038100g [Phaseolus vulgaris]
 gb|ESW11529.1| hypothetical protein PHAVU_008G038100g [Phaseolus vulgaris]
Length=540

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K+VS +R  HHILGGTLNPNAAYL+IRGMKTLHLRVQQQNST + MA++LEAH
Sbjct  367  GCISGSTKVVSQIRTFHHILGGTLNPNAAYLLIRGMKTLHLRVQQQNSTGMGMAKILEAH  426

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGD+ TT KFVD+LKIPYIA SFGG
Sbjct  427  PKVKRVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDIHTTIKFVDSLKIPYIAASFGG  486

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAI+SYWDL Q+ERA Y I DNLVRFSFGVEDFED+KADVLQALE I
Sbjct  487  CESIVDQPAILSYWDLPQSERAKYKIHDNLVRFSFGVEDFEDLKADVLQALEAI  540



>ref|NP_001266947.1| cystathionine gamma-synthase, chloroplastic-like [Fragaria vesca]
 emb|CAA04772.2| cystathionine gamma synthase [Fragaria vesca]
 emb|CAB57356.1| cystathionine gamma synthase [Fragaria vesca]
Length=545

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS +R LHHILGG LNPNAAYLIIRGMKTLH+R+QQQNSTALRMA++LEAH
Sbjct  372  GCISGSMKLVSEIRILHHILGGALNPNAAYLIIRGMKTLHIRIQQQNSTALRMAKILEAH  431

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV  VYYPGLPSHPEH +AK+QMTGFGGVVSFEIDGDL  T KF+DALKIPYIAPSFGG
Sbjct  432  PKVAHVYYPGLPSHPEHELAKRQMTGFGGVVSFEIDGDLKRTIKFIDALKIPYIAPSFGG  491

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++R  YGI DNLVRFSFG+EDF D+KAD+LQALE I
Sbjct  492  CESIVDQPAIMSYWDLSQSDRLKYGIKDNLVRFSFGIEDFNDLKADILQALEKI  545



>gb|AGF95116.1| cystathionine gamma synthase, partial [Prunus persica]
Length=157

 Score =   298 bits (764),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  52   HILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEH  231
            HILGG LNPNAAYLIIRGMKTLHLRVQQQNSTA RMA++LEAHPKV RVYYPGL SHPEH
Sbjct  1    HILGGALNPNAAYLIIRGMKTLHLRVQQQNSTASRMAKILEAHPKVARVYYPGLSSHPEH  60

Query  232  HIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLT  411
             +AK+QMTGFGGVVSFEIDGDLMTT KFVDAL+IPYIAPSFGGCESIVDQPAIMSYWDL+
Sbjct  61   QLAKRQMTGFGGVVSFEIDGDLMTTIKFVDALRIPYIAPSFGGCESIVDQPAIMSYWDLS  120

Query  412  QAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            Q+ER  YGI DNLVRFSFGVEDFED+KAD+LQALETI
Sbjct  121  QSERITYGIKDNLVRFSFGVEDFEDLKADILQALETI  157



>ref|NP_001265950.1| cystathionine gamma-synthase, chloroplastic-like [Cicer arietinum]
 gb|AGA60136.1| cystathionine gamma-synthase [Cicer arietinum]
Length=534

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG +KL+S +R LHHILGG LNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAH
Sbjct  361  GCISGSDKLISQIRILHHILGGALNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAH  420

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGLPSHPEH +A +QMTGFGGVVSFEIDGDL TT KFVD+LKIPYIA SFGG
Sbjct  421  PKVKRVYYPGLPSHPEHELAMRQMTGFGGVVSFEIDGDLTTTIKFVDSLKIPYIAASFGG  480

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAI+SYWDL  +ERA Y I DNLVRFSFGVEDFED+KAD+LQALE I
Sbjct  481  CESIVDQPAILSYWDLPASERAKYKIYDNLVRFSFGVEDFEDLKADILQALEAI  534



>ref|XP_006858075.1| hypothetical protein AMTR_s00062p00067400 [Amborella trichopoda]
 gb|ERN19542.1| hypothetical protein AMTR_s00062p00067400 [Amborella trichopoda]
Length=520

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG +KLV  VR LHH+LGG LNPNAAY+IIRGMKTLHLRVQQ N TA+RMA +LEAH
Sbjct  347  GCISGSKKLVETVRALHHVLGGVLNPNAAYMIIRGMKTLHLRVQQHNLTAMRMARLLEAH  406

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIA +QMTGFGGVVSFE+ GDL TTAKFVDALKIPYIAPSFGG
Sbjct  407  PKITRVYYPGLPSHPEHHIASRQMTGFGGVVSFEVAGDLNTTAKFVDALKIPYIAPSFGG  466

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWDL+  ERA YGI DNLVRFS G+EDFED++ DVLQAL++I
Sbjct  467  CESIIDQPAIMSYWDLSPVERAQYGIKDNLVRFSLGIEDFEDLRMDVLQALDSI  520



>ref|XP_010937206.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Elaeis guineensis]
Length=541

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG E+L+S +R  H+++GG LNPNAAY+I+RGMKTLHLRVQQQN TALRMA+ LE H
Sbjct  368  GCLSGSEELISKIRQYHNVIGGVLNPNAAYMILRGMKTLHLRVQQQNHTALRMAQFLEEH  427

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK+QMTGFGGVVSFE+ GDL TT KF+D+LKIPYIAPSFGG
Sbjct  428  PKITRVYYPGLPSHPEHHIAKQQMTGFGGVVSFEVAGDLRTTMKFIDSLKIPYIAPSFGG  487

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+ +ERA YGI D+LVRFSFGVEDFED+KAD++QALE I
Sbjct  488  CESIVDQPAIMSYWDLSSSERATYGIKDSLVRFSFGVEDFEDLKADIVQALENI  541



>ref|XP_010939832.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Elaeis 
guineensis]
Length=539

 Score =   306 bits (785),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG E+L+S +   HH++GG LNPNAAY+I+RGMKTLHLRVQQQN TALRMA+ LE H
Sbjct  366  GCISGSEELISKICLYHHVIGGVLNPNAAYMILRGMKTLHLRVQQQNHTALRMAQFLEEH  425

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK+QMTGFGGVVSFE+ GDL TT KFVD+LKIPY+APSFGG
Sbjct  426  PKIIRVYYPGLPSHPEHHIAKQQMTGFGGVVSFEVAGDLRTTMKFVDSLKIPYVAPSFGG  485

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+ +ERA YGI DNLVRFSFGVEDFED+KAD++QALE+I
Sbjct  486  CESIVDQPAIMSYWDLSASERATYGIKDNLVRFSFGVEDFEDLKADIVQALESI  539



>ref|XP_010495203.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=418

 Score =   303 bits (775),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS +R LH +LGGTLN NAAYL+IRGMKT+HLRVQQQNSTALRMA++LE H
Sbjct  234  GCISGSTKLVSEIRKLHRVLGGTLNSNAAYLLIRGMKTMHLRVQQQNSTALRMAQILETH  293

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHP+HHIAK+QMTGFGGVVSFE+ GDL TT KF+D+LKIPYIA SFGG
Sbjct  294  PKVSRVYYPGLPSHPDHHIAKRQMTGFGGVVSFEVAGDLGTTIKFIDSLKIPYIATSFGG  353

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+VDQPAI SYWDL Q ER  +GI DNLVRFSFGVEDF+DVKAD+L ALE I
Sbjct  354  CESLVDQPAISSYWDLPQEERLKHGIKDNLVRFSFGVEDFDDVKADILNALEVI  407



>gb|ABI34092.1| cystathionine gamma-synthase [Medicago sativa]
Length=536

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  K+VS +R LHH+LGGTLNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAH
Sbjct  363  GCISGSIKVVSQIRTLHHVLGGTLNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAH  422

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGLPSHPEH +A +QMTGFGGVVSFEIDGD+ TT KF+D+LKIPYIA SFGG
Sbjct  423  PKVKRVYYPGLPSHPEHELAMRQMTGFGGVVSFEIDGDITTTIKFIDSLKIPYIAASFGG  482

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAI+SYWDL  +ERA + I DNLVRFSFG+EDFED+KADVLQALE I
Sbjct  483  CESIVDQPAILSYWDLPASERAKWKIYDNLVRFSFGIEDFEDLKADVLQALEAI  536



>ref|XP_010453667.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
 ref|XP_010453668.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=520

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG  +LVS VRNLHH+LGGTLNPNAAYL+IRGMKT+HLRVQQQNSTALRMA++LE H
Sbjct  319  GCVSGLMELVSEVRNLHHVLGGTLNPNAAYLLIRGMKTMHLRVQQQNSTALRMAQILETH  378

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVRRVYYPGLPSHP+HHIAK+QMTGFGGVV+FEI GDL +T  FVD+LKIPYIA SFGG
Sbjct  379  PKVRRVYYPGLPSHPDHHIAKRQMTGFGGVVTFEIAGDLGSTINFVDSLKIPYIATSFGG  438

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+VDQPAI SYWDL Q ER  +GI DNLVRFSFGVEDF+DVKAD+L ALE I
Sbjct  439  CESLVDQPAISSYWDLPQEERPKHGIKDNLVRFSFGVEDFDDVKADILHALEVI  492



>ref|XP_003621272.1| Cystathionine gamma-synthase [Medicago truncatula]
 gb|AES77490.1| cystathionine gamma-synthase [Medicago truncatula]
Length=535

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KL+S +R LHHILGG LNPNAAYL IRGMKTLHLRVQQQNST +RMA++LEAH
Sbjct  362  GCISGSLKLISEIRILHHILGGALNPNAAYLFIRGMKTLHLRVQQQNSTGMRMAKLLEAH  421

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGLPSHPEH +A +QMTGFGGVVSFEIDGD+ TT KF+D+LKIPYIA SFGG
Sbjct  422  PKVKRVYYPGLPSHPEHELAMRQMTGFGGVVSFEIDGDITTTIKFIDSLKIPYIAASFGG  481

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAI+SYWDL  +ERA + I DNLVRFSFG+EDFED+KADVLQALE I
Sbjct  482  CESIVDQPAILSYWDLPASERAKWKIYDNLVRFSFGIEDFEDLKADVLQALEAI  535



>gb|AGA60137.1| cystathionine gamma-synthase [Lens culinaris]
Length=535

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG +KL+S +R LHHILGG LNPNAAYL IRG+KTLHLRVQQQNST + MA+ LEAH
Sbjct  362  GCISGSDKLISEIRILHHILGGVLNPNAAYLFIRGLKTLHLRVQQQNSTGMGMAKFLEAH  421

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGLPSHPEH +A +QMTGFGGVVSFEIDGDL TT KFVD+LKIPYIAPSFGG
Sbjct  422  PKVKRVYYPGLPSHPEHELAMRQMTGFGGVVSFEIDGDLETTIKFVDSLKIPYIAPSFGG  481

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAI+SYWDL  +ERA + I DNLVRFSFG+EDFED+KAD++QALE I
Sbjct  482  CESIVDQPAILSYWDLPASERAKWKIYDNLVRFSFGIEDFEDLKADIVQALEVI  535



>ref|NP_001274915.1| cystathionine-gamma-synthase [Solanum tuberosum]
 gb|AAD31520.2|AF144102_1 cystathionine-gamma-synthase [Solanum tuberosum]
Length=583

 Score =   304 bits (779),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGPEKLVSV+RNLHHILGG LNPNAAYL IRG    HLR   +    LRMAE+LEAH
Sbjct  367  GCISGPEKLVSVIRNLHHILGGALNPNAAYLAIRGRGLNHLRDSTKIQLHLRMAEILEAH  426

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+ VYYPGLPSHPE+H+AKKQMTGFGGVVSFE+DGDL+TTAKFVDAL+IP IAPSF G
Sbjct  427  PKVKHVYYPGLPSHPEYHLAKKQMTGFGGVVSFEVDGDLLTTAKFVDALRIPKIAPSFEG  486

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            C+SIVDQPAIMSYWDL+Q++RA YGI+DNLVRFSFGVEDFEDVKADVLQAL++I
Sbjct  487  CKSIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI  540



>ref|XP_009409044.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=541

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG E+L+S +   HH++GG LNPNAAY+I+RGMKTLHLRVQ QNSTALRMA+ LE H
Sbjct  367  GCISGSEELISKISLHHHVIGGVLNPNAAYMILRGMKTLHLRVQNQNSTALRMAQFLEEH  426

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK+QMTGFGGVVSFE+ GDL TT KFVD+LKIPYIAPSFGG
Sbjct  427  PKIIRVYYPGLPSHPEHHIAKRQMTGFGGVVSFEVAGDLNTTKKFVDSLKIPYIAPSFGG  486

Query  361  CESIVDQPAIMSYWDLTQAERAA-YGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+ +ER A YGI DNLVRFSFGVE FED+KAD+LQALE I
Sbjct  487  CESIVDQPAIMSYWDLSGSERVAKYGIKDNLVRFSFGVEGFEDLKADILQALEKI  541



>ref|XP_010424106.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=421

 Score =   296 bits (759),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 155/177 (88%), Gaps = 3/177 (2%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNP---NAAYLIIRGMKTLHLRVQQQNSTALRMAEVL  171
            GCISG  KLVS +R LHH+LGGTLN    +AAYL+IRGMKT+HLRVQ+QNSTAL+MA+VL
Sbjct  234  GCISGSTKLVSEIRKLHHVLGGTLNSVKVHAAYLLIRGMKTMHLRVQEQNSTALKMAQVL  293

Query  172  EAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPS  351
            E HPKV RVYYPGLPSHP+HHIAK+QMTGFGGVVSFEI GDL TT KF+D+LKIPYIA S
Sbjct  294  ETHPKVSRVYYPGLPSHPDHHIAKRQMTGFGGVVSFEIAGDLGTTIKFIDSLKIPYIATS  353

Query  352  FGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            FGGCES+VDQPAI SYWDL Q ER  +GI DNLVRFSFGVEDF+DVKAD+L ALE I
Sbjct  354  FGGCESLVDQPAISSYWDLPQEERPKHGIKDNLVRFSFGVEDFDDVKADILHALEVI  410



>ref|XP_006400053.1| hypothetical protein EUTSA_v10015332mg [Eutrema salsugineum]
 gb|ESQ41506.1| hypothetical protein EUTSA_v10015332mg [Eutrema salsugineum]
Length=416

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+ G  +LVS VR++H++LGG LNPNAAYL+IRG+KT+HLR++QQNSTALRMA VLEAH
Sbjct  242  GCVCGSMELVSKVRDMHYVLGGMLNPNAAYLLIRGIKTMHLRLKQQNSTALRMAHVLEAH  301

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFE-IDGDLMTTAKFVDALKIPYIAPSFG  357
            PKV RVYYPGLPSHPEHHIAK+QMTGFGGVVSFE I GDL  T KFVD+LKIPYIAPSFG
Sbjct  302  PKVSRVYYPGLPSHPEHHIAKRQMTGFGGVVSFEIITGDLEITIKFVDSLKIPYIAPSFG  361

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            GCESIVDQPAIMSYW+L + ER  +GI  NLVRFSFGVEDF+DVKADVLQAL+TI
Sbjct  362  GCESIVDQPAIMSYWNLPEEERLTHGIKVNLVRFSFGVEDFDDVKADVLQALDTI  416



>emb|CDX90997.1| BnaC02g06000D [Brassica napus]
Length=490

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 157/192 (82%), Gaps = 18/192 (9%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+ G  +LVS +RNLHH+LGGTLNPNAAYL+IRG+KT+HLR++QQNSTALRMA+VLEAH
Sbjct  299  GCVCGSMELVSAIRNLHHVLGGTLNPNAAYLLIRGIKTMHLRLKQQNSTALRMAQVLEAH  358

Query  181  PK------------------VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTT  306
            PK                  V RVYYPGL SHPEHHIAK+QM GFGGVVSFEI GDL TT
Sbjct  359  PKALYFPPKKPFFLYIYIFLVSRVYYPGLISHPEHHIAKRQMNGFGGVVSFEIAGDLETT  418

Query  307  AKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFED  486
             KFVD+L IPYIAPSFGGCESIVDQPAIMSYWDL Q ER  YGI DNLVRFSFG+EDF+D
Sbjct  419  IKFVDSLNIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGIEDFDD  478

Query  487  VKADVLQALETI  522
            VKADVLQAL TI
Sbjct  479  VKADVLQALGTI  490



>emb|CDX69530.1| BnaA10g18790D [Brassica napus]
Length=362

 Score =   293 bits (749),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 155/173 (90%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS +RN+H++LGGTL+PNAAYL+IRG+KT+HLRV+QQNSTALRMA VLEAH
Sbjct  174  GCISGSMKLVSEIRNMHNLLGGTLSPNAAYLLIRGIKTMHLRVKQQNSTALRMAHVLEAH  233

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLP+HPEHHIAK+QMTGFGG+V+FEIDGDL TT KF+D+LKIPYIA SFGG
Sbjct  234  PKVSRVYYPGLPNHPEHHIAKRQMTGFGGLVTFEIDGDLETTIKFIDSLKIPYIATSFGG  293

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET  519
            CES VDQPA  + WD+ Q ER  YG  DNLVRFSFGVEDFED+KAD+LQALET
Sbjct  294  CESFVDQPATRN-WDVPQEERLKYGHKDNLVRFSFGVEDFEDLKADILQALET  345



>ref|XP_009122874.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Brassica 
rapa]
Length=439

 Score =   292 bits (748),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 155/173 (90%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KLVS +R +H++LGGTL+PNAAYL+IRG+KT+HLRV+QQNSTALRMA VLEAH
Sbjct  251  GCISGSMKLVSEIRIMHNLLGGTLSPNAAYLLIRGIKTMHLRVKQQNSTALRMAHVLEAH  310

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLP+HPEHHIAK+QMTGFGG+V+FEIDGDL TT KF+D+LKIPYIA SFGG
Sbjct  311  PKVSRVYYPGLPNHPEHHIAKRQMTGFGGLVTFEIDGDLETTIKFIDSLKIPYIATSFGG  370

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET  519
            CES VDQPA  + WD+ Q ER  YG+ DNLVRFSFGVEDFED+KAD+LQALET
Sbjct  371  CESFVDQPATRN-WDVPQEERLKYGLKDNLVRFSFGVEDFEDLKADILQALET  422



>ref|XP_006400056.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
 gb|ESQ41509.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
Length=285

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG  K++S +R LH++LGGTLNPNAAYL+IR MKT+HLRV+QQNSTALRMA+VLEAH
Sbjct  95   GYISGSMKMISEIRILHNLLGGTLNPNAAYLLIRSMKTMHLRVKQQNSTALRMAQVLEAH  154

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHPEHHIAK+QMTGFGG+V+FEI GDL TT KFVD+LKIPYIA SFGG
Sbjct  155  PKVSRVYYPGLPSHPEHHIAKRQMTGFGGLVTFEIAGDLETTFKFVDSLKIPYIATSFGG  214

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES VDQPA  + W++ Q ER  YG+ DNLVRFSFGVEDF+D+KAD+LQALETI
Sbjct  215  CESFVDQPAARN-WEVPQEERLKYGLKDNLVRFSFGVEDFDDLKADILQALETI  267



>gb|KDO72635.1| hypothetical protein CISIN_1g0091671mg, partial [Citrus sinensis]
Length=148

 Score =   280 bits (716),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 130/148 (88%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +1

Query  79   NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG  258
            NAAYLIIRGMKTLHLRVQQQNSTALRMAE+LEAHPKV+RV+YPGL SHPEHHIA +QMTG
Sbjct  1    NAAYLIIRGMKTLHLRVQQQNSTALRMAEILEAHPKVKRVHYPGLKSHPEHHIATQQMTG  60

Query  259  FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGI  438
            FGGVVSFE+DGDL  T KF+DALKIPYIAPSFGGCESIVDQPAIMSYWDL+Q+ER  YGI
Sbjct  61   FGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGI  120

Query  439  MDNLVRFSFGVEDFEDVKADVLQALETI  522
            MDNLVRFSFGVEDFED+KADVLQAL  I
Sbjct  121  MDNLVRFSFGVEDFEDLKADVLQALHAI  148



>ref|XP_006400055.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
 gb|ESQ41508.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
Length=346

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG  K++S +R LH++LGGTLNPNAAYL+IR MKT+HLRV+QQNSTALRMA+VLEAH
Sbjct  156  GYISGSMKMISEIRILHNLLGGTLNPNAAYLLIRSMKTMHLRVKQQNSTALRMAQVLEAH  215

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHPEHHIAK+QMTGFGG+V+FEI GDL TT KFVD+LKIPYIA SFGG
Sbjct  216  PKVSRVYYPGLPSHPEHHIAKRQMTGFGGLVTFEIAGDLETTFKFVDSLKIPYIATSFGG  275

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES VDQPA  + W++ Q ER  YG+ DNLVRFSFGVEDF+D+KAD+LQALETI
Sbjct  276  CESFVDQPAARN-WEVPQEERLKYGLKDNLVRFSFGVEDFDDLKADILQALETI  328



>gb|KDO72629.1| hypothetical protein CISIN_1g0091673mg, partial [Citrus sinensis]
 gb|KDO72630.1| hypothetical protein CISIN_1g0091673mg, partial [Citrus sinensis]
 gb|KDO72631.1| hypothetical protein CISIN_1g0091673mg, partial [Citrus sinensis]
Length=148

 Score =   278 bits (712),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +1

Query  79   NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG  258
            NAAYLIIRGMKTLHLRVQQQNSTALRMA++LEAHPKV+RV+YPGL SHPEHHIA +QMTG
Sbjct  1    NAAYLIIRGMKTLHLRVQQQNSTALRMAKILEAHPKVKRVHYPGLKSHPEHHIATQQMTG  60

Query  259  FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGI  438
            FGGVVSFE+DGDL  T KF+DALKIPYIAPSFGGCESIVDQPAIMSYWDL+Q+ER  YGI
Sbjct  61   FGGVVSFEVDGDLTATIKFIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGI  120

Query  439  MDNLVRFSFGVEDFEDVKADVLQALETI  522
            MDNLVRFSFGVEDFED+KADVLQAL  I
Sbjct  121  MDNLVRFSFGVEDFEDLKADVLQALHAI  148



>ref|XP_006400054.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
 gb|ESQ41507.1| hypothetical protein EUTSA_v10013649mg [Eutrema salsugineum]
Length=422

 Score =   287 bits (734),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG  K++S +R LH++LGGTLNPNAAYL+IR MKT+HLRV+QQNSTALRMA+VLEAH
Sbjct  232  GYISGSMKMISEIRILHNLLGGTLNPNAAYLLIRSMKTMHLRVKQQNSTALRMAQVLEAH  291

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHPEHHIAK+QMTGFGG+V+FEI GDL TT KFVD+LKIPYIA SFGG
Sbjct  292  PKVSRVYYPGLPSHPEHHIAKRQMTGFGGLVTFEIAGDLETTFKFVDSLKIPYIATSFGG  351

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES VDQPA  + W++ Q ER  YG+ DNLVRFSFGVEDF+D+KAD+LQALETI
Sbjct  352  CESFVDQPAARN-WEVPQEERLKYGLKDNLVRFSFGVEDFDDLKADILQALETI  404



>tpg|DAA45549.1| TPA: hypothetical protein ZEAMMB73_196241 [Zea mays]
Length=234

 Score =   280 bits (717),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN TALRMA+ LE H
Sbjct  62   GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNDTALRMAQFLEEH  121

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGG
Sbjct  122  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGG  181

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  182  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  234



>tpg|DAA45550.1| TPA: hypothetical protein ZEAMMB73_196241 [Zea mays]
Length=277

 Score =   281 bits (718),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN TALRMA+ LE H
Sbjct  105  GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNDTALRMAQFLEEH  164

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGG
Sbjct  165  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGG  224

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  225  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  277



>gb|EEC75352.1| hypothetical protein OsI_11784 [Oryza sativa Indica Group]
Length=220

 Score =   278 bits (712),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE H
Sbjct  48   GCISGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEH  107

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGG
Sbjct  108  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGG  167

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  168  CESIIDQPAIMSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  220



>ref|XP_009404092.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=540

 Score =   288 bits (738),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 153/175 (87%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG E+L+S ++  H+++GG LNPN AY+I+RGMKTLHLRVQ QNSTALRMA++LE H
Sbjct  366  GCISGSEELISKIQLYHNVVGGVLNPNDAYMILRGMKTLHLRVQNQNSTALRMAQLLEEH  425

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+  VYYPGLPSHPEHHIAK QMTGFGGVVSFEI GDL TT KF+D+LKIPYIAPSFGG
Sbjct  426  PKIIHVYYPGLPSHPEHHIAKCQMTGFGGVVSFEIAGDLSTTKKFIDSLKIPYIAPSFGG  485

Query  361  CESIVDQPAIMSYWDLTQAERAA-YGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWDL++ ER A YGI DNLVRFSFGVE FED+ AD LQ+LE I
Sbjct  486  CESIIDQPAIMSYWDLSRPERTAKYGIKDNLVRFSFGVEGFEDLNADNLQSLEKI  540



>gb|ACF82119.1| unknown [Zea mays]
 gb|ACF83490.1| unknown [Zea mays]
 tpg|DAA45551.1| TPA: hypothetical protein ZEAMMB73_196241 [Zea mays]
 tpg|DAA45552.1| TPA: hypothetical protein ZEAMMB73_196241 [Zea mays]
 tpg|DAA45553.1| TPA: hypothetical protein ZEAMMB73_196241 [Zea mays]
Length=322

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN TALRMA+ LE H
Sbjct  150  GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNDTALRMAQFLEEH  209

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGG
Sbjct  210  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGG  269

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  270  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  322



>gb|KEH25015.1| cystathionine gamma-synthase [Medicago truncatula]
Length=457

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG EKL+S VR+ H ILGGTL+PN+AYL+IRGMKTLHLRVQ QNSTA++MA++LE H
Sbjct  284  GCISGSEKLISQVRSFHFILGGTLSPNSAYLVIRGMKTLHLRVQHQNSTAMKMAQLLETH  343

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHPE+ +AK+QMTGFGGVV F+IDGD+M T KFVD+LKIPYIAPSFGG
Sbjct  344  PKVTRVYYPGLPSHPEYALAKRQMTGFGGVVCFDIDGDIMRTIKFVDSLKIPYIAPSFGG  403

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+V+QPAIMSYWDL + ER  Y I DN VRF FGVE +ED+K DVLQAL+ I
Sbjct  404  VESVVNQPAIMSYWDLPRKEREKYRIYDNTVRFCFGVEGYEDLKDDVLQALDAI  457



>gb|ABF96222.1| Cys/Met metabolism PLP-dependent enzyme family protein, expressed 
[Oryza sativa Japonica Group]
Length=322

 Score =   280 bits (715),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE H
Sbjct  150  GCISGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEH  209

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGG
Sbjct  210  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGG  269

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  270  CESIIDQPAIMSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  322



>gb|EEE59137.1| hypothetical protein OsJ_11031 [Oryza sativa Japonica Group]
Length=306

 Score =   279 bits (714),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE H
Sbjct  134  GCISGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEH  193

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGG
Sbjct  194  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGG  253

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  254  CESIIDQPAIMSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  306



>ref|XP_002465206.1| hypothetical protein SORBIDRAFT_01g034130 [Sorghum bicolor]
 gb|EER92204.1| hypothetical protein SORBIDRAFT_01g034130 [Sorghum bicolor]
Length=322

 Score =   279 bits (714),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H
Sbjct  150  GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEH  209

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T +F+D++KIPY APSFGG
Sbjct  210  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDGTRRFIDSVKIPYHAPSFGG  269

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  270  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  322



>ref|XP_003618534.1| Cystathionine-gamma-synthase [Medicago truncatula]
 gb|AES74752.1| cystathionine gamma-synthase [Medicago truncatula]
Length=477

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG EKL+S VR+ H ILGGTL+PN+AYL+IRGMKTLHLRVQ QNSTA++MA++LE H
Sbjct  304  GCISGSEKLISQVRSFHFILGGTLSPNSAYLVIRGMKTLHLRVQHQNSTAMKMAQLLETH  363

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHPE+ +AK+QMTGFGGVV F+IDGD+M T KFVD+LKIPYIAPSFGG
Sbjct  364  PKVTRVYYPGLPSHPEYALAKRQMTGFGGVVCFDIDGDIMRTIKFVDSLKIPYIAPSFGG  423

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+V+QPAIMSYWDL + ER  Y I DN VRF FGVE +ED+K DVLQAL+ I
Sbjct  424  VESVVNQPAIMSYWDLPRKEREKYRIYDNTVRFCFGVEGYEDLKDDVLQALDAI  477



>gb|AAG38873.1|AF076495_1 cystathionine gamma-synthase [Oryza sativa]
Length=360

 Score =   280 bits (716),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE H
Sbjct  188  GCISGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEH  247

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGG
Sbjct  248  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGG  307

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  308  CESIIDQPAIMSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  360



>ref|XP_010499872.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Camelina 
sativa]
Length=386

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KL+S +R LH +LGGTLNPNAAYL+IR MKT+HLRV+Q NS ALRMA+VLEAH
Sbjct  214  GCISGSTKLISKIRILHQLLGGTLNPNAAYLLIRSMKTMHLRVKQHNSNALRMAQVLEAH  273

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHPEH IAK+QMTGFGG+V+FE+ GDL TT KFVD+LKIPYIA SFGG
Sbjct  274  PKVSRVYYPGLPSHPEHLIAKRQMTGFGGLVTFEVAGDLKTTIKFVDSLKIPYIATSFGG  333

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES VDQPA  + WD+ + ER  Y + DNLVRFSFG+EDF+D+KADVLQAL+TI
Sbjct  334  CESFVDQPATRN-WDVPREERLKYELKDNLVRFSFGIEDFDDIKADVLQALDTI  386



>ref|NP_001050220.1| Os03g0376100 [Oryza sativa Japonica Group]
 dbj|BAF12134.1| Os03g0376100, partial [Oryza sativa Japonica Group]
Length=360

 Score =   280 bits (716),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE H
Sbjct  188  GCISGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEH  247

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGG
Sbjct  248  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGG  307

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  308  CESIIDQPAIMSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  360



>gb|EMT23437.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=507

 Score =   284 bits (727),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG ++LVS VR  HH++GG LNPNA+YLI+RGMKTLHLRVQ QNSTALRMA+ LE H
Sbjct  335  GCISGRDELVSKVRIYHHVVGGVLNPNASYLILRGMKTLHLRVQCQNSTALRMAQFLEEH  394

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+DGD  +T KF+D +KIPY APSFGG
Sbjct  395  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVDGDFDSTRKFIDYVKIPYHAPSFGG  454

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QAL  I
Sbjct  455  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDIVQALNKI  507



>gb|ACF83809.1| unknown [Zea mays]
 gb|ACL52497.1| unknown [Zea mays]
 gb|ACN34605.1| unknown [Zea mays]
 gb|AFW87951.1| hypothetical protein ZEAMMB73_590146 [Zea mays]
Length=322

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H
Sbjct  150  GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEH  209

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
             K+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGG
Sbjct  210  LKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGG  269

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  270  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  322



>ref|XP_003557832.1| PREDICTED: cystathionine gamma-synthase, chloroplastic [Brachypodium 
distachyon]
Length=507

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 152/174 (87%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG ++LVS VR  HH++GG LNPNA+YLI+RGMKTLHLRVQ QN+TALRMA+ LE H
Sbjct  335  GCISGRDELVSKVRIYHHVVGGVLNPNASYLILRGMKTLHLRVQCQNNTALRMAQFLEEH  394

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE++GD  +T KF+D++KIPY APSFGG
Sbjct  395  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVNGDFDSTRKFIDSVKIPYHAPSFGG  454

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QAL+ I
Sbjct  455  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSVGVEDFEDLKNDIVQALDKI  507



>gb|AAL82522.1|AC084766_8 putative cystathionine gamma synthase [Oryza sativa Japonica 
Group]
Length=446

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE H
Sbjct  274  GCISGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEH  333

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGG
Sbjct  334  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGG  393

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  394  CESIIDQPAIMSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  446



>ref|XP_010478750.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010478751.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=402

 Score =   278 bits (712),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KL+S +R LH +LGGTLNPNAAYL+IR MKT+HLRV+Q NS ALRMA+VLEAH
Sbjct  230  GCISGSTKLISKIRILHQLLGGTLNPNAAYLLIRSMKTMHLRVKQHNSNALRMAQVLEAH  289

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHPEH IAK+QMTGFGG+V+FE+ GDL  T KF+D+LKIPYIA SFGG
Sbjct  290  PKVSRVYYPGLPSHPEHLIAKRQMTGFGGLVTFEVAGDLKKTIKFIDSLKIPYIATSFGG  349

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES VDQPA  + WD+ + ER  Y + DNLVRFSFG+EDF+D+KADVLQAL+TI
Sbjct  350  CESFVDQPATRN-WDVPREERLKYELNDNLVRFSFGIEDFDDIKADVLQALDTI  402



>gb|AAG51206.1|AC051630_3 cystathionine gamma-synthase, putative; 4884-7220 [Arabidopsis 
thaliana]
Length=373

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG  +LVS +RNLH +LGGTLNPNAAYL+IRGMKT+HLRV+QQNST ++MA+VLEAH
Sbjct  201  GSISGSMELVSKIRNLHKLLGGTLNPNAAYLLIRGMKTMHLRVRQQNSTGMKMAQVLEAH  260

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYY GLPSHPEH IAK+QMTG GG++SFEIDGDL TT KF+DALKIPY+A SFGG
Sbjct  261  PKVSRVYYLGLPSHPEHLIAKRQMTGIGGLISFEIDGDLKTTIKFIDALKIPYLAASFGG  320

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+VDQ A    WD+ + ER   G  DNLVRFSFG+EDFED+KADVLQALETI
Sbjct  321  CESLVDQLA-TGIWDIPREERLKDGFQDNLVRFSFGIEDFEDIKADVLQALETI  373



>ref|NP_001104875.1| cystathionine gamma-synthase1 [Zea mays]
 gb|AAB61347.1| cystathionine gamma-synthase [Zea mays]
Length=509

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN TALRMA+ LE H
Sbjct  337  GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNDTALRMAQFLEEH  396

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGG
Sbjct  397  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGG  456

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  457  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  509



>ref|XP_010461154.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Camelina sativa]
 ref|XP_010461155.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=402

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KL+S +R LH +LGGTLNPNAAYL+IR MKT+HLRV+Q NS ALRMA+VLEAH
Sbjct  230  GCISGSTKLISKIRILHQLLGGTLNPNAAYLLIRSMKTMHLRVKQHNSNALRMAQVLEAH  289

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHPEH IAK+QMTGFGG+V+FE+ GDL  T KF+D+LKIPYIA SFGG
Sbjct  290  PKVSRVYYPGLPSHPEHLIAKRQMTGFGGLVTFEVAGDLKKTIKFIDSLKIPYIATSFGG  349

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES VDQPA  + WD+ + ER  Y + DNLVRFSFG+EDF+D+KADVLQAL+TI
Sbjct  350  CESFVDQPATRN-WDVPREERLNYELNDNLVRFSFGIEDFDDIKADVLQALDTI  402



>ref|NP_174600.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q9C876.1|CGS2_ARATH RecName: Full=Probable cystathionine gamma-synthase 2 [Arabidopsis 
thaliana]
 gb|AAG51279.1|AC027035_2 cystathionine gamma-synthase, putative [Arabidopsis thaliana]
 gb|AEE31583.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Arabidopsis thaliana]
Length=412

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG  +LVS +RNLH +LGGTLNPNAAYL+IRGMKT+HLRV+QQNST ++MA+VLEAH
Sbjct  240  GSISGSMELVSKIRNLHKLLGGTLNPNAAYLLIRGMKTMHLRVRQQNSTGMKMAQVLEAH  299

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYY GLPSHPEH IAK+QMTG GG++SFEIDGDL TT KF+DALKIPY+A SFGG
Sbjct  300  PKVSRVYYLGLPSHPEHLIAKRQMTGIGGLISFEIDGDLKTTIKFIDALKIPYLAASFGG  359

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+VDQ A    WD+ + ER   G  DNLVRFSFG+EDFED+KADVLQALETI
Sbjct  360  CESLVDQLA-TGIWDIPREERLKDGFQDNLVRFSFGIEDFEDIKADVLQALETI  412



>ref|XP_010461152.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Camelina sativa]
 ref|XP_010461153.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=429

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  KL+S +R LH +LGGTLNPNAAYL+IR MKT+HLRV+Q NS ALRMA+VLEAH
Sbjct  257  GCISGSTKLISKIRILHQLLGGTLNPNAAYLLIRSMKTMHLRVKQHNSNALRMAQVLEAH  316

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RVYYPGLPSHPEH IAK+QMTGFGG+V+FE+ GDL  T KF+D+LKIPYIA SFGG
Sbjct  317  PKVSRVYYPGLPSHPEHLIAKRQMTGFGGLVTFEVAGDLKKTIKFIDSLKIPYIATSFGG  376

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES VDQPA  + WD+ + ER  Y + DNLVRFSFG+EDF+D+KADVLQAL+TI
Sbjct  377  CESFVDQPATRN-WDVPREERLNYELNDNLVRFSFGIEDFDDIKADVLQALDTI  429



>gb|ABF96221.1| Cys/Met metabolism PLP-dependent enzyme family protein, expressed 
[Oryza sativa Japonica Group]
Length=502

 Score =   280 bits (716),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE H
Sbjct  330  GCISGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEH  389

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGV+SFE+ GD   T +F+D++KIPY APSFGG
Sbjct  390  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVISFEVAGDFDATRRFIDSVKIPYHAPSFGG  449

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K DV+QAL+ I
Sbjct  450  CESIIDQPAIMSYWD-SKEQREIYGIKDNLIRFSIGVEDFEDLKNDVVQALDKI  502



>dbj|BAJ84799.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG  +LVS VR  HH++GG LNPNA+YLI+RGMKTLHLRVQ QN+TALRMA+ LE H
Sbjct  335  GCISGRGELVSKVRIYHHVVGGVLNPNASYLILRGMKTLHLRVQCQNNTALRMAQFLEEH  394

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+DGD  +T +F+D++KIPY APSFGG
Sbjct  395  PKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVDGDFDSTRRFIDSVKIPYHAPSFGG  454

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDF D+K D++QAL+ I
Sbjct  455  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFGDLKNDIVQALDKI  507



>ref|NP_001130426.1| uncharacterized protein LOC100191523 [Zea mays]
 gb|ACF78628.1| unknown [Zea mays]
Length=481

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H
Sbjct  309  GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEH  368

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
             K+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGG
Sbjct  369  LKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGG  428

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  429  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  481



>ref|XP_004984247.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Setaria 
italica]
Length=511

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 150/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TA+RMA+ LE H
Sbjct  339  GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTAMRMAQFLEEH  398

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T +F+D++KIPY APSFGG
Sbjct  399  PKIARVYYPGLPSHPEHHIAKTQMTGFGGVVSFEVAGDFDGTRRFIDSVKIPYHAPSFGG  458

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE +
Sbjct  459  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKV  511



>gb|AFW87953.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_590146 [Zea 
mays]
Length=485

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H
Sbjct  313  GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEH  372

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
             K+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGG
Sbjct  373  LKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGG  432

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  433  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  485



>gb|AAB61348.1| cystathionine gamma-synthase [Zea mays]
Length=509

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 149/174 (86%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H
Sbjct  337  GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEH  396

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
             K+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGG
Sbjct  397  LKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGG  456

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESI+DQPAIMSYWD ++ +R  YGI DNL+RFS GVEDFED+K D++QALE I
Sbjct  457  CESIIDQPAIMSYWD-SKEQRDIYGIKDNLIRFSIGVEDFEDLKNDLVQALEKI  509



>ref|XP_009772869.1| PREDICTED: LOW QUALITY PROTEIN: cystathionine gamma-synthase, 
chloroplastic-like, partial [Nicotiana sylvestris]
Length=445

 Score =   275 bits (704),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCIS P +LVSVVRNLHHILGG +NPNAAYLIIRGMKTLHLRVQQQNS AL MAE+LEAH
Sbjct  291  GCISCPLELVSVVRNLHHILGGAINPNAAYLIIRGMKTLHLRVQQQNSNALSMAEILEAH  350

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDL-MTTAKFVDALKIPYIAPSFG  357
            PKV+ V +PGLPSHPE+HIAKKQMTGFGGVVSFE    + +TTAKFVDAL+IPYIAPSFG
Sbjct  351  PKVKHVXFPGLPSHPEYHIAKKQMTGFGGVVSFEATFFVRLTTAKFVDALRIPYIAPSFG  410

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFS  462
            GCESIVDQPAIMSYWDL+Q++RA YGIMDNLVRFS
Sbjct  411  GCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFS  445



>ref|XP_010937207.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Elaeis guineensis]
Length=512

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +1

Query  73   NPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQM  252
            N NAAY+I+RGMKTLHLRVQQQN TALRMA+ LE HPK+ RVYYPGLPSHPEHHIAK+QM
Sbjct  363  NDNAAYMILRGMKTLHLRVQQQNHTALRMAQFLEEHPKITRVYYPGLPSHPEHHIAKQQM  422

Query  253  TGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAY  432
            TGFGGVVSFE+ GDL TT KF+D+LKIPYIAPSFGGCESIVDQPAIMSYWDL+ +ERA Y
Sbjct  423  TGFGGVVSFEVAGDLRTTMKFIDSLKIPYIAPSFGGCESIVDQPAIMSYWDLSSSERATY  482

Query  433  GIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            GI D+LVRFSFGVEDFED+KAD++QALE I
Sbjct  483  GIKDSLVRFSFGVEDFEDLKADIVQALENI  512



>gb|ABR16369.1| unknown [Picea sitchensis]
 gb|ABR18082.1| unknown [Picea sitchensis]
Length=521

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G +SG  K++  VR LH++LGG L+PNAAYLI+RG+KTLHLRVQQQNSTALR+A  LEAH
Sbjct  348  GSLSGSNKIIGAVRALHNVLGGVLSPNAAYLILRGIKTLHLRVQQQNSTALRIARTLEAH  407

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RV+YPGL SHPEHHIAK+QM+GFGGVVSFEI GDL  T++F+D+LKIPYIAPS GG
Sbjct  408  PKVSRVHYPGLESHPEHHIAKRQMSGFGGVVSFEIVGDLQATSRFIDSLKIPYIAPSLGG  467

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V+QP I+SYWD +  ERA  GI DNLVRFS GVE F+D+++DVLQALE +
Sbjct  468  CESLVEQPTIISYWDQSSEERARLGIKDNLVRFSCGVEAFDDIESDVLQALEAV  521



>ref|XP_008800507.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Phoenix 
dactylifera]
Length=144

 Score =   261 bits (668),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +1

Query  91   LIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGV  270
            +I+RGMKTLHLRVQQQN TALRMA+ LE HPK+ RVYYPGLPSHPEHHIAK+QMTGFGGV
Sbjct  1    MILRGMKTLHLRVQQQNHTALRMAQFLEEHPKIIRVYYPGLPSHPEHHIAKQQMTGFGGV  60

Query  271  VSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNL  450
            VSFE+ GDL TT KFVD+LKIPYIAPSFGGCESIVDQPAIMSYWDL+ +ER  YGI DNL
Sbjct  61   VSFEVAGDLRTTMKFVDSLKIPYIAPSFGGCESIVDQPAIMSYWDLSASERVTYGIKDNL  120

Query  451  VRFSFGVEDFEDVKADVLQALETI  522
            +RFSFGVEDFED+KAD++QALE+I
Sbjct  121  IRFSFGVEDFEDLKADIIQALESI  144



>ref|XP_004172088.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Cucumis 
sativus]
Length=139

 Score =   252 bits (644),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  106  MKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI  285
            MKT+HLRVQQQNS+ L+MA +LEAHPK++ VYYPGLPSHPEH++AK+QMTGFGGVVSFE+
Sbjct  1    MKTMHLRVQQQNSSGLKMAMLLEAHPKIKCVYYPGLPSHPEHNLAKRQMTGFGGVVSFEV  60

Query  286  DGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSF  465
            DGDLMTTAKF+D+LKIPYIAPSFGGCESI+DQPAIMSYWDL Q ER  YGI DNLVRFS 
Sbjct  61   DGDLMTTAKFIDSLKIPYIAPSFGGCESIIDQPAIMSYWDLNQTERLKYGIKDNLVRFSI  120

Query  466  GVEDFEDVKADVLQALETI  522
            G+EDFED+KAD+LQAL+ I
Sbjct  121  GIEDFEDLKADILQALDAI  139



>gb|KJB75687.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=519

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG EKLV+ +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH
Sbjct  365  GCISGSEKLVTEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  424

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V+RVYYPGLPSHPEH IAK+QMTGFGGVVSFE+DGDL TT KFVDALKIPYIAPSFGG
Sbjct  425  PRVKRVYYPGLPSHPEHEIAKRQMTGFGGVVSFEVDGDLTTTIKFVDALKIPYIAPSFGG  484

Query  361  CESIVDQPAIMSYW  402
            CESIVD PAIMSYW
Sbjct  485  CESIVDPPAIMSYW  498



>ref|XP_001761633.1| predicted protein [Physcomitrella patens]
 gb|EDQ73701.1| predicted protein [Physcomitrella patens]
Length=526

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 146/174 (84%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G +SG ++ +S VR LH+ILGG ++PNAAYLI+RG+KTL LRV+QQN TA  +A+ LEAH
Sbjct  353  GSLSGSKQCLSAVRALHNILGGVVDPNAAYLILRGLKTLDLRVKQQNKTAYLLAQNLEAH  412

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RV+YPGL SHPEH IAK+QMTGFGGV+SFEIDGDL TT+KF+D L+IPYIAPS GG
Sbjct  413  PKVARVHYPGLESHPEHQIAKRQMTGFGGVISFEIDGDLETTSKFIDGLRIPYIAPSLGG  472

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+V+QP I+SYWD + AERA  GI DNLVRFS GVED+ED+  DV+Q+L+ +
Sbjct  473  VESLVEQPTIISYWDQSPAERARIGIKDNLVRFSCGVEDYEDILNDVMQSLDAL  526



>ref|XP_002965872.1| hypothetical protein SELMODRAFT_143363 [Selaginella moellendorffii]
 gb|EFJ33292.1| hypothetical protein SELMODRAFT_143363 [Selaginella moellendorffii]
Length=466

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG + LV  VR LH++LGG ++ +AAYLI RG+KTL LRV+QQNS ALR+A  LE+H
Sbjct  293  GSISGSKPLVDTVRKLHNVLGGVVDAHAAYLIGRGLKTLDLRVRQQNSNALRLARALESH  352

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RV+YPGL SHPE HIA KQM GFGGVVSFEIDGDL  T+KF+D L+IPYIAPS GG
Sbjct  353  PKIARVHYPGLESHPEFHIASKQMRGFGGVVSFEIDGDLALTSKFIDGLRIPYIAPSLGG  412

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V+QP I+SYWD + AERA  GI DNLVRFS G+ED+ED+ ADV+Q+L ++
Sbjct  413  CESLVEQPTIISYWDQSPAERAKMGIKDNLVRFSCGIEDYEDIYADVMQSLASL  466



>ref|XP_002983120.1| hypothetical protein SELMODRAFT_155550 [Selaginella moellendorffii]
 gb|EFJ15929.1| hypothetical protein SELMODRAFT_155550 [Selaginella moellendorffii]
Length=467

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG + LV  VR LH++LGG ++ +AAYLI RG+KTL LRV+QQNS ALR+A  LE+H
Sbjct  294  GSISGSKPLVDTVRKLHNVLGGVVDAHAAYLIGRGLKTLDLRVRQQNSNALRLARALESH  353

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RV+YPGL SHPE HIA KQM GFGGVVSFEIDGDL  T+KF+D L+IPYIAPS GG
Sbjct  354  PKIARVHYPGLESHPEFHIASKQMRGFGGVVSFEIDGDLALTSKFIDGLRIPYIAPSLGG  413

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V+QP I+SYWD + AERA  GI DNLVRFS G+ED+ED+ ADV+Q+L ++
Sbjct  414  CESLVEQPTIISYWDQSPAERAKMGIKDNLVRFSCGIEDYEDIYADVMQSLASL  467



>ref|XP_001772529.1| predicted protein [Physcomitrella patens]
 gb|EDQ62571.1| predicted protein [Physcomitrella patens]
Length=532

 Score =   255 bits (652),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 145/174 (83%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G +SG ++ +S VR LH+ILGG ++PNAAYLI+RG+KTL LRV+QQN TAL +A+ LEAH
Sbjct  359  GSLSGTKQCLSAVRALHNILGGVVDPNAAYLILRGLKTLDLRVKQQNRTALLLAQKLEAH  418

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RV+YPGL SHPEH IAK+QM+GFGGV+SFEI+GDL TT+ F+D L+IPYIAPS GG
Sbjct  419  PKVARVHYPGLESHPEHQIAKRQMSGFGGVISFEINGDLETTSNFIDGLRIPYIAPSLGG  478

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+V+QP I+SYWD + AERA  GI DNLVRFS G+ED+ED+  DV+Q+L  +
Sbjct  479  VESLVEQPTIISYWDQSPAERARLGIKDNLVRFSCGIEDYEDILNDVMQSLNAL  532



>ref|XP_009602125.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Nicotiana tomentosiformis]
Length=565

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 133/174 (76%), Gaps = 36/174 (21%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP KLVSV+RNLHHILGG LNP                                  
Sbjct  428  GCISGPVKLVSVIRNLHHILGGALNP----------------------------------  453

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
              VR VYYPGL SHPEHHIAKKQMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGG
Sbjct  454  --VRHVYYPGLQSHPEHHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGG  511

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  512  CESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  565



>ref|XP_009775846.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like isoform 
X2 [Nicotiana sylvestris]
Length=502

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 132/174 (76%), Gaps = 36/174 (21%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISGP KLVS +RNLHHILGG LNP                                  
Sbjct  365  GCISGPLKLVSEIRNLHHILGGALNP----------------------------------  390

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
              VR VYYPGL SHPEHHIAKKQMTGFGGVVSFE+DGDL+TTAKFVDALKIPYIAPSFGG
Sbjct  391  --VRHVYYPGLQSHPEHHIAKKQMTGFGGVVSFEVDGDLLTTAKFVDALKIPYIAPSFGG  448

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CESIVDQPAIMSYWDL+Q++RA YGIMDNLVRFSFGVEDF+D+KAD+LQAL++I
Sbjct  449  CESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI  502



>ref|XP_003561880.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Brachypodium 
distachyon]
Length=467

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG + L+S +R  HH LGG ++P+AAY+IIRG+KT+ LRV+ QN TALRMA +LE H
Sbjct  294  GCISGSDALLSRIRAWHHDLGGAISPDAAYMIIRGLKTMALRVETQNRTALRMARLLENH  353

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P HH+AK QMTGFGGV+SFE+  DL    +FVDAL+IP+IA S GG
Sbjct  354  PKIERVYYPGLKSSPWHHVAKSQMTGFGGVISFEVASDLRGVMRFVDALEIPFIATSLGG  413

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MS+W  +  E++  GI DNLVRFSFG+E FED++ D+LQALE +
Sbjct  414  CESLVQQPAVMSFWGQSDEEKSKNGITDNLVRFSFGIEKFEDLRDDILQALEKV  467



>ref|XP_003057119.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58764.1| predicted protein [Micromonas pusilla CCMP1545]
Length=374

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCI G ++LV+  R  H+I+GG L+P+AAYL++RGMKTL LRV + N  A+R+A +LEAH
Sbjct  200  GCIVGDKELVAKCRQFHNIMGGVLDPHAAYLVLRGMKTLSLRVARHNDNAMRLATLLEAH  259

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+  V+YPGLPSHP+H +AK+ M+GFGGVVSFE+ GDL  TAKF+DA  +PYIAPS GG
Sbjct  260  PKIDVVHYPGLPSHPDHEVAKRYMSGFGGVVSFEVKGDLWATAKFIDACNLPYIAPSLGG  319

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++QP I+SYWD    +RA  GI DNLVR++ G+EDFED+ +DVLQALE I
Sbjct  320  VESLIEQPTIVSYWDYGAEQRAELGIKDNLVRYACGIEDFEDIASDVLQALEQI  373



>gb|EMS45856.1| Cystathionine gamma-synthase, chloroplastic [Triticum urartu]
Length=723

 Score =   248 bits (633),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = +1

Query  79   NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG  258
            NA+YLI+RGMKTLHLRVQ QNSTALRMA+ LE HPK+ RVYYPGLPSHPEHHIAK QMTG
Sbjct  577  NASYLILRGMKTLHLRVQCQNSTALRMAQFLEEHPKIARVYYPGLPSHPEHHIAKSQMTG  636

Query  259  FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGI  438
            FGGVVSFE+DGD  +T KF+D++KIPY APSFGGCESI+DQPAIMSYWD ++ +R  YGI
Sbjct  637  FGGVVSFEVDGDFDSTRKFIDSVKIPYHAPSFGGCESIIDQPAIMSYWD-SKEQRDIYGI  695

Query  439  MDNLVRFSFGVEDFEDVKADVLQALETI  522
             DNL+RFS GVEDFED+K D++QAL  I
Sbjct  696  KDNLIRFSIGVEDFEDLKNDIVQALNKI  723



>gb|EMT09613.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=457

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG + L+S +R  HH LGG ++P+AAY+IIRG+KT+ LRV+ QN TALRMA +LE H
Sbjct  284  GCISGSKDLISRIRAWHHDLGGAISPDAAYMIIRGLKTMALRVETQNHTALRMARLLENH  343

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ +VYYPGL S P H IAK+QMTGFGGV+SFE+  DL     FVDAL+IP+IA S GG
Sbjct  344  PKIEQVYYPGLLSSPWHDIAKRQMTGFGGVISFEVASDLHGVMMFVDALEIPFIATSLGG  403

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MS+W  +  E+A  GI DNLVRFSFG+E+FED++ D+LQALE I
Sbjct  404  CESLVQQPAVMSFWGQSGEEKAKNGIKDNLVRFSFGIENFEDLRDDILQALEKI  457



>dbj|BAJ93384.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG + L+S +R  HH LGG ++P+AAY+IIRG+KT+ LRV+ QN T+LRMA +LE H
Sbjct  287  GCISGSQALISRIRAWHHDLGGAISPDAAYMIIRGLKTMALRVETQNRTSLRMARLLENH  346

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P H IAK QMTGFGGV+SFE+  DL    +F+DAL+IP+IA S GG
Sbjct  347  PKIERVYYPGLLSSPWHDIAKSQMTGFGGVISFEVASDLHGVMRFIDALEIPFIATSLGG  406

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MS+W  ++ E++  GI DNLVRFSFG+E FED++ D++QALE I
Sbjct  407  CESLVQQPAVMSFWGQSEEEKSKNGIKDNLVRFSFGIEKFEDLRDDIIQALEKI  460



>gb|EMS47533.1| Cystathionine gamma-synthase, chloroplastic [Triticum urartu]
Length=460

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG + L+S +R  HH LGG ++P+AAY+IIRG+KT+ LRV+ QNSTALRMA +LE H
Sbjct  287  GCISGSDALISRIRAWHHDLGGAISPDAAYMIIRGLKTMVLRVETQNSTALRMARLLENH  346

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P HHIA  QMTG GGV+SF++  DL    +F+DAL+IP+IA S GG
Sbjct  347  PKIERVYYPGLISSPWHHIANSQMTGCGGVISFKVASDLHGVMRFIDALEIPFIATSLGG  406

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MS+W     E+A  GI DNLVRFSFGVE FED++ D+LQALE I
Sbjct  407  CESLVQQPAVMSFWGENDEEKAKNGIKDNLVRFSFGVEKFEDLRDDILQALEKI  460



>ref|XP_004983123.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Setaria 
italica]
 ref|XP_004983124.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Setaria 
italica]
Length=448

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG + L+S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+  N TAL MA +LE H
Sbjct  275  GCISGSKTLISKIRAWHHDLGGAISPNAAYMIIRGLKTMALRVEAHNRTALDMARLLELH  334

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RV+YPGL S+P H +AK QMTG+GGVVSFE+  DL  T +FVDAL+IP IA S GG
Sbjct  335  PKIERVHYPGLESNPWHQVAKSQMTGYGGVVSFEVKSDLCGTMRFVDALEIPLIATSLGG  394

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MS+W  +  E+A  GI DNLVRFSFG+E FED++ D+LQALE I
Sbjct  395  CESLVQQPAVMSFWGKSDDEKAKNGIKDNLVRFSFGIEKFEDLRDDILQALEKI  448



>ref|NP_001064539.1| Os10g0399200 [Oryza sativa Japonica Group]
 gb|AAK50405.1|AC021891_6 Putative cystathionine gamma synthase (O-succinylhomoserine (thiol)-lyase) 
[Oryza sativa Japonica Group]
 gb|AAP53634.1| Cys/Met metabolism PLP-dependent enzyme family protein [Oryza 
sativa Japonica Group]
 dbj|BAF26453.1| Os10g0399200 [Oryza sativa Japonica Group]
 gb|EAZ15991.1| hypothetical protein OsJ_31435 [Oryza sativa Japonica Group]
Length=472

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 134/174 (77%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG E L+S +R  HH LGG ++PNAAY+IIRG+KTL LRV+ QN TALRMA +LE H
Sbjct  299  GCVSGSEALISRIRAWHHDLGGAISPNAAYMIIRGLKTLALRVEAQNRTALRMARLLEKH  358

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P H +A +QM G GGVVSFE+  D+    +FVDAL++P IA S GG
Sbjct  359  PKIERVYYPGLESSPWHGVATRQMAGAGGVVSFEVASDMRGVMRFVDALELPLIATSLGG  418

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MSYW  ++ E+A  GI DN VRFSFG+E FED++ D+LQALE I
Sbjct  419  CESLVQQPAVMSYWGKSEEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALEKI  472



>gb|EMT09614.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=466

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG E L+S +R  HH LGG ++P++AY+IIRG+KT+ LRV+ QN TALRMA +LE H
Sbjct  293  GCISGSETLISRIRAWHHDLGGAISPDSAYMIIRGLKTMGLRVETQNRTALRMARLLENH  352

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P H IAK QMTGFGGV+SFE+  DL    +F+DAL+IP+IA S GG
Sbjct  353  PKIERVYYPGLLSSPWHDIAKSQMTGFGGVISFEVASDLHGIMRFIDALEIPFIATSLGG  412

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MS+W  +  E+A  GI DNLVR  FG+E FED+K D+LQALE I
Sbjct  413  CESLVQQPAVMSFWGQSYEEKANNGIKDNLVRLIFGIEKFEDLKDDILQALEKI  466



>gb|EAY78389.1| hypothetical protein OsI_33476 [Oryza sativa Indica Group]
Length=486

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 134/174 (77%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG E L+S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+ QN TALRMA +LE H
Sbjct  313  GCVSGSEALISRIRAWHHDLGGAISPNAAYMIIRGLKTIALRVEAQNRTALRMARLLEKH  372

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P H +A +QM G GGVVSF++  DL    +FVDAL++P IA S GG
Sbjct  373  PKIERVYYPGLESSPWHGVATRQMAGAGGVVSFDVASDLRGVMRFVDALELPLIATSLGG  432

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MSYW  ++ E+A  GI DN VRFSFG+E FED++ D+LQALE I
Sbjct  433  CESLVQQPAVMSYWGKSEEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALEKI  486



>ref|XP_002467292.1| hypothetical protein SORBIDRAFT_01g023050 [Sorghum bicolor]
 gb|EER94290.1| hypothetical protein SORBIDRAFT_01g023050 [Sorghum bicolor]
Length=468

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG   L+S +R  HH +GG ++PNAAY++IRG+KT+ LRV+  NSTALRMA +LE H
Sbjct  295  GCVSGSAALISRIRAWHHDIGGAISPNAAYMVIRGLKTMALRVEAHNSTALRMARILERH  354

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RV+YPGL S P H +A  QM+G+GGVVSFE+  DL  T  FVDAL+IP+IA S GG
Sbjct  355  PKIERVHYPGLESSPWHEVATSQMSGYGGVVSFELKADLHGTMSFVDALEIPFIATSLGG  414

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MS+W  +Q E+A  GI DN+VRFSFG+E F+D++ D+LQAL  I
Sbjct  415  CESLVQQPAVMSFWGQSQEEKAKNGIKDNMVRFSFGIEKFQDLRDDILQALNRI  468



>ref|XP_008666693.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Zea 
mays]
 tpg|DAA50062.1| TPA: hypothetical protein ZEAMMB73_527983 [Zea mays]
Length=467

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG E L++ +R  HH LGG ++P+AAY++IRG+KT+ LRV+  NSTALRMA +LE H
Sbjct  294  GCVSGSEALITRIRAWHHHLGGVISPSAAYMVIRGLKTMALRVEAHNSTALRMARMLERH  353

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RV+YPGL S P H +A+ +M+G+GGVVSFE+  DL  T +FVDAL+IP+IA S GG
Sbjct  354  PKIERVHYPGLESSPWHELARTRMSGYGGVVSFELKADLRGTMRFVDALEIPFIATSLGG  413

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MS+W  ++ ++A  GI DNLVRFSFG+E FED++ D+LQAL  I
Sbjct  414  CESLVQQPAVMSFWGHSEEDKAKNGIKDNLVRFSFGIEKFEDLRDDILQALNKI  467



>ref|XP_008666694.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Zea 
mays]
Length=468

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG E L+S +R  HH LGG ++PNAAY +IRG+KT+ LRV+  NSTALRMA +LE H
Sbjct  295  GCISGSEALISRIRAWHHQLGGAISPNAAYTVIRGLKTMALRVEAHNSTALRMARMLERH  354

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RV+YPGL S P H +A+ QM+G+GGVV  E+  DL  T  FVDAL+IP+IA S GG
Sbjct  355  PKIERVHYPGLESSPWHEVARTQMSGYGGVVRLELKADLRGTMSFVDALEIPFIATSLGG  414

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MS+W  +Q ++   GI DNLVRFSFG+E FED++ D+LQAL  I
Sbjct  415  CESLVQQPAVMSFWGRSQEDKTKNGIKDNLVRFSFGIEKFEDLQDDILQALNRI  468



>tpg|DAA50063.1| TPA: hypothetical protein ZEAMMB73_244612 [Zea mays]
Length=473

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG E L+S +R  HH LGG ++PNAAY +IRG+KT+ LRV+  NSTALRMA +LE H
Sbjct  300  GCISGSEALISRIRAWHHQLGGAISPNAAYTVIRGLKTMALRVEAHNSTALRMARMLERH  359

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RV+YPGL S P H +A+ QM+G+GGVV  E+  DL  T  FVDAL+IP+IA S GG
Sbjct  360  PKIERVHYPGLESSPWHEVARTQMSGYGGVVRLELKADLRGTMSFVDALEIPFIATSLGG  419

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MS+W  +Q ++   GI DNLVRFSFG+E FED++ D+LQAL  I
Sbjct  420  CESLVQQPAVMSFWGRSQEDKTKNGIKDNLVRFSFGIEKFEDLQDDILQALNRI  473



>gb|EAY78386.1| hypothetical protein OsI_33473 [Oryza sativa Indica Group]
Length=473

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG E LVS +R  HH LGG ++PNAAY+IIRG+KTL LRVQ QN TALRMA++LE H
Sbjct  300  GCVSGSEALVSRIRTWHHDLGGAISPNAAYMIIRGLKTLALRVQAQNRTALRMAQLLEKH  359

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P H +A +QM G GGVV  E+  D+    +FVDAL++P IA S GG
Sbjct  360  PKIERVYYPGLESSPWHGVATRQMAGAGGVVGLEVASDMRGAMRFVDALELPLIATSLGG  419

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPAIMSYW     E+A  GI DN VRFSFG+E FED++ D+LQAL  I
Sbjct  420  CESLVQQPAIMSYWGKCDEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALGKI  473



>ref|NP_001064540.1| Os10g0399700 [Oryza sativa Japonica Group]
 gb|AAK50410.1|AC021891_11 Putative cystathionine gamma synthase (O-succinylhomoserine (thiol)-lyase) 
[Oryza sativa Japonica Group]
 gb|AAP53639.1| Cys/Met metabolism PLP-dependent enzyme family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26454.1| Os10g0399700 [Oryza sativa Japonica Group]
 gb|EAZ15992.1| hypothetical protein OsJ_31436 [Oryza sativa Japonica Group]
Length=486

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG E L+S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+ QN TALRMA +LE H
Sbjct  313  GCVSGSEALISRIRAWHHDLGGAISPNAAYMIIRGLKTIALRVEAQNRTALRMARLLEKH  372

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S   H +A +QM G GGVVSF++  DL    +FVDAL++P IA S GG
Sbjct  373  PKIERVYYPGLESSLWHGVATRQMAGAGGVVSFDVASDLRGVMRFVDALELPLIATSLGG  432

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MSYW  ++ E+A  GI DN VRFSFG+E FED++ D+LQALE I
Sbjct  433  CESLVQQPAVMSYWGKSEEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALEKI  486



>gb|AAK50404.1|AC021891_5 Putative O-succinylhomoserine (thiol)-lyase (cystathionine gamma 
synthase) [Oryza sativa Japonica Group]
Length=508

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG E LVS +R  HH LGG ++PNAAY+IIRG+KTL LRVQ QN TALRMA++LE H
Sbjct  335  GCVSGSEALVSRIRTWHHDLGGAISPNAAYMIIRGLKTLALRVQAQNRTALRMAQLLEKH  394

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P H +A +QM G GGVV  E+  D+    +FVDAL++P IA S GG
Sbjct  395  PKIERVYYPGLESSPWHGVATRQMAGAGGVVGLEVASDMRGAMRFVDALELPLIATSLGG  454

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPAIMSYW     E+A  GI DN VRFSFG+E FED++ D+LQAL  I
Sbjct  455  CESLVQQPAIMSYWGKCDEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALGKI  508



>ref|XP_007510517.1| cystathionine gamma-synthase [Bathycoccus prasinos]
 emb|CCO18050.1| cystathionine gamma-synthase [Bathycoccus prasinos]
Length=453

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G ++ VS VR  H+I+GG L+P+AAYLI+RG+KTL LRV++ NS A R+AE LEAH
Sbjct  280  GVIVGQKEAVSKVRAFHNIVGGVLDPHAAYLILRGLKTLSLRVERHNSNAQRLAEWLEAH  339

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ +V+YPGL SH +H +AKK MTGFGGVVSFE+DGDL  TAKF+D  ++PYIAPS GG
Sbjct  340  PKIAKVHYPGLKSHQDHEVAKKYMTGFGGVVSFEVDGDLWQTAKFIDECRLPYIAPSLGG  399

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++QP ++SYWD    +RAA GI DNLVRF+ G+ED+ D++AD  QAL+ I
Sbjct  400  VESLIEQPTVVSYWDQGPEKRAAIGIKDNLVRFACGIEDYADIEADFKQALDKI  453



>ref|XP_005651362.1| cystathionine gamma-synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE26818.1| cystathionine gamma-synthase [Coccomyxa subellipsoidea C-169]
Length=477

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ++G   +V+ VR++H++LGGT++P+AAYL++RGMKTL +RVQ+QN+TA+ +A  LE H
Sbjct  303  GALAGKADVVAAVRSMHNVLGGTIDPHAAYLLLRGMKTLDVRVQRQNTTAMELARRLEEH  362

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTG-FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFG  357
            P++ RV+YPGLPSHP+HHIA  QM G FGGVVSFE+D DL  TAKFVD++++PYIAPS G
Sbjct  363  PRITRVHYPGLPSHPDHHIAVDQMLGGFGGVVSFEVDADLWGTAKFVDSVRLPYIAPSLG  422

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            G +S+++QP ++SYWD    +RA YGI DNL+RFS G+E  ED+  D+LQAL  I
Sbjct  423  GVDSLIEQPTVISYWDQGPEKRAEYGIKDNLIRFSCGIESMEDIWQDLLQALAKI  477



>ref|XP_003081090.1| O-succinylhomoserine (ISS) [Ostreococcus tauri]
Length=301

 Score =   227 bits (579),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G ++ V+  R  H+ILGG ++P+AAYL++RG+KTL LRV++ N +A+++A+ LEAH
Sbjct  128  GVIVGKKEPVAACRQFHNILGGVIDPHAAYLVLRGLKTLSLRVERHNESAMKLAQFLEAH  187

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ +V+YPGLPSH +H +AKK M GFGGVVSFE+ GDL  TAKF+D+ KIPYIAPS GG
Sbjct  188  PKIDKVHYPGLPSHCDHEVAKKYMKGFGGVVSFEVKGDLWKTAKFIDSCKIPYIAPSLGG  247

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++QP I+SYWD     RA  GI DNLVR+S G+ED+ D++AD+ QAL+ I
Sbjct  248  VESLIEQPTIVSYWDYAPEVRAEIGIKDNLVRYSTGIEDYADIEADMAQALDQI  301



>ref|XP_006661751.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Oryza 
brachyantha]
Length=485

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 132/174 (76%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+S  E L+S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+ QN TALRMA +LE H
Sbjct  313  GCVSASEALISRIRAWHHDLGGAISPNAAYMIIRGLKTMALRVEAQNRTALRMARLLENH  372

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P H +A+KQM G GGV+S E+  DL    +FVDAL++P IA S GG
Sbjct  373  PKIERVYYPGLESSPWHGVARKQMAGGGGVISLEVASDLRGAMRFVDALELPLIATSLGG  432

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MSYW   + E+A  GI DN VRFSFG+E FED++ D+LQALE I
Sbjct  433  CESLVQQPAVMSYWG-REEEKAKNGIKDNFVRFSFGIEKFEDLREDILQALEKI  485



>ref|XP_001419722.1| cystathione gamma synthase [Ostreococcus lucimarinus CCE9901]
 gb|ABO98015.1| cystathione gamma synthase [Ostreococcus lucimarinus CCE9901]
Length=433

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G ++ V+  R  H+ILGG ++P+AAYL++RG+KTL LRV++ N +A+R+A+ LE H
Sbjct  260  GVIVGKKEAVAACRQFHNILGGVIDPHAAYLVLRGLKTLSLRVERHNDSAMRLAQYLEKH  319

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ +V+YPGLPSH +H +AKK M GFGGVVSFE+ GDL  TAKF+D+ ++PYIAPS GG
Sbjct  320  PKIDKVHYPGLPSHCDHEVAKKYMKGFGGVVSFEVKGDLWATAKFIDSCELPYIAPSLGG  379

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++QP ++SYWD    +RA  GI DNLVRFS G+ED+ D++AD+ QALE I
Sbjct  380  VESLIEQPTVVSYWDQGPEKRAEIGIKDNLVRFSTGIEDYVDIEADIAQALEKI  433



>emb|CEF98968.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
2 [Ostreococcus tauri]
Length=430

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G ++ V+  R  H+ILGG ++P+AAYL++RG+KTL LRV++ N +A+++A+ LEAH
Sbjct  257  GVIVGKKEPVAACRQFHNILGGVIDPHAAYLVLRGLKTLSLRVERHNESAMKLAQFLEAH  316

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ +V+YPGLPSH +H +AKK M GFGGVVSFE+ GDL  TAKF+D+ KIPYIAPS GG
Sbjct  317  PKIDKVHYPGLPSHCDHEVAKKYMKGFGGVVSFEVKGDLWKTAKFIDSCKIPYIAPSLGG  376

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++QP I+SYWD     RA  GI DNLVR+S G+ED+ D++AD+ QAL+ I
Sbjct  377  VESLIEQPTIVSYWDYAPEVRAEIGIKDNLVRYSTGIEDYADIEADMAQALDQI  430



>ref|XP_006662330.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Oryza 
brachyantha]
Length=478

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 133/174 (76%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+S  E+L+S +R  HH LGG ++PNAAY+IIRG+KT+ LRV+ QN TALRMA +LE H
Sbjct  306  GCVSASEQLISRIRAWHHDLGGAISPNAAYMIIRGLKTMALRVEAQNRTALRMARLLENH  365

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RV+YPGL S P H + +KQM G GGV+SFE+  D+    +FVDAL++P IA S GG
Sbjct  366  PKIERVHYPGLESSPWHGVGRKQMAGGGGVISFEVASDMDGATRFVDALELPLIATSLGG  425

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CES+V QPA+MSYW  +  E+   GI DNLVRFSFG+E +ED++ D+LQALE I
Sbjct  426  CESLVQQPAVMSYWGKSD-EKTKNGIKDNLVRFSFGIEKYEDLRDDILQALEKI  478



>ref|XP_005846526.1| hypothetical protein CHLNCDRAFT_24830 [Chlorella variabilis]
 gb|EFN54424.1| hypothetical protein CHLNCDRAFT_24830 [Chlorella variabilis]
Length=412

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I+G  +LV+ VR +H++LGGT++P+A+YL++RGMKTL LRVQ+QN+TA  +A  LEAH
Sbjct  239  GAIAGKSELVAAVRAMHNVLGGTIDPHASYLLLRGMKTLDLRVQRQNATATDIAARLEAH  298

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P V RV+YPGL SHP+H IA  QM+G+GGVVSFE+DGDL  TA+FVD++++PYIAPS GG
Sbjct  299  PLVTRVHYPGLASHPDHAIAAAQMSGYGGVVSFEVDGDLWRTARFVDSVQLPYIAPSLGG  358

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++QP ++SYWD    +RA  GI DNL+RFS G+E  +D+ AD  QA   I
Sbjct  359  VESLIEQPTVISYWDQGAEKRAQVGIKDNLIRFSCGIESADDIWADFEQAFAKI  412



>ref|XP_002506028.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67286.1| predicted protein [Micromonas sp. RCC299]
Length=376

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G ++ V+ VR  H+ILGG ++P+AAYL++RG+KTL LRV++ N  A+++A  LE H
Sbjct  190  GAIVGDKETVAKVRQFHNILGGVIDPHAAYLVMRGIKTLQLRVERHNENAMKLATALEKH  249

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P + +V+YPGLPSHP+H +AKK M GFGGVVSFE+ GDL  TAKF+D  ++PYIAPS GG
Sbjct  250  PMIEKVHYPGLPSHPDHEVAKKYMNGFGGVVSFEVKGDLWATAKFIDNCRLPYIAPSLGG  309

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++QP ++SYWD     RA  GI DNLVR + G+ED+ D++AD++QAL++I
Sbjct  310  VESLIEQPTVVSYWDQGPERRAEIGIKDNLVRMACGIEDYADIEADIIQALDSI  363



>gb|AFW87952.1| hypothetical protein ZEAMMB73_590146 [Zea mays]
Length=314

 Score =   222 bits (565),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG ++LVS VR  HH++GG LNPNAAYLI+RGMKTLHLRVQ QN+TALRMA+ LE H
Sbjct  150  GCVSGRDELVSKVRIYHHVVGGVLNPNAAYLILRGMKTLHLRVQCQNNTALRMAQFLEEH  209

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
             K+ RVYYPGLPSHPEHHIAK QMTGFGGVVSFE+ GD   T KF+D++KIPY APSFGG
Sbjct  210  LKIARVYYPGLPSHPEHHIAKSQMTGFGGVVSFEVAGDFDATRKFIDSVKIPYHAPSFGG  269

Query  361  CESIVDQPAIMSY  399
            CESI+DQPAIMSY
Sbjct  270  CESIIDQPAIMSY  282



>gb|KDD72103.1| Cys/Met metabolism PLP-dependent enzyme, partial [Helicosporidium 
sp. ATCC 50920]
Length=172

 Score =   216 bits (549),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = +1

Query  10   SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKV  189
            +G   LV+ VR +H++LGGTL+P+AAYL++RG+KTL LRVQ+ +++AL +A  LE HPKV
Sbjct  1    AGRADLVAAVRAMHNVLGGTLDPHAAYLLLRGLKTLDLRVQRADASALELARRLEEHPKV  60

Query  190  RRVYYPGLPSHPEHHIAKKQMTG-FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE  366
            +RV+YPGL SHP+  +A++QM G +GG+VSFE+ GDL T A+ VDA+++PYIAPS GG E
Sbjct  61   QRVHYPGLDSHPDAAVARRQMAGGYGGLVSFEVRGDLWTAARVVDAVRLPYIAPSLGGVE  120

Query  367  SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  516
            S+++QP ++SYWD T  +RA  GI D L+RFS GVE+FED+  D+ QALE
Sbjct  121  SLIEQPTVVSYWDHTPQQRADLGISDQLIRFSVGVENFEDLWQDLAQALE  170



>gb|KIZ06880.1| cystathionine gamma-synthase [Monoraphidium neglectum]
Length=1211

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 136/174 (78%), Gaps = 0/174 (0%)
 Frame = +1

Query  1     GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
             G I+G   LV  VR  H++LGG ++P+AAYL++RGMKTL LRV++QN +AL +A  LEAH
Sbjct  1038  GSIAGRADLVETVRQAHNVLGGVIDPHAAYLLLRGMKTLDLRVERQNKSALELARRLEAH  1097

Query  181   PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
             PK+ RV+YPGLPSHP+H IA  QM+GFGGVVSFE+DGDL  TA F+DA+++P IAPS GG
Sbjct  1098  PKIARVHYPGLPSHPDHEIAVAQMSGFGGVVSFEVDGDLWRTAAFIDAVRLPRIAPSLGG  1157

Query  361   CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
              ES+++QP I+SYWD     RA  GI D+LVRFS GVE FED+ ADV QAL+ I
Sbjct  1158  VESLIEQPTIISYWDQGPEARAKIGIKDSLVRFSVGVEAFEDIWADVEQALDQI  1211



>gb|EMT05299.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=499

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 136/207 (66%), Gaps = 33/207 (16%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG + L+S +R  HH +GGT++P+AAY+IIRG+KT+ LRV  QN TALRMA +LE H
Sbjct  293  GCISGSDALISRIRVWHHDIGGTISPDAAYMIIRGLKTMALRVDTQNRTALRMARLLENH  352

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P + RVYYPGL + P HHIAK QMTG GG++SFE+  DL    +F+DAL+IP+IA S GG
Sbjct  353  PMIERVYYPGLTTSPWHHIAKSQMTGSGGIISFEVASDLHGVMRFIDALEIPFIAMSLGG  412

Query  361  CESIVDQPAIMSYW---------------------------------DLTQAERAAYGIM  441
            CES+V QPA+MS+W                                   +  E+A  GI 
Sbjct  413  CESLVQQPAVMSFWYAFGFLSLQRTICNSNIVRRIGHSIAWFSVYIRGQSGEEKANNGIK  472

Query  442  DNLVRFSFGVEDFEDVKADVLQALETI  522
            DNLVRFSFG+E FED+K DVLQAL+ I
Sbjct  473  DNLVRFSFGIEKFEDLKDDVLQALKKI  499



>ref|XP_001695742.1| cystathionine gamma-synthase [Chlamydomonas reinhardtii]
 gb|EDP01529.1| cystathionine gamma-synthase [Chlamydomonas reinhardtii]
Length=466

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G ++LV  VR  HHI+GG ++P+AAYL++RG+KTL LRV + N++A+ +A  LE+H
Sbjct  292  GALCGKKELVEKVREFHHIMGGVVDPHAAYLLLRGLKTLELRVTRHNASAMEIARRLESH  351

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RV+YPGL SHP+H IAK+QM+GFGGVVSFE  G L     F+D +K+PYIAPS GG
Sbjct  352  PKVVRVWYPGLESHPDHAIAKRQMSGFGGVVSFETRGGLNECISFIDNVKLPYIAPSLGG  411

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++ PA+ SYW      RA  GI +NL+RFS GVED ED+ AD++QALE +
Sbjct  412  VESLIEMPAVQSYWGFGPERRAQIGIKENLIRFSIGVEDVEDIWADLVQALEYV  465



>ref|XP_002953537.1| hypothetical protein VOLCADRAFT_75793 [Volvox carteri f. nagariensis]
 gb|EFJ45510.1| hypothetical protein VOLCADRAFT_75793 [Volvox carteri f. nagariensis]
Length=473

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 130/174 (75%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G  +LV  VR  HHI+GG ++P+AAYL++RG+KTL LRV++ N +A+ +A  LE H
Sbjct  299  GALCGKPELVGKVREFHHIMGGVVDPHAAYLLLRGLKTLDLRVERHNRSAMEIARRLEQH  358

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RV+YPGL SHP+H IAK+QM+GFGGVVSFE+ G L     F+D +K+PYIAPS GG
Sbjct  359  PKIDRVWYPGLESHPDHAIAKRQMSGFGGVVSFEVRGGLQECISFIDNVKLPYIAPSLGG  418

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++ PA+ SYW      RA  GI +NLVRFS G+ED +D+ AD++QALE +
Sbjct  419  VESLIEMPAVQSYWGFGPERRAQIGIKENLVRFSIGIEDVDDIWADLVQALEYV  472



>gb|EEC80304.1| hypothetical protein OsI_22339 [Oryza sativa Indica Group]
Length=380

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  79   NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG  258
            NAAY+IIRG+KT+ LRV+ QN TALR+A +LE HPKV RVYYP L S P H +A++QMTG
Sbjct  233  NAAYMIIRGLKTMALRVEAQNRTALRVARLLERHPKVERVYYPWLESSPWHGVARRQMTG  292

Query  259  FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGI  438
             GGV+SFE+  D+    +FVDAL++P+IA S GGCES+V QPAIMSYW  + AE+A  GI
Sbjct  293  AGGVISFEVASDMRGAMRFVDALELPFIATSLGGCESLVQQPAIMSYWGKSDAEKAENGI  352

Query  439  MDNLVRFSFGVEDFEDVKADVLQALETI  522
             DNLVRFSFG+E FED+K D+LQALE I
Sbjct  353  KDNLVRFSFGIEKFEDLKDDILQALEKI  380



>ref|XP_011397361.1| Cystathionine gamma-synthase, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM24473.1| Cystathionine gamma-synthase, chloroplastic [Auxenochlorella 
protothecoides]
Length=390

 Score =   208 bits (530),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 133/174 (76%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ++G   LV+ VR +H++LGG ++P+AAYL++RGMKTL LRV + N+TA  +A  LE H
Sbjct  217  GALAGRGDLVAAVRAMHNVLGGVMDPHAAYLLLRGMKTLDLRVARANATAATLAARLEEH  276

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RV+YPGL SHP+H IA  QM GFGG+VSFE+ GDL  TA+FVDA ++PYIAPS GG
Sbjct  277  PRVARVHYPGLTSHPDHAIAAAQMDGFGGMVSFEVAGDLWATARFVDACRLPYIAPSMGG  336

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++QP I+SYWD    ERA  GI D+LVRFS GVE  ED+ AD+ QALE +
Sbjct  337  VESLIEQPTIVSYWDQGPEERARLGIRDSLVRFSCGVEAAEDIWADLAQALEAV  390



>ref|XP_007024260.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein, putative [Theobroma cacao]
 gb|EOY26882.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein, putative [Theobroma cacao]
Length=266

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  151  LRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALK  330
            ++  +VLEAHP V+R Y+PGLPSH EH IAK+QMTGFGGVVSFE+D DLMTT KFVDA K
Sbjct  92   IKDGKVLEAHPWVKRFYHPGLPSHSEHEIAKQQMTGFGGVVSFEVDRDLMTTIKFVDAFK  151

Query  331  IPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQA  510
            IP IAPS GGCESI DQP IMSYWDLTQAER  YGI DNLVRFSFGVEDF+D+KAD+LQA
Sbjct  152  IPNIAPSLGGCESIADQPTIMSYWDLTQAERRKYGIEDNLVRFSFGVEDFKDLKADILQA  211



>gb|EEE65425.1| hypothetical protein OsJ_20780 [Oryza sativa Japonica Group]
Length=380

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +1

Query  79   NAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTG  258
            NAAY+IIRG+KT+ LRV+ QN TALR+A +LE HPKV RV YP L S P H +A+KQMTG
Sbjct  233  NAAYMIIRGLKTMALRVEAQNRTALRVARLLERHPKVERVNYPWLESSPWHGVARKQMTG  292

Query  259  FGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGI  438
             GGV+SFE+  D+    +FVDAL++P+IA S GGCES+V QPAIMSYW  ++AE+   GI
Sbjct  293  AGGVISFEVASDMRGAMRFVDALELPFIATSLGGCESLVQQPAIMSYWGKSEAEKTENGI  352

Query  439  MDNLVRFSFGVEDFEDVKADVLQALETI  522
             DNLVRFSFG+E FED+K D+LQALE I
Sbjct  353  KDNLVRFSFGIEKFEDLKDDILQALEKI  380



>ref|WP_012828513.1| cystathionine gamma-synthase [Haliangium ochraceum]
 ref|YP_003267806.1| cystathionine gamma-synthase [Haliangium ochraceum DSM 14365]
 gb|ACY15913.1| Cystathionine gamma-synthase [Haliangium ochraceum DSM 14365]
Length=395

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 127/172 (74%), Gaps = 0/172 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G   LV  +R    +LGG L+ ++ YL+IRG+KTL LRV +QN TA+ +A  LEAH
Sbjct  222  GAVVGSAPLVQALREFRGVLGGILDAHSGYLLIRGLKTLQLRVARQNQTAMAVARALEAH  281

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P V RVYYPGL SHP+H IAK+ M GFGGVVSF + GDL +T++F+DA  +P I PS GG
Sbjct  282  PHVERVYYPGLESHPDHEIAKRHMRGFGGVVSFLVKGDLDSTSRFIDACTLPVIGPSLGG  341

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  516
             ES+++QPA+MS+++L+  +R A GI DNLVR S GVE+ ED+ AD+ QAL+
Sbjct  342  VESLIEQPALMSFYELSTEQRLAIGIRDNLVRLSVGVEETEDLIADLTQALD  393



>gb|EMT09615.1| Cystathionine gamma-synthase, chloroplastic [Aegilops tauschii]
Length=517

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 121/164 (74%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG E L+S +R  HH LGG ++P+AAY+IIRG+KT+ LRV+ QN T+LRMA +LE H
Sbjct  287  GCISGSEALISRIRAWHHDLGGAISPDAAYMIIRGLKTMALRVETQNQTSLRMARLLENH  346

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P H IAK QMTGFGGV+SFE+  DL    +FVDAL+IP+IA S GG
Sbjct  347  PKIERVYYPGLLSSPWHDIAKSQMTGFGGVISFEVASDLHGVMRFVDALEIPFIATSLGG  406

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVK  492
            CES+V QPA+MS+W  +  E+A  GI DNL      ++  E V+
Sbjct  407  CESLVQQPAVMSFWGQSDEEKAKNGIKDNLAALVHQLDQLEVVE  450



>gb|ETW97684.1| hypothetical protein ETSY2_44200, partial [Candidatus Entotheonella 
sp. TSY2]
Length=206

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 124/174 (71%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G   ++  +R    ILGG  +PN+AYL++RG+K+  LR+ Q N+    +A  LE+H
Sbjct  32   GVVVGKAGMIDALRESQSILGGITDPNSAYLLLRGLKSFALRMAQHNANGAALAAFLESH  91

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVRRVYYPGL SHP H +A+ QM GFGG+VSFE+D  +     F+DAL++PY+APS GG
Sbjct  92   PKVRRVYYPGLKSHPSHAVARAQMRGFGGLVSFELDATMAQAGAFIDALELPYMAPSLGG  151

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+V+QPAI+SY+++   ER   GI D+LVR++ G+ED +D+  DV QAL+ +
Sbjct  152  VESLVEQPAIVSYYEMAPEERQKIGISDSLVRYAAGIEDTDDLLTDVEQALKVL  205



>ref|WP_029671929.1| cystathionine gamma-synthase [Candidatus Hydrogenedens terephthalicus]
Length=389

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 129/172 (75%), Gaps = 0/172 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G  +LV  VR LH  +GG ++P+  YL++RG+KT  LR+++QN+TA+ +A+ LE H
Sbjct  213  GAVLGRSELVEEVRKLHKAMGGVIDPHCCYLLLRGLKTFSLRMERQNNTAMLIAKFLEGH  272

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P++++VYYPGL SHP HHIAK QM GFGGVV+F+I G+L T  KF+D+L++ YIAPS GG
Sbjct  273  PQIKKVYYPGLESHPHHHIAKAQMKGFGGVVTFDIKGNLNTAKKFMDSLQLCYIAPSLGG  332

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  516
             E+++  PA++SY+D T+ ER   GI D L R + G+E+ ED+ AD+ QAL+
Sbjct  333  VETLITHPALVSYYDYTRKERYELGITDTLFRLAVGIEEPEDIIADIDQALK  384



>ref|WP_006563164.1| cystathionine gamma-synthase [Oscillochloris trichoides]
 gb|EFO79475.1| cystathionine gamma-synthase [Oscillochloris trichoides DG-6]
Length=399

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 128/172 (74%), Gaps = 0/172 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G   L+  +R    I+G   +P +A+L++RG+KT  LR+++ N   L +A+ LE H
Sbjct  223  GVVIGRPALIQPLRQEQGIVGAISDPQSAFLLLRGLKTFGLRMERHNQNGLAVAQFLERH  282

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RV+YPGLPSHP+H +A  QM GFGGVVSFEI+GDL  TA+ +D +KIPYIAPS GG
Sbjct  283  PRVTRVHYPGLPSHPDHAVASAQMRGFGGVVSFEIEGDLEATARMLDLVKIPYIAPSLGG  342

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  516
             ES+++QPAI+SY+++T  +R A GI DNLVRF+ GVED +D+ AD+ QALE
Sbjct  343  VESLIEQPAIISYYEMTTEQRNAIGIYDNLVRFACGVEDAQDLIADLAQALE  394



>dbj|BAD37853.1| putative O-succinylhomoserine (thiol)-lyase [Oryza sativa Japonica 
Group]
Length=425

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +1

Query  85   AYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFG  264
            AY+IIRG+KT+ LRV+ QN TALR+A +LE HPKV RV YP L S P H +A+KQMTG G
Sbjct  280  AYMIIRGLKTMALRVEAQNRTALRVARLLERHPKVERVNYPWLESSPWHGVARKQMTGAG  339

Query  265  GVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMD  444
            GV+SFE+  D+    +FVDAL++P+IA S GGCES+V QPAIMSYW  ++AE+   GI D
Sbjct  340  GVISFEVASDMRGAMRFVDALELPFIATSLGGCESLVQQPAIMSYWGKSEAEKTENGIKD  399

Query  445  NLVRFSFGVEDFEDVKADVLQALETI  522
            NLVRFSFG+E FED+K D+LQALE I
Sbjct  400  NLVRFSFGIEKFEDLKDDILQALEKI  425



>gb|EAZ15990.1| hypothetical protein OsJ_31434 [Oryza sativa Japonica Group]
Length=449

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 115/158 (73%), Gaps = 3/158 (2%)
 Frame = +1

Query  49   HHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPE  228
            H ++ G    NAAY+IIRG+KTL LRVQ QN TALRMA++LE HPK+ RVYYPGL S P 
Sbjct  295  HDVIAGC---NAAYMIIRGLKTLALRVQAQNRTALRMAQLLEKHPKIERVYYPGLESSPW  351

Query  229  HHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDL  408
            H +A +QM G GGVV  E+  D+    +FVDAL++P IA S GGCES+V QPAIMSYW  
Sbjct  352  HGVATRQMAGAGGVVGLEVASDMRGAMRFVDALELPLIATSLGGCESLVQQPAIMSYWGK  411

Query  409  TQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
               E+A  GI DN VRFSFG+E FED++ D+LQAL  I
Sbjct  412  CDEEKAKNGIKDNFVRFSFGIEKFEDLRDDILQALGKI  449



>ref|WP_015940702.1| cystathionine gamma-synthase [Chloroflexus aggregans]
 gb|ACL24843.1| Cystathionine gamma-synthase [Chloroflexus aggregans DSM 9485]
Length=398

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 123/171 (72%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G   ++  +R    ILGG  +P+AAYL+ RG+KT  LR+++ N     +AE L  H
Sbjct  225  GVIIGRPPIIKALRETQGILGGICDPHAAYLLGRGLKTFALRMERHNQNGQAVAEFLAHH  284

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RV+YPGLP HP+H IA+ QM GFGGVVSFE+ GDL +    VD L++PYIAPSFGG
Sbjct  285  PRVTRVHYPGLPDHPDHTIARAQMRGFGGVVSFEVAGDLTSAMAVVDKLRLPYIAPSFGG  344

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
             ES+V+QPA+MSY++L+  ER A GI DNL+R S G+ED +D+ AD+ QAL
Sbjct  345  VESLVEQPALMSYYELSSEERLAVGIRDNLIRLSCGIEDADDLIADLQQAL  395



>ref|WP_020740637.1| cystathionine beta-lyase [Sorangium cellulosum]
 ref|YP_008155135.1| cystathionine beta-lyase [Sorangium cellulosum So0157-2]
 gb|AGP32869.1| cystathionine beta-lyase [Sorangium cellulosum So0157-2]
Length=387

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 125/174 (72%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G +SG   LVS+VR++  +LGG ++P+AA LI RGMKTL LRV++QN+T L +A  LEAH
Sbjct  211  GAVSGSSALVSLVRDMRSVLGGVIDPHAAALIGRGMKTLALRVERQNATGLAVARALEAH  270

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P V RV+YPGLPSHP+H IA  QM GFGGVVSF + G     A+ VD  +I  IAPSFGG
Sbjct  271  PAVERVFYPGLPSHPDHEIAAAQMRGFGGVVSFIVRGGREAAARVVDGTRIAAIAPSFGG  330

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             E++++QP IMS+ +L+  + AA GI   L+R S GVE+ EDV  DVL AL+ +
Sbjct  331  VETLIEQPCIMSFHELSDEQLAAIGISPALIRLSVGVEETEDVVKDVLAALDAL  384



>ref|WP_034419446.1| cystathionine gamma-synthase [Candidatus Entotheonella sp. TSY1]
 gb|ETW97960.1| cystathionine gamma-synthase [Candidatus Entotheonella sp. TSY1]
Length=396

 Score =   198 bits (504),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 125/174 (72%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G   ++  +R    ILGG  +PN+AYL++RG+K+  LR+ + N+    +A  LEAH
Sbjct  222  GVVVGKAGMIDALRESQGILGGITDPNSAYLLLRGLKSFALRMARHNANGAALASFLEAH  281

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVRRVYYPGL SHP H +A+ QM GFGG+VSFE+D  +  T  F+DAL++PY+APS GG
Sbjct  282  PKVRRVYYPGLKSHPSHAVARAQMRGFGGLVSFELDATMAQTGAFIDALELPYMAPSLGG  341

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+V+QPAI+SY+++   ER   GI D+LVR++ G+ED +D+  DV QAL+ +
Sbjct  342  VESLVEQPAIVSYYEMAPEERHQIGISDSLVRYAAGIEDTDDLLTDVEQALKVL  395



>ref|WP_012257342.1| MULTISPECIES: cystathionine gamma-synthase [Chloroflexus]
 ref|YP_001635075.1| cystathionine gamma-synthase [Chloroflexus aurantiacus J-10-fl]
 gb|ABY34686.1| Cystathionine gamma-synthase [Chloroflexus aurantiacus J-10-fl]
 gb|ACM52999.1| Cystathionine gamma-synthase [Chloroflexus sp. Y-400-fl]
Length=398

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 122/171 (71%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G   ++S +R    ILGG  +P+ AYL+ RG+KT  LR+++ N     +AE L  H
Sbjct  225  GVIIGRPPIISALRETQGILGGICDPHTAYLLGRGLKTFALRMERHNHNGQAVAEFLARH  284

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RV+YPGLP HP+H +A+ QM GFGGVVSFE+ GDL +    VD L++PYIAPSFGG
Sbjct  285  PRVSRVHYPGLPEHPDHAVARAQMRGFGGVVSFEVVGDLQSAMAVVDRLRLPYIAPSFGG  344

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
             ES+V+QPA+MSY++L+  ER A GI DNL+R S G+ED  D+ AD+ QAL
Sbjct  345  VESLVEQPALMSYYELSSEERLAVGIRDNLIRLSCGIEDVSDLIADLQQAL  395



>ref|WP_031459521.1| cystathionine gamma-synthase [Chloroflexus sp. MS-G]
Length=398

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 121/171 (71%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G   L+S +R    ILGG  +P+ AYL+ RG+KT  LR+++ N     +AE L  H
Sbjct  225  GVIIGRPPLISALRETQGILGGICDPHTAYLLGRGLKTFALRMERHNQNGQAVAEFLSRH  284

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RV+YPGLPSHP+H IA+ QM GFGGVVSFE+ GDL T    VD +++ YIAPSFGG
Sbjct  285  PRVSRVHYPGLPSHPDHAIARAQMRGFGGVVSFEVVGDLQTAMAVVDRMRLAYIAPSFGG  344

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
             ES+V+QPA+MSY++L+  ER A GI DNL+R S G+ED  D+ AD+ QA 
Sbjct  345  VESLVEQPALMSYYELSSEERLAVGIRDNLIRLSCGIEDASDLIADLQQAF  395



>ref|WP_012240206.1| cystathionine gamma-synthase [Sorangium cellulosum]
 ref|YP_001618247.1| cystathionine gamma-synthase [Sorangium cellulosum So ce56]
 emb|CAN97767.1| Cystathionine gamma-synthase [Sorangium cellulosum So ce56]
Length=398

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 127/176 (72%), Gaps = 0/176 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G +SG   L+S++R+L  +LGG ++P+AA LI RGMKTL LR+++QN+T L +A  LEAH
Sbjct  222  GAVSGSSALISLIRDLRSVLGGIMDPHAAALIGRGMKTLALRIERQNATGLAVARALEAH  281

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P V RV+YPGLPSHP+H +A +QM GFGGVVSF + G     ++ VD  ++  IAPSFGG
Sbjct  282  PAVERVFYPGLPSHPDHKVAAEQMRGFGGVVSFTVRGGREAASRVVDGTRVAAIAPSFGG  341

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI*G  528
             E++++QP IMS+ +L+  + AA GI   L+R S G+E+ EDV  DVL AL+ + G
Sbjct  342  VETLIEQPCIMSFHELSDEQLAAIGISPALIRLSVGIEETEDVVRDVLGALDALGG  397



>ref|WP_028458069.1| cystathionine gamma-synthase [Chloroflexus sp. Y-396-1]
Length=398

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 122/171 (71%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G   ++S +R    ILGG  +P+ AYL+ RG+KT  LR+++ N     +AE L  H
Sbjct  225  GVIIGRPPIISALRETQGILGGICDPHTAYLLGRGLKTFALRMERHNQNGQAVAEFLSRH  284

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RV+YPGLPSHP+H IA+ QM GFGGVVSFE+ GDL +    VD +++ YIAPSFGG
Sbjct  285  PRVSRVHYPGLPSHPDHAIARAQMRGFGGVVSFEVVGDLQSAMAVVDRMRLAYIAPSFGG  344

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
             ES+V+QPA+MSY++L+  ER A GI DNL+R S G+ED  D+ AD+ QAL
Sbjct  345  VESLVEQPALMSYYELSSEERLAVGIRDNLIRLSCGIEDASDLIADLQQAL  395



>ref|WP_041903797.1| cystathionine gamma-synthase [Latescibacteria bacterium SCGC 
AAA252-B13]
Length=391

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G EKLV+ + +   I+GG ++P+ AYL+IRG+KT  +R+++ N +   +A  LE+H
Sbjct  218  GVVLGEEKLVAEIVDFQKIMGGVIDPHCAYLLIRGLKTFCVRMEKLNRSGEEVARWLESH  277

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+RR YYP L SHP   +AK++M+GFG VV+FE+DGDL+ + +F+D LK+ YI PS GG
Sbjct  278  PKIRRCYYPSLDSHPHQDVAKREMSGFGAVVTFELDGDLVDSNRFLDNLKLCYIGPSLGG  337

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            CE+++  PA ++Y++ T+AER   GI+DNL R S G+ED ED+ AD+ QA++ I
Sbjct  338  CETLITHPATVTYYNCTRAERYELGILDNLFRLSVGLEDPEDIIADLDQAMKAI  391



>ref|WP_012174821.1| cystathionine gamma-synthase [Desulfococcus oleovorans]
 gb|ABW67205.1| Cystathionine gamma-synthase [Desulfococcus oleovorans Hxd3]
Length=392

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G +KLV  VR    I GG ++PN+AYL+IRG+KT  LR+++ N     +AE LE H
Sbjct  221  GVVLGSKKLVEPVREFLKITGGVIDPNSAYLLIRGLKTFGLRMERLNENGQIVAEGLERH  280

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGLPSHP H +AK QM GFG VV+FE++GD      F+  LKI  I PS GG
Sbjct  281  PKISRVYYPGLPSHPHHDVAKAQMKGFGAVVTFEVEGDCEYVLNFLSRLKIINIGPSLGG  340

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
             ES++  PA +SY+D T+ ER A GI D L+R + GVE+ ED+ AD+ QAL
Sbjct  341  VESLITHPATISYYDKTRKERLALGIKDGLIRLAVGVENAEDIIADIEQAL  391



>gb|ABB47533.1| Cys/Met metabolism PLP-dependent enzyme family protein [Oryza 
sativa Japonica Group]
Length=433

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+SG E LVS +R  HH LGG ++PNAAY+IIRG+KTL LRVQ QN TALRMA++LE H
Sbjct  300  GCVSGSEALVSRIRTWHHDLGGAISPNAAYMIIRGLKTLALRVQAQNRTALRMAQLLEKH  359

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ RVYYPGL S P H +A +QM G GGVV  E+  D+    +FVDAL++P IA S GG
Sbjct  360  PKIERVYYPGLESSPWHGVATRQMAGAGGVVGLEVASDMRGAMRFVDALELPLIATSLGG  419

Query  361  CESIVDQPAIMSYW  402
            CES+V QPAIMSYW
Sbjct  420  CESLVQQPAIMSYW  433



>ref|WP_007334081.1| cystathionine gamma-synthase [Rhodopirellula baltica]
 gb|EKK00234.1| methionine gamma-lyase [Rhodopirellula baltica SH28]
Length=417

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 122/175 (70%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG ++L+  +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  H
Sbjct  243  GVISGRKELLDPIRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQH  302

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            PK+ RVYYPGLPSHP H IAK+QM G+GG+++F + D D  TT++ VDA KI  IAPS G
Sbjct  303  PKIDRVYYPGLPSHPTHAIAKEQMLGYGGLITFTVKDADWKTTSRVVDAAKIARIAPSLG  362

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            G ES+++QP +MSY+  +  ERA +GI DN++RFS G+ED  D+ AD+ QAL  I
Sbjct  363  GTESLIEQPLVMSYFHYSPEERACFGIADNMIRFSCGIEDSADLIADLDQALAAI  417



>ref|WP_007324756.1| cystathionine gamma-synthase [Rhodopirellula baltica]
 gb|EGF29210.1| methionine gamma-lyase [Rhodopirellula baltica WH47]
Length=417

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 122/175 (70%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG ++L+  +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  H
Sbjct  243  GVISGRKELLDPIRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQH  302

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            PK+ RVYYPGLPSHP H IAK+QM G+GG+++F + D D  TT++ VDA KI  IAPS G
Sbjct  303  PKIDRVYYPGLPSHPTHAIAKEQMLGYGGLITFTVKDADWKTTSRVVDAAKIARIAPSLG  362

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            G ES+++QP +MSY+  +  ERA +GI DN++RFS G+ED  D+ AD+ QAL  I
Sbjct  363  GTESLIEQPLVMSYFHYSPEERACFGIADNMIRFSCGIEDSADLIADLDQALAAI  417



>ref|WP_011120920.1| cystathionine gamma-synthase [Rhodopirellula baltica]
 ref|NP_867259.1| cystathionine gamma-synthase [Rhodopirellula baltica SH 1]
 emb|CAD74805.1| cystathionine gamma-synthase [Rhodopirellula baltica SH 1]
Length=434

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 122/175 (70%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG ++L+  +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  H
Sbjct  260  GVISGRKELLDPIRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQH  319

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            PK+ RVYYPGLPSHP H IAK+QM G+GG+++F + D D  TT++ VDA KI  IAPS G
Sbjct  320  PKIDRVYYPGLPSHPTHAIAKEQMLGYGGLITFTVKDADWKTTSRVVDAAKIARIAPSLG  379

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            G ES+++QP +MSY+  +  ERA +GI DN++RFS G+ED  D+ AD+ QAL  I
Sbjct  380  GTESLIEQPLVMSYFHYSPEERACFGIADNMIRFSCGIEDSADLIADLDQALAAI  434



>ref|WP_008655459.1| methionine gamma-lyase [Rhodopirellula europaea]
 gb|EMB17591.1| methionine gamma-lyase [Rhodopirellula europaea 6C]
 gb|EMI28500.1| methionine gamma-lyase [Rhodopirellula europaea SH398]
Length=417

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 121/175 (69%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG ++L+  +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  H
Sbjct  243  GVISGRKELLDPIRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQH  302

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            PK+ RVYYPGLPSHP H IAK+QM GFGG+++F + D D  TT++ VD  KI  IAPS G
Sbjct  303  PKIERVYYPGLPSHPTHAIAKEQMLGFGGLITFTVKDADWKTTSRVVDGAKIARIAPSLG  362

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            G ES+++QP +MSY+  +  ERA +GI DN++R+S G+ED  D+ AD+ QAL  I
Sbjct  363  GTESLIEQPLVMSYFHYSPEERACFGIADNMIRYSCGIEDSADLIADLDQALAAI  417



>ref|WP_007339059.1| methionine gamma-lyase [Rhodopirellula baltica]
 gb|ELP31787.1| methionine gamma-lyase [Rhodopirellula baltica SWK14]
Length=417

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 121/175 (69%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG ++L+  +R L   LG   +P++ YL+ RG+KT  LR+Q+ N     +AE L  H
Sbjct  243  GVISGRKELLDPIRALRGCLGSVTSPHSMYLLERGLKTFSLRMQRHNENGQAVAEFLHQH  302

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            PK+ RVYYPGLPSHP H IAK+QM G+GG+++F + D D  TT++ VDA KI  IAPS G
Sbjct  303  PKIDRVYYPGLPSHPTHAIAKEQMLGYGGLITFTVKDADWKTTSRVVDAAKIARIAPSLG  362

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            G ES+++QP +MSY+  +  ERA +GI DN++RFS G+ED  D+ AD+  AL  I
Sbjct  363  GTESLIEQPLVMSYFHYSPEERACFGIADNMIRFSCGIEDSADLIADLDSALAAI  417



>ref|WP_002653306.1| cystathionine gamma-synthase [Blastopirellula marina]
 gb|EAQ77909.1| cystathionine gamma-synthase [Blastopirellula marina DSM 3645]
Length=402

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 122/175 (70%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G +  +  VR L  I+GG  +P+  YL++RG+KT  LR+++ N     +AE LE+H
Sbjct  228  GVIIGSKAQLESVRKLRGIMGGINSPHNIYLLLRGLKTFSLRMERHNQNGQAIAEFLESH  287

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            PKV +VYYPGLPSH    IAK+ M GFGG+++F + D D   TA  +DA+KIP IAPS G
Sbjct  288  PKVEKVYYPGLPSHKYFDIAKQTMRGFGGLITFLVKDADWRKTADVIDAVKIPRIAPSLG  347

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            G ES+++QP +MSY+ L   ERA +GI DN++R + G+ED ED+ AD+ QAL++I
Sbjct  348  GVESLIEQPLVMSYYQLAPEERAKFGIYDNMIRMACGIEDAEDLIADLKQALDSI  402



>gb|KJB75686.1| hypothetical protein B456_012G052100 [Gossypium raimondii]
Length=468

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GCISG EKLV+ +R LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH
Sbjct  365  GCISGSEKLVTEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  424

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI  285
            P+V+RVYYPGLPSHPEH IAK+QMTGFGGVVSFE+
Sbjct  425  PRVKRVYYPGLPSHPEHEIAKRQMTGFGGVVSFEV  459



>ref|WP_037466783.1| cystathionine gamma-synthase [Smithella sp. F21]
 gb|KFN37872.1| cystathionine gamma-synthase [Smithella sp. F21]
Length=395

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G ++LVS VR LH  +GG ++P+  YL++RG+KT  LRV+ QN +AL++AE LE H
Sbjct  222  GVLLGKKELVSKVRELHKSMGGVIDPHCCYLLLRGLKTFPLRVKAQNESALKIAEYLERH  281

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+ R YYP L SH  + IAK+QM G GGVV+F I GDL    +F+DAL++ YIAPS GG
Sbjct  282  PKIERAYYPFLKSHDHYSIAKEQMKGGGGVVTFTIKGDLDAAKRFMDALEMIYIAPSLGG  341

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADV  501
             E+++  PA ++Y+  ++ +R   GI+DNL R + G+ED ED+ AD+
Sbjct  342  VETLITHPATVTYYRYSREQRYDLGIVDNLFRLAVGIEDVEDIIADL  388



>ref|WP_014432877.1| cystathionine gamma-synthase [Caldilinea aerophila]
 dbj|BAL99638.1| cystathionine gamma-lyase [Caldilinea aerophila DSM 14535 = NBRC 
104270]
Length=407

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 119/174 (68%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ++G   L + +R +  +LG    P  AYLI+RG+KTL LR+++QN++ L +A  LE H
Sbjct  234  GVVAGRYDLTTPLRQMQGLLGNIAAPQTAYLILRGIKTLALRMERQNASGLAVARFLEGH  293

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVRRV+YP L SHP++ +A+  + G GGVVSFEI+GD     +F+DAL+IP I PS GG
Sbjct  294  PKVRRVWYPFLESHPDYAVARATLRGGGGVVSFEIEGDAGRAHRFIDALRIPVIGPSLGG  353

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ESIV   A+M Y +L+  ER A GI D LVR   G+ED E++ AD+ QAL+ I
Sbjct  354  VESIVSPLALMGYANLSPEERLALGIRDELVRLCIGIEDTENLIADLAQALDQI  407



>ref|WP_008695126.1| methionine gamma-lyase [Rhodopirellula maiorica]
 gb|EMI20813.1| methionine gamma-lyase [Rhodopirellula maiorica SM1]
Length=393

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 117/173 (68%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G  + +  VR+L  +LGG  +P+  YL+ RG+KT  LR+Q+ N   L +AE LE H
Sbjct  220  GVICGRREQLESVRSLRGVLGGVNSPHNLYLLERGLKTFALRMQRHNENGLAIAEFLENH  279

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            P+V RVYYPGL SHP H  A  QM G+GG+++F + D D   T++ VDA KIP IA S G
Sbjct  280  PRVDRVYYPGLKSHPSHDSAAAQMRGYGGLITFTVKDADWEETSRIVDAAKIPRIAASLG  339

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  516
            G ES+++QP +MSY+  T  +R  +GI DN++R S G+ED +D+ AD+ QAL+
Sbjct  340  GVESLIEQPLVMSYYHCTPEDRVRFGIADNMIRMSCGIEDTDDLIADLKQALQ  392



>ref|WP_009709642.1| cystathionine gamma-synthase [Desmospora sp. 8437]
 gb|EGK12254.1| methionine gamma-lyase [Desmospora sp. 8437]
Length=408

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 120/174 (69%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + GPE+LV  V +   I GGTL+P AAYL++RGMKTLHLRV+QQN +AL +A  LE+ 
Sbjct  225  GIVCGPEELVRKVYHYREINGGTLHPMAAYLLLRGMKTLHLRVRQQNESALTIARWLESQ  284

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RVYYPGL SHP +  A+KQM GFGGV+SF ++G       F+  L++ ++A + G 
Sbjct  285  PQVDRVYYPGLESHPHYETARKQMRGFGGVLSFSLEGGFDAVRSFLPHLRLAHLAANLGS  344

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             E++   P   S+ + T+ ER A GI + L+R+S G+E+ ED+ AD+ QAL+ +
Sbjct  345  VETVAGPPRTTSHVECTEEERRAMGIPEGLIRYSVGIEETEDLLADLKQALDRL  398



>ref|WP_012912576.1| cystathionine gamma-synthase [Pirellula staleyi]
 gb|ADB18315.1| Cystathionine gamma-synthase [Pirellula staleyi DSM 6068]
Length=401

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 119/173 (69%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ISG +  +  VR L  I+G   +P+  YL+ RG+KT  LR+Q+ N   L +A+ L AH
Sbjct  224  GVISGCKAKLDPVRKLRGIMGAINSPHNLYLLERGLKTFELRMQRHNENGLAVAKFLAAH  283

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            P+V +VYYPGL +HP + IA+KQM GFGG+++FEI D D   TA  VDA  I  IAPS G
Sbjct  284  PRVSKVYYPGLETHPYYEIARKQMRGFGGLITFEIKDADWKETAAIVDASTIARIAPSLG  343

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  516
            G ES+++QP +MSY+++   +R  +GI DN++R + G+E+ ED+ AD+ QALE
Sbjct  344  GAESLIEQPLVMSYFEVPPEDRKRFGIYDNMIRLACGIENSEDLIADLAQALE  396



>gb|KHD07814.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Candidatus 
Thiomargarita nelsonii]
 gb|KHD11747.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Candidatus 
Thiomargarita nelsonii]
Length=384

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 116/172 (67%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G +SG   L+  +RN  ++ G  ++PN A+ + RGMKTL LR+   N   L++A  LEAH
Sbjct  210  GTVSGSADLIEQIRNYRNVTGAIVDPNTAFFLNRGMKTLPLRMNHLNEVGLKLARYLEAH  269

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
             KVR+VYY  LPSHP H +AKK +T  GGVVSFE++     T +FVDAL+IP++  +FG 
Sbjct  270  DKVRQVYYTALPSHPHHALAKKYLTDHGGVVSFELEAGEKETTQFVDALQIPFMGTNFGL  329

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVE-DFEDVKADVLQAL  513
             +S+++Q AI +Y+ LT  ERA  GI D+LVR+S G E D ED+  D+ QAL
Sbjct  330  ADSMIEQCAIFTYYQLTPQERAEIGITDSLVRYSIGYEDDVEDIIQDLEQAL  381



>ref|WP_044251002.1| cystathionine gamma-synthase [Rhodopirellula sp. SWK7]
Length=417

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 119/172 (69%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G  +L+  VR L   LG   +P++ YL+ RG+KT  LR+ + N   L +A+ LE+H
Sbjct  241  GVICGRRELLDPVRALRGCLGSVSSPHSLYLLERGLKTFALRMARHNENGLAVAQFLESH  300

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            P+V RV+YPGL SHP H IA++QM GFGG+++F + D D   T++ VDA K+  IAPS G
Sbjct  301  PRVDRVFYPGLESHPTHAIAREQMKGFGGLITFTVKDADWRATSRVVDAAKLARIAPSLG  360

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
            G ES+++QP +MSY+  +  +R ++GI DN++RFS G+ED  D+ AD+ QAL
Sbjct  361  GVESLIEQPLVMSYFGYSPEQRESFGIADNMIRFSCGIEDSADLIADLDQAL  412



>gb|EMI46706.1| methionine gamma-lyase [Rhodopirellula sp. SWK7]
Length=431

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 119/172 (69%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G  +L+  VR L   LG   +P++ YL+ RG+KT  LR+ + N   L +A+ LE+H
Sbjct  255  GVICGRRELLDPVRALRGCLGSVSSPHSLYLLERGLKTFALRMARHNENGLAVAQFLESH  314

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            P+V RV+YPGL SHP H IA++QM GFGG+++F + D D   T++ VDA K+  IAPS G
Sbjct  315  PRVDRVFYPGLESHPTHAIAREQMKGFGGLITFTVKDADWRATSRVVDAAKLARIAPSLG  374

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
            G ES+++QP +MSY+  +  +R ++GI DN++RFS G+ED  D+ AD+ QAL
Sbjct  375  GVESLIEQPLVMSYFGYSPEQRESFGIADNMIRFSCGIEDSADLIADLDQAL  426



>ref|WP_036745737.1| hypothetical protein [Paenibacillus sp. UNC451MF]
Length=393

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 124/176 (70%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G    +  +R+   I+GGT+ P  AY + RG+KTL LR+++ N+TALR+A+ L+AH
Sbjct  219  GVLIGRASDIHRMRDSLEIMGGTIQPMMAYWVTRGLKTLGLRMERHNATALRVAQFLDAH  278

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKVR+VYYPGLPSHP++ IA  QM G+GGVV+FE+D  L    + VDA++IP +A S GG
Sbjct  279  PKVRKVYYPGLPSHPDYAIALSQMRGYGGVVTFEVD-HLEQARQVVDAMRIPRLASSLGG  337

Query  361  CESIVDQPAI--MSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES++   A+  M+Y+ +TQ ER    I D ++RFS G+ED +D+ AD+ QAL+ +
Sbjct  338  VESLISVTAMSAMAYFFMTQEERMERAIPDGMIRFSIGIEDPDDIIADLAQALDKL  393



>ref|WP_044302136.1| cystathionine gamma-synthase [Rhodopirellula sallentina]
Length=393

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 117/172 (68%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G  +L+  +R L   LG   +P+  YL+ RG+KT  LR+ + N   L +A+ LE H
Sbjct  217  GVICGRRELLDPIRALRGCLGSVSSPHNLYLLERGLKTFALRMARHNDNGLAVAQFLENH  276

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            P++ RV+YPGL SHP H IA +QM GFGG+++F + D D   +++ VDA ++  IAPS G
Sbjct  277  PRIERVFYPGLASHPTHAIASQQMRGFGGLITFTVKDADWKASSRVVDAARLARIAPSLG  336

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
            G ES+++QP +MSY+  +  ERA++GI DN++RFS G+ED  D+ AD+ QAL
Sbjct  337  GVESLIEQPLVMSYFSYSPEERASFGIADNMIRFSCGIEDPADLIADLDQAL  388



>gb|EMI56348.1| cystathionine gamma synthase [Rhodopirellula sallentina SM41]
Length=442

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 117/172 (68%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G  +L+  +R L   LG   +P+  YL+ RG+KT  LR+ + N   L +A+ LE H
Sbjct  266  GVICGRRELLDPIRALRGCLGSVSSPHNLYLLERGLKTFALRMARHNDNGLAVAQFLENH  325

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEI-DGDLMTTAKFVDALKIPYIAPSFG  357
            P++ RV+YPGL SHP H IA +QM GFGG+++F + D D   +++ VDA ++  IAPS G
Sbjct  326  PRIERVFYPGLASHPTHAIASQQMRGFGGLITFTVKDADWKASSRVVDAARLARIAPSLG  385

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
            G ES+++QP +MSY+  +  ERA++GI DN++RFS G+ED  D+ AD+ QAL
Sbjct  386  GVESLIEQPLVMSYFSYSPEERASFGIADNMIRFSCGIEDPADLIADLDQAL  437



>gb|KIG18323.1| Cystathionine gamma-synthase [Enhygromyxa salina]
Length=395

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 119/174 (68%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G   LV  +R     LG   +P+ A+L+ RG+KTL LR+++ N +AL +A +LE H
Sbjct  222  GVVVGRSGLVEAIREQVGTLGAVCDPHNAFLLGRGLKTLALRIERHNRSALAIATMLEEH  281

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV +V+YP L SH +H  A++ ++G GGVVSFE+ G L    K VDA++IP +APS GG
Sbjct  282  PKVAQVWYPLLASHQDHATARRYLSGGGGVVSFEVHGGLEAGTKLVDAVRIPKLAPSLGG  341

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+++QPA+MS++D     RA  GI + L+R S G+ED ED++AD+L AL+ +
Sbjct  342  VESLIEQPALMSFYDQGPEGRAQLGIREGLIRLSVGIEDLEDLRADLLAALDQM  395



>ref|XP_005702997.1| cystathionine gamma-synthase [Galdieria sulphuraria]
 gb|EME26477.1| cystathionine gamma-synthase [Galdieria sulphuraria]
Length=554

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 121/181 (67%), Gaps = 7/181 (4%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ++G + L+  +R+LH ILGG ++P+++YL++RGMKTL LR++  N  A  +A+ L  H
Sbjct  374  GVLAGKKDLLERIRSLHGILGGVVDPHSSYLLLRGMKTLPLRMRAHNENAAALAQELSQH  433

Query  181  PKVRRVYYPGLPSHPEHHIAKKQM-TGFGGVVSFEIDGD------LMTTAKFVDALKIPY  339
            PK+ +V+YP L +HP++ +AK     GFGGV+SFEI GD           +FVDAL IP+
Sbjct  434  PKIAKVHYPSLSNHPDYSVAKAHFKNGFGGVLSFEICGDPFGMDTFAAGIRFVDALSIPH  493

Query  340  IAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALET  519
            I PS GG ES+V+Q  IM Y+D  Q  R   GI + L+RFS GVED  D+  DVLQALE 
Sbjct  494  IGPSLGGVESLVEQVCIMGYFDQPQKVRRELGITNGLIRFSCGVEDKTDLLNDVLQALEA  553

Query  520  I  522
            +
Sbjct  554  V  554



>gb|EMS50136.1| Cystathionine gamma-synthase, chloroplastic [Triticum urartu]
Length=126

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  157  MAEVLEAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIP  336
            MA +LE HPK+ RVYYP L S P H IAK QMT  GGV+SFEI  DL    +FVDAL+IP
Sbjct  1    MARLLENHPKIERVYYPWLLSSPWHDIAKSQMTSCGGVISFEIASDLHGVMRFVDALEIP  60

Query  337  YIAPSFGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  516
            +IA S GGCES+V QPA+MS+W  +  E+A   I DNLVRFSFG+E FED+K D+LQALE
Sbjct  61   FIATSLGGCESLVQQPAVMSFWGQSDEEKAKNRIKDNLVRFSFGIEKFEDLKDDILQALE  120

Query  517  TI  522
             I
Sbjct  121  KI  122



>ref|WP_027178852.1| cystathionine gamma-synthase [Desulfovibrio bastinii]
Length=392

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 120/172 (70%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I+G ++L+S +     I+GGT++P AAYL+IRGMKTL LRV++QN  A+ +A+ LE H
Sbjct  220  GIITGSKELISKIYAYREIVGGTMHPMAAYLMIRGMKTLKLRVEKQNENAMEIAKFLENH  279

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTA-KFVDALKIPYIAPSFG  357
            P V RV+YPGL +HP H +A KQM+GFGG++SF + G+    A + +  LKI   A + G
Sbjct  280  PGVERVFYPGLENHPGHDVAVKQMSGFGGMLSFMVKGNTYEDACRCLTRLKIVRRAANLG  339

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
              E+I   PA  S+ + T  ERAA GI ++L+R+S G+ED ED+KAD+ QAL
Sbjct  340  SVETIAGPPATTSHVECTAEERAAMGIPESLIRYSVGIEDVEDLKADLDQAL  391



>ref|WP_009034610.1| cystathionine gamma-synthase [Indibacter alkaliphilus]
 gb|EOZ97091.1| Cystathionine gamma-synthase [Indibacter alkaliphilus LW1]
Length=396

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 117/174 (67%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G + L+  + +   I G TL+ N+AY+++RG+KTL LRV +QN  A+++ E LE H
Sbjct  223  GLVCGKKTLIDQIFHYREINGATLHANSAYMLLRGIKTLELRVLRQNENAMKLGEYLEGH  282

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PK+  V+YPGL SHP H IAKKQMTGFGGV+SF + GD      F+++L++ ++A S G 
Sbjct  283  PKIDSVFYPGLKSHPSHEIAKKQMTGFGGVLSFSLVGDFENVKLFLNSLELAHLAASLGS  342

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
              +++  P + S+ + T+ ER A GI ++L+R + G+E+ ED+ AD  QAL  I
Sbjct  343  VGTLIGPPKVTSHVEATEEERKALGIPESLIRCAVGIENIEDIIADFDQALSKI  396



>dbj|BAL55052.1| cystathionine gamma-lyase [uncultured Acidobacteria bacterium]
Length=392

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 116/174 (67%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I G    +        + G TL+P  A+L+IRGMKT  LR+++QN+ A R+AE L+AH
Sbjct  218  GAIVGSAAFIERCWTQAKLFGPTLSPFDAWLLIRGMKTFGLRLERQNANAQRIAEFLDAH  277

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV RV+YPGLPSHP+H +A++QM GFGG+V+FE+ G      + V++L++  +A S GG
Sbjct  278  PKVARVFYPGLPSHPQHDLARRQMRGFGGMVAFELKGGREAGRQLVESLRVITLAVSLGG  337

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
              S++  PA MS+  + + ER A GI + L+R S G+ED ED+ AD+ QAL  +
Sbjct  338  VTSLIQHPASMSHGPIPEEERQATGITEGLIRLSVGIEDAEDLIADLEQALRRL  391



>ref|WP_018150728.1| methionine gamma-lyase [Leeia oryzae]
Length=389

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 115/174 (66%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G +   ++L + +   H  LG  L+P  ++L++RG++T  +R+ + N   L +A+ LEAH
Sbjct  216  GVVCTSKELAARIWKTHITLGSVLSPMDSWLLLRGLRTFPMRMNRVNQNGLSLAQTLEAH  275

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RV YPGL SHP+H +AK+QM GFGG+VSF IDGD  T ++FV  LK+P  APS GG
Sbjct  276  PKVQRVLYPGLASHPQHELAKRQMKGFGGIVSFMIDGDYDTASRFVSLLKLPVNAPSLGG  335

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             +S+V   A M    LT  +    GI  NLVR++ G+E  +D+ AD+LQAL+ +
Sbjct  336  VDSLVIHAAAMWAGTLTPEQMKTAGIPVNLVRYAIGIEHSDDINADILQALDQL  389



>ref|WP_006976115.1| cystathionine gamma-synthase [Plesiocystis pacifica]
 gb|EDM74743.1| cystathionine gamma-synthase [Plesiocystis pacifica SIR-1]
Length=369

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 118/174 (68%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G   LV  +R     LG   +P+ AYL+ RG+KTL LRV++ N +AL +A VLEAH
Sbjct  197  GVVIGKSGLVDAIREQVGTLGAVCDPHNAYLLSRGLKTLALRVERHNHSALALARVLEAH  256

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV +V+YP L SH ++  A++ + G GGV+SFE++G L    + VDAL++P +APS GG
Sbjct  257  PKVAKVWYPLLESHQDYGHARRLLRGGGGVISFEVEG-LEAGTRLVDALRVPKLAPSLGG  315

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             ES+V+QPA+MS++D     RAA GI + L+R++ G+ED  D++AD+   L  +
Sbjct  316  VESLVEQPALMSFYDQGPEGRAALGIREGLIRYAVGIEDLADLRADLESGLAAL  369



>ref|WP_028852232.1| cystathionine beta-lyase [Thermocrispum municipale]
Length=385

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 115/174 (66%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            GC+ G   LV  VR   ++ GG+L+P+A +L+ RG+KTL +RV+QQN+ A  +AE L   
Sbjct  212  GCVIGRADLVDQVRATQNLFGGSLDPHAGFLLSRGIKTLGVRVRQQNTNAAAVAEFLAGR  271

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V +V+YPGLP+HP+H  A + + GFGG++SFE+ G         DAL++PY+APS GG
Sbjct  272  PEVAKVHYPGLPNHPDHAYAAELLDGFGGMLSFELVGGEQAVDALFDALQLPYVAPSLGG  331

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             E+ + +PA+ S+  +    RA  GI D+LVR S G+E  +D+ AD  QAL  +
Sbjct  332  VETTITKPAVTSHASVGADHRARVGIPDDLVRLSCGIEGADDLVADFEQALSKL  385



>ref|WP_016987095.1| cystathionine beta-lyase [Pseudomonas fluorescens]
Length=390

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = +1

Query  19   EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRV  198
            ++L   +  L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V+RV
Sbjct  223  QELAEKLGFLQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLEQQPQVKRV  282

Query  199  YYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVD  378
            YYPGLPSHP+H +AK+QM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++
Sbjct  283  YYPGLPSHPQHELAKRQMRGFGGMISVDLNSDLAGARRFLENVKIFALAESLGGVESLIE  342

Query  379  QPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             PAIM++  +    RA  GI D LVR S GVED ED++AD+ QAL++I
Sbjct  343  HPAIMTHATIPADTRAKLGIGDGLVRLSVGVEDVEDLRADLAQALQSI  390



>ref|WP_015243721.1| cystathionine gamma-synthase [Singulisphaera acidiphila]
 gb|AGA24536.1| cystathionine beta-lyase/cystathionine gamma-synthase [Singulisphaera 
acidiphila DSM 18658]
Length=403

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 115/173 (66%), Gaps = 1/173 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G ++G   LV  +     I G TL+ +AAYL++RGMKTL LRV++QNS AL +A  L AH
Sbjct  226  GVVAGDAALVEAIFRRREITGATLHADAAYLLLRGMKTLALRVERQNSNALTIARHLRAH  285

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMT-GFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFG  357
            P V +V+YPGL  HP H IAK+QM  GFGGV+SF++ GD     +F+  L+  + A + G
Sbjct  286  PLVEQVFYPGLEDHPNHEIAKRQMPGGFGGVLSFQLPGDFDAVKRFLPRLRWAHRAANLG  345

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALE  516
              E++V  PA  S+ +LT  ERAA GI + LVR+S G+ED  D+ AD+ QALE
Sbjct  346  AVETVVAPPATGSHVELTAKERAALGIPETLVRYSCGIEDVADLIADLDQALE  398



>ref|WP_034152361.1| cystathionine beta-lyase [Pseudomonas fluorescens]
 gb|KII36496.1| cystathionine beta-lyase [Pseudomonas fluorescens]
Length=390

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = +1

Query  19   EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRV  198
            ++L   +  L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V+RV
Sbjct  223  QELAEKLGFLQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLEQQPQVKRV  282

Query  199  YYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVD  378
            YYPGLPSHP+H +AK+QM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++
Sbjct  283  YYPGLPSHPQHELAKRQMRGFGGMISVDLNSDLAGARRFLENVKIFALAESLGGVESLIE  342

Query  379  QPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             PAIM++  +    RA  GI D LVR S GVED ED++AD+ QAL++I
Sbjct  343  HPAIMTHATIPADTRAKLGIGDGLVRLSVGVEDVEDLRADLAQALQSI  390



>ref|WP_042342462.1| methionine gamma-lyase [Bacillus timonensis]
Length=403

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 112/171 (65%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I    KL   + + H  +G  L+P  A+L++RG++TL LR+++ NS AL +AE LE  
Sbjct  230  GVICTSTKLAEKIWDTHTSIGSVLSPMDAWLLLRGLRTLPLRMERINSNALALAEFLEEQ  289

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P++ +VYYPGLPSHP+H +AKKQM GFG V++F I GD   T +FV ALK+   A S GG
Sbjct  290  PEIEKVYYPGLPSHPQHELAKKQMKGFGAVIAFAIKGDYNATNRFVSALKLSTNAVSLGG  349

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
             +S+V   A M    LT+ +    GI  N VR+S G+E  ED++AD++QAL
Sbjct  350  VDSLVVHTAAMWEGALTEEQMKTAGIPANFVRYSVGLEHIEDLQADIIQAL  400



>ref|WP_012501926.1| cystathionine beta-lyase [Chlorobaculum parvum]
 gb|ACF11093.1| Cystathionine gamma-synthase [Chlorobaculum parvum NCIB 8327]
Length=380

 Score =   164 bits (415),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 114/172 (66%), Gaps = 0/172 (0%)
 Frame = +1

Query  7    ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK  186
            ++  ++L   +RN     G    P   +L++RG+KTL +R+++   +AL +A  LEAHP 
Sbjct  209  VTSDDELHETIRNYQGAAGAVPGPWDCWLVLRGLKTLKIRMEEHQKSALHLARALEAHPA  268

Query  187  VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE  366
            V RV YPGLPSHP+H +AK QM+GFGG+V+  + G L  T+K +++LK+  IA S GG E
Sbjct  269  VSRVIYPGLPSHPQHELAKSQMSGFGGMVTIALKGGLPATSKLLNSLKLFVIADSLGGVE  328

Query  367  SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            S+V  PA M++  L+Q ER      D+LVR S G+E+ ED++ D+LQAL TI
Sbjct  329  SLVASPARMTFGPLSQEERDRRACTDDLVRLSVGLENAEDLEQDLLQALATI  380



>ref|WP_013905610.1| cystathionine beta-lyase [Pyrococcus yayanosii]
 ref|YP_004623825.1| cystathionine gamma-lyase [Pyrococcus yayanosii CH1]
 gb|AEH24553.1| cystathionine gamma-lyase [Pyrococcus yayanosii CH1]
Length=387

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = +1

Query  58   LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHI  237
            +G  L+P  ++L++RG+KTL +R+++    A+R+AE LE HP V +VYYPGLPSHP+H +
Sbjct  229  VGAILSPFDSWLVMRGIKTLAVRMERHEKNAMRIAEYLEEHPLVEKVYYPGLPSHPQHEL  288

Query  238  AKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQA  417
            AK+QM GFGG++SFE+ G L    KFV++L+I  +A S GG ES+++ PA+M++  L + 
Sbjct  289  AKRQMRGFGGMLSFELKGGLKEAVKFVESLEIFALAESLGGVESLIELPALMTHASLPKE  348

Query  418  ERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            ER   GI D+L+R S G+ED ED+  D+ +  E +
Sbjct  349  EREKVGIKDSLIRVSVGIEDVEDLIEDLERGFEAV  383



>ref|WP_007412771.1| cystathionine gamma-synthase [Pedosphaera parvula]
 gb|EEF63464.1| Cystathionine gamma-synthase [bacterium Ellin514]
Length=392

 Score =   164 bits (415),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/171 (47%), Positives = 115/171 (67%), Gaps = 0/171 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G ++LV  V +   I G  L+P AAYL++RGMKTL LRV +QN +AL++A+ LE+ 
Sbjct  221  GVVCGSKELVHQVYHHREITGAALDPMAAYLLLRGMKTLQLRVARQNESALKIAQFLESQ  280

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P V +V+YPGL SHP+H IA++QM GFGGV+SF + G       F+  L+  ++A + G 
Sbjct  281  PSVTQVFYPGLSSHPQHEIARQQMRGFGGVLSFMLKGGFDAVRAFLPRLRHAHLAANLGA  340

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
             E+I   PA  S+ + T  ERAA GI + L+R+S G+ED +D+ AD+ QAL
Sbjct  341  VETIAGPPATTSHVECTPEERAAMGIPEGLIRYSVGIEDVDDLIADLKQAL  391



>ref|WP_004068005.1| cystathionine beta-lyase [Thermococcus litoralis]
 ref|YP_008429540.1| cystathionine beta-lyase [Thermococcus litoralis DSM 5473]
 gb|EHR78732.1| cystathionine beta-lyase [Thermococcus litoralis DSM 5473]
Length=385

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = +1

Query  19   EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRV  198
            E+L   ++   + +G  L+P  ++L++RG+KTL LR+++    A+ +A+ LE HP V+RV
Sbjct  216  EELYEKLKFHQNAVGAVLSPFDSWLVMRGIKTLSLRMERHEKNAMAIAKYLEGHPLVKRV  275

Query  199  YYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVD  378
            YYPGLPSHP+H +AK+QM+GFGG++SFE+ G L    KFV++L+I  +A S GG ES+++
Sbjct  276  YYPGLPSHPQHELAKRQMSGFGGMLSFELKGGLEKAIKFVESLEIFALAESLGGVESLIE  335

Query  379  QPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             PAIM++  + + ER   GI D+L+R S G+ED ED+  D+ +  + +
Sbjct  336  LPAIMTHASVPKEERERVGIRDSLIRVSVGIEDVEDLIEDLERGFQAV  383



>ref|WP_035663612.1| cystathionine gamma-synthase [Bacillus akibai]
 dbj|GAE34641.1| cystathionine gamma-synthase [Bacillus akibai JCM 9157]
Length=393

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 116/174 (67%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G + G E LV  + +   I G T++P AAYL++RGMKTL LRV++Q   AL++AE L  H
Sbjct  218  GVVCGEEGLVKDIYHYREINGATMDPMAAYLLLRGMKTLKLRVEKQQENALKVAEFLSTH  277

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV +V+YPGL +H  H IAKKQM G+GG++SF + G+L    +F+  L++ + A + G 
Sbjct  278  PKVEQVFYPGLTTHKHHDIAKKQMNGYGGMLSFALKGELDAVRQFLPKLELAHRAANLGA  337

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             E+ V      S+ + T+ ERAA GI + LVR+S G+ED +D+ AD+ QAL+ I
Sbjct  338  VETTVGPARTTSHVENTKEERAALGIPEGLVRYSAGIEDIQDLIADLKQALDAI  391



>ref|WP_043248620.1| cystathionine beta-lyase [Pseudomonas knackmussii]
 emb|CDF81797.1| Cystathionine beta-lyase [Pseudomonas knackmussii B13]
Length=390

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = +1

Query  46   LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  225
            L + +G    P  A+L +RG+KTL LR+ +  S AL +A+ LE  P+V+RV+YPGLPSHP
Sbjct  232  LQNAVGAIAGPFDAFLTLRGVKTLALRMDRHCSNALELAQWLERQPQVKRVHYPGLPSHP  291

Query  226  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  405
            +H +AK+QM GFGGV+S ++  DL    +F++ ++I  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMNGFGGVISIDLATDLAGAKRFLENVQIFALAESLGGVESLIEHPAIMTHAT  351

Query  406  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            +  A RA  GI D LVR S GVED ED++AD+ QAL TI
Sbjct  352  IPPATRAELGIGDGLVRLSVGVEDVEDLRADLAQALATI  390



>ref|WP_034633929.1| cystathionine gamma-synthase, partial [Bacillus okhensis]
 gb|KHF37963.1| cystathionine gamma-synthase, partial [Bacillus okhensis]
Length=174

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 111/172 (65%), Gaps = 0/172 (0%)
 Frame = +1

Query  7    ISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPK  186
            + G E LV  + +   I G T++P AAYLI+RGMKTL LRV++Q   A+++A+ LE H K
Sbjct  1    VCGAESLVKDIYHYREINGATMDPMAAYLILRGMKTLRLRVEKQQENAMKVAQFLEMHEK  60

Query  187  VRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCE  366
            V  VYYPGL +H  H IAKKQM GFGG++SF + G+L    +F+  L+  + A + G  E
Sbjct  61   VEHVYYPGLTTHTNHDIAKKQMKGFGGMLSFALKGELEAVRQFLPKLEYAHRAANLGAVE  120

Query  367  SIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            + V      S+ + T  ERAA GI + LVR+S G+ED +D+  D+ QAL+ I
Sbjct  121  TTVGPARTTSHVENTPEERAALGIPEGLVRYSAGIEDIDDLLHDLKQALDEI  172



>ref|WP_017437713.1| methionine gamma-lyase [Geobacillus caldoxylosilyticus]
Length=401

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 114/174 (66%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I   E+L   + + H  +G  L+P  A+L++RG++TL +R+++ N+ AL +AE LE  
Sbjct  228  GVICTSEELAERIWHTHISIGSVLSPMDAWLLLRGLRTLPIRMERINANALALAEFLEQQ  287

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RVYYPGLPSHP+H +AK+QM GFG V++F I G    T +FV ALK+P  A S GG
Sbjct  288  PQVERVYYPGLPSHPQHELAKRQMRGFGAVIAFAIKGGYEETQRFVSALKLPPNAVSLGG  347

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             +S+V   A M    +T+ +    GI  N VRFS G+E  +D+KADV QAL+ +
Sbjct  348  VDSLVVHTAAMWEGVMTEEQMRTAGIPSNFVRFSVGIEHIDDLKADVWQALQVV  401



>ref|WP_015374550.1| MULTISPECIES: cystathionine gamma-synthase [Geobacillus]
 gb|AGE21886.1| cystathionine gamma-synthase [Geobacillus sp. GHH01]
 gb|EPR26402.1| Methionine gamma-lyase [Geobacillus sp. WSUCF1]
Length=401

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 114/174 (66%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I   E+L   + + H  +G  L+P  A+L++RG++TL +R+++ N+ AL +AE LE  
Sbjct  228  GVICTSEELAERIWHTHISIGSVLSPMDAWLLLRGLRTLPIRMERINANALALAEFLEQQ  287

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RVYYPGLPSHP+H +AK+QM GFG V++F I G    T +FV ALK+P  A S GG
Sbjct  288  PQVERVYYPGLPSHPQHELAKRQMKGFGAVIAFAIKGGYEETQRFVSALKLPPNAVSLGG  347

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             +S+V   A M    +T+ +    GI  N VRFS G+E  +D+KADV QAL+ +
Sbjct  348  VDSLVVHTAAMWEGVMTEEQMKTAGIPSNFVRFSVGIEHIDDLKADVWQALQVV  401



>ref|WP_042411373.1| methionine gamma-lyase [Geobacillus caldoxylosilyticus]
 dbj|GAJ41273.1| methionine gamma-lyase [Geobacillus caldoxylosilyticus NBRC 107762]
Length=401

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 114/174 (66%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I   E+L   + + H  +G  L+P  A+L++RG++TL +R+++ N+ AL +AE LE  
Sbjct  228  GVICTSEELAERIWHTHISIGSVLSPMDAWLLLRGLRTLPIRMERINANALALAEFLEQQ  287

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RVYYPGLPSHP+H +AK+QM GFG V++F I G    T +FV ALK+P  A S GG
Sbjct  288  PQVERVYYPGLPSHPQHELAKRQMRGFGAVIAFAIKGGYEETQRFVSALKLPPNAVSLGG  347

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             +S+V   A M    +T+ +    GI  N VRFS G+E  +D+KADV QAL+ +
Sbjct  348  VDSLVVHTAAMWEGVMTEEQMRTAGIPSNFVRFSVGIEHIDDLKADVWQALQVV  401



>ref|WP_014322773.1| cystathionine gamma-synthase [Desulfovibrio desulfuricans]
 gb|EGB15346.1| Cys/Met metabolism pyridoxal-phosphate-dependent protein [Desulfovibrio 
desulfuricans ND132]
Length=396

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 114/172 (66%), Gaps = 1/172 (1%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G   G  +L+  + +   I+G  L P +AYL++RGMKTLHLR+++QN+ AL +A  LE H
Sbjct  221  GVAVGSAELIKTIYSYREIVGNVLEPMSAYLLLRGMKTLHLRIERQNANALEIARFLEGH  280

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTA-KFVDALKIPYIAPSFG  357
            P V +V+YPGL SHP H IA +QM GFGG++SF   G     A + +  LK+   A + G
Sbjct  281  PGVEKVFYPGLESHPGHEIACRQMRGFGGMLSFVARGGTYADACRVLSRLKLARRAANLG  340

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
              E+I   PA  S+ + T+AERAA GI ++L+R+S G+ED ED+KAD+ +AL
Sbjct  341  AVETIAGPPATTSHVECTKAERAAMGIPESLIRYSVGIEDVEDLKADLDRAL  392



>dbj|GAM27720.1| hypothetical protein SAMD00019534_108960 [Acytostelium subglobosum 
LB1]
Length=384

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 118/175 (67%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    GCI-SGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEA  177
            GC+ +  E+L + ++ L + +G   +P   ++ +RG+KTLHLR+++    A  + + LE+
Sbjct  210  GCLATNDEQLFTKLKFLQNSIGAVPSPFDCFMALRGIKTLHLRMREHEKNAFAVVKFLES  269

Query  178  HPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFG  357
            H KV RV YPGLPSHP+H I K+QM GFGG+V F I GD+ T+ KF++ +K+  +A S G
Sbjct  270  HAKVERVVYPGLPSHPQHEICKRQMKGFGGMVVFFIKGDIATSRKFLENIKLFALAESLG  329

Query  358  GCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            G ES+++ P++M++  +   ER   GI D L+R S G+ED +D+ AD+ QAL+ I
Sbjct  330  GVESLIELPSVMTHASVPLEERIKLGITDTLIRLSVGIEDIDDLLADLRQALDKI  384



>ref|WP_043903364.1| methionine gamma-lyase [Geobacillus stearothermophilus]
 gb|EZP79167.1| cystathionine gamma-synthase [Geobacillus stearothermophilus 
NUB3621]
Length=401

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 114/174 (66%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I   E+L   + + H  +G  L+P  A+L++RG++TL +R+++ N+ AL +A+ LE  
Sbjct  228  GVICTSEELAERIWHTHISIGSVLSPMDAWLLLRGLRTLPIRMERINANALALAKFLEEQ  287

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RVYYPGLPSHP+H +AK+QM GFG V++F I G    T +FV ALK+P  A S GG
Sbjct  288  PQVERVYYPGLPSHPQHELAKRQMRGFGAVIAFAIKGGYEETQRFVSALKLPPNAVSLGG  347

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             +S+V   A M    +T+ +    GI  N VRFS G+E  ED+KADV QAL+ +
Sbjct  348  VDSLVVHTAAMWEGVMTEEQMKTAGIPSNFVRFSVGIEHIEDLKADVWQALQVV  401



>gb|EWG07846.1| hypothetical protein ASUL_02344 [Sulfolobales archaeon AZ1]
Length=374

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 114/174 (66%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G  +GP  +++ V  +   LG +L P  AYL++RG+KTL +R+   N  A+++AE LE H
Sbjct  201  GLSAGPASIMTKVDQMRRTLGTSLEPFPAYLVLRGLKTLKVRMDVINRNAMQVAEFLEDH  260

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            PKV+RVYYPGL SHP+H +A++ + G+GGVVSF++ G      K + +LKI   A S GG
Sbjct  261  PKVQRVYYPGLESHPDHSVARRVLKGYGGVVSFDVRGTANDALKVMQSLKIIIPAQSLGG  320

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
              S++  P  MS+  LT  ER A G+ + L+R S G+ED ED+  D+ QAL++I
Sbjct  321  VNSLISHPPTMSHRTLTPEERKAIGLNEGLLRLSVGIEDVEDLIEDLDQALKSI  374



>ref|WP_042681523.1| cystathionine gamma-synthase [Thermococcus sp. ES1]
 gb|AHF80774.1| cystathionine gamma-lyase [Thermococcus sp. ES1]
Length=386

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = +1

Query  58   LGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHPEHHI  237
            +G  L+P  ++L++RG+KTL +R+++    A+R+A+ LE HP V RVYYPGLPSHP+H +
Sbjct  230  VGAILSPFDSWLVMRGIKTLAVRMERHEKNAIRIAKYLEEHPLVERVYYPGLPSHPQHEL  289

Query  238  AKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWDLTQA  417
            A++QM GFGG++SFE+ G L    KFV++L+I  +A S GG ES+++ PA+M++  L + 
Sbjct  290  ARRQMRGFGGMLSFELKGGLKEAIKFVESLEIFALAESLGGVESLIELPALMTHASLPKE  349

Query  418  ERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            ER   GI D+L+R S G+ED ED+  D+ +  E +
Sbjct  350  EREKVGIKDSLIRVSVGIEDVEDLIEDLERGFEAV  384



>ref|WP_008085129.1| cystathionine beta-lyase [Pseudomonas sp. GM80]
 gb|EJN24164.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM80]
Length=390

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 115/168 (68%), Gaps = 0/168 (0%)
 Frame = +1

Query  19   EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRV  198
            E+L   +  L + +G    P  A+L +RG+KTL LR+++  S AL +A  LE  P+++RV
Sbjct  223  EELAEKLGFLQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLARWLEQQPQIKRV  282

Query  199  YYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVD  378
            YYPGL SHP+H +AK+QM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++
Sbjct  283  YYPGLESHPQHELAKRQMRGFGGMISVDLNSDLAGARRFLENVKIFALAESLGGVESLIE  342

Query  379  QPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             PAIM++  +    RA  GI D LVR S GVED ED++AD+ QAL++I
Sbjct  343  HPAIMTHATIPADTRAKLGIGDGLVRLSVGVEDIEDLRADLAQALQSI  390



>ref|WP_041961175.1| methionine gamma-lyase, partial [Bradyrhizobium japonicum]
 gb|KGT72700.1| methionine gamma-lyase, partial [Bradyrhizobium japonicum]
Length=244

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 113/174 (65%), Gaps = 0/174 (0%)
 Frame = +1

Query  1    GCISGPEKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAH  180
            G I   E+L   + + H  +G  L+P  A+L++RG++TL +RV++ N+ AL +AE LE  
Sbjct  71   GVICTSEELAERIWHTHISIGSVLSPMDAWLLLRGLRTLPMRVERINANALALAEFLEEQ  130

Query  181  PKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGG  360
            P+V RVYYPGL SHP+H +AK+QM GFG V++F I G    T +FV ALK+   A S GG
Sbjct  131  PQVERVYYPGLASHPQHELAKRQMRGFGAVIAFAIKGGYDATERFVSALKLSTNAVSLGG  190

Query  361  CESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             +S+V   A M    +T+ +    GI  N VR+S G+E  +D+KADVLQAL+ +
Sbjct  191  VDSLVVHTAAMWGGVMTEEQMRTAGIPPNFVRYSVGIEHIDDLKADVLQALQVV  244



>ref|WP_027621174.1| cystathionine beta-lyase [Pseudomonas sp. URHB0015]
Length=392

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = +1

Query  46   LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  225
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLERQPQVARVYYPGLPSHP  293

Query  226  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  405
            +H +A++QM GFGG++S +++ DL    +F++A++I  +A S GG ES+++QPAIM++  
Sbjct  294  QHALAQRQMRGFGGMISLDLNSDLAGARRFLEAVQIFALAESLGGVESLIEQPAIMTHAS  353

Query  406  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            +  A RA  GI D LVR S GVE  ED++AD+ QAL  I
Sbjct  354  IPAATRAQIGIGDALVRLSVGVEGIEDLRADLAQALAQI  392



>ref|WP_007999877.1| cystathionine beta-lyase [Pseudomonas sp. GM49]
 gb|EJM61025.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM49]
Length=392

 Score =   162 bits (409),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  46   LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  225
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVSRVYYPGLPSHP  293

Query  226  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  405
            +H +A++QM GFGG++S +++ DL  T +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELAQRQMRGFGGMISLDLNSDLAGTKRFLESVQIFALAESLGGVESLIEHPAIMTHAT  353

Query  406  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
            +    RA  GI D LVR S GVED ED++AD+ QAL
Sbjct  354  IPADTRAQLGIGDGLVRLSVGVEDVEDLRADLAQAL  389



>ref|WP_038368044.1| cystathionine beta-lyase [Pseudomonas chlororaphis]
 gb|KHA70669.1| cystathionine beta-lyase [Pseudomonas chlororaphis]
Length=390

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 116/168 (69%), Gaps = 0/168 (0%)
 Frame = +1

Query  19   EKLVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRV  198
            ++L   +  L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V+RV
Sbjct  223  QELAEKLGFLQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLEQQPQVKRV  282

Query  199  YYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVD  378
            YYPGL SHP+H +AK+QM GFGG++S +++ DL    +F++ +KI  +A S GG ES+++
Sbjct  283  YYPGLASHPQHELAKRQMRGFGGMISVDLNSDLAGARRFLENVKIFALAESLGGVESLIE  342

Query  379  QPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             PAIM++  +    RA  GI D LVR S GVED ED++AD+ QAL++I
Sbjct  343  HPAIMTHATIPAETRAKLGIGDGLVRLSVGVEDVEDLRADLAQALKSI  390



>ref|WP_007931537.1| cystathionine beta-lyase [Pseudomonas sp. GM17]
 gb|EJL97510.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM17]
Length=392

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 114/166 (69%), Gaps = 0/166 (0%)
 Frame = +1

Query  25   LVSVVRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYY  204
            LV  +  L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYY
Sbjct  227  LVERLGFLQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYY  286

Query  205  PGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQP  384
            PGLPSHP+H +A++QM GFGG++S ++D DL    +F+++++I  +A S GG ES+++ P
Sbjct  287  PGLPSHPQHALARRQMHGFGGMISLDLDCDLAGARRFLESVRIFALAESLGGVESLIEHP  346

Query  385  AIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            AIM++  +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  347  AIMTHASIPADTRAQLGIGDGLVRLSVGVEDVEDLRADLAQALTRI  392



>ref|WP_009858211.1| cystathionine beta-lyase [Rubrivivax benzoatilyticus]
 gb|EGJ11646.1| cystathionine gamma-lyase [Rubrivivax benzoatilyticus JA2 = ATCC 
BAA-35]
Length=397

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 122/177 (69%), Gaps = 4/177 (2%)
 Frame = +1

Query  4    CISGPEKLVSVVRN----LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVL  171
             + G ++ ++ VR     L + +G    P  ++L +RG+KTL LRV++ N+ AL +A  L
Sbjct  221  AVVGRDERLAPVRERLGFLQNAVGAIAGPFDSFLALRGVKTLALRVERHNANALELARWL  280

Query  172  EAHPKVRRVYYPGLPSHPEHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPS  351
            EA P+V RV+YPGL SHP+H +A++QM+GFGG++S ++  DL    +F++A+++  +A S
Sbjct  281  EAQPQVARVHYPGLESHPQHALARRQMSGFGGMISLDLATDLAGARRFLEAVRLFALAES  340

Query  352  FGGCESIVDQPAIMSYWDLTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
             GG ES+++ PAIM++  +    RAA GI+D+LVR S G+ED ED++AD+ QAL  I
Sbjct  341  LGGVESLIEHPAIMTHATIPPETRAALGIVDSLVRLSVGIEDVEDLRADLAQALAAI  397



>ref|WP_028940547.1| cystathionine beta-lyase [Pseudomonas umsongensis]
Length=398

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  46   LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  225
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  226  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  405
            +H +A++QM GFGG++S E++ DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELARRQMRGFGGMISVELNSDLTGARRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  406  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
            +    RA  GI D LVR S GVED ED++AD+ QAL
Sbjct  354  IPAETRAQLGISDALVRLSVGVEDVEDLRADLAQAL  389



>ref|WP_018926010.1| MULTISPECIES: cystathionine beta-lyase [Pseudomonas]
Length=398

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  46   LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  225
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  226  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  405
            +H +A++QM GFGG++S E++ DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELARRQMRGFGGMISVELNSDLTGARRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  406  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
            +    RA  GI D LVR S GVED ED++AD+ QAL
Sbjct  354  IPAETRAQLGISDALVRLSVGVEDVEDLRADLAQAL  389



>ref|WP_019649893.1| cystathionine beta-lyase [Pseudomonas sp. 45MFCol3.1]
Length=398

 Score =   161 bits (408),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  46   LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  225
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  226  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  405
            +H +A++QM GFGG++S E++ DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELARRQMRGFGGMISVELNSDLTGARRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  406  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
            +    RA  GI D LVR S GVED ED++AD+ QAL
Sbjct  354  IPAETRAQLGISDALVRLSVGVEDVEDLRADLAQAL  389



>ref|WP_009042798.1| cystathionine beta-lyase [Pseudomonas chlororaphis]
 gb|EJL09088.1| Cystathionine beta-lyase [Pseudomonas chlororaphis subsp. aureofaciens 
30-84]
Length=392

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 111/159 (70%), Gaps = 0/159 (0%)
 Frame = +1

Query  46   LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  225
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  226  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  405
            +H +A++QM GFGG++S ++D DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHALARRQMHGFGGMISLDLDCDLAGARRFLESVRIFALAESLGGVESLIEHPAIMTHAS  353

Query  406  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  354  IPADTRAQLGIGDGLVRLSVGVEDVEDLRADLAQALTRI  392



>ref|WP_008039031.1| cystathionine beta-lyase [Pseudomonas sp. GM67]
 gb|EJM89819.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM67]
Length=392

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 110/159 (69%), Gaps = 0/159 (0%)
 Frame = +1

Query  46   LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  225
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNSVGAIAGPFDAFLTLRGVKTLALRMERHCSNALELAQWLERQPQVARVYYPGLPSHP  293

Query  226  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  405
            +H +AK+QM GFGG++S ++  DL    +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELAKRQMRGFGGMISVDLKSDLAGATRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  406  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            +    RA  GI D LVR S GVED ED++AD+ QAL  I
Sbjct  354  IPAETRAQLGIGDGLVRLSVGVEDVEDLRADLAQALTRI  392



>ref|WP_008019625.1| cystathionine beta-lyase [Pseudomonas sp. GM55]
 gb|EJM72235.1| cystathionine beta-lyase/cystathionine gamma-synthase [Pseudomonas 
sp. GM55]
Length=392

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 111/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  46   LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  225
            L + +G    P  A+L +RG+KTL LR+++  S AL +A+ LE  P+V RVYYPGLPSHP
Sbjct  234  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCSNALDLAQWLERQPQVSRVYYPGLPSHP  293

Query  226  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  405
            +H +A++QM GFGG++S +++ DL  T +F+++++I  +A S GG ES+++ PAIM++  
Sbjct  294  QHELAQRQMRGFGGMISLDLNSDLAGTKRFLESVRIFALAESLGGVESLIEHPAIMTHAT  353

Query  406  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQAL  513
            +    RA  GI D LVR S GVED ED++AD+ QAL
Sbjct  354  IPPDTRAELGIGDGLVRLSVGVEDVEDLRADLAQAL  389



>ref|WP_043269495.1| cystathionine beta-lyase [Pseudomonas sp. AAC]
 gb|KES23992.1| cystathionine beta-lyase [Pseudomonas sp. AAC]
Length=390

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 112/159 (70%), Gaps = 0/159 (0%)
 Frame = +1

Query  46   LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTALRMAEVLEAHPKVRRVYYPGLPSHP  225
            L + +G    P  A+L +RG+KTL LR+++  + AL +A+ LE  P+V RV+YPGLPSHP
Sbjct  232  LQNAVGAIAGPFDAFLTLRGVKTLALRMERHCANALELAQWLERQPQVARVHYPGLPSHP  291

Query  226  EHHIAKKQMTGFGGVVSFEIDGDLMTTAKFVDALKIPYIAPSFGGCESIVDQPAIMSYWD  405
            +H +AK+QM GFGG++S ++  DL  + +F++ ++I  +A S GG ES+++ PAIM++  
Sbjct  292  QHELAKRQMNGFGGMISMDLATDLAGSKRFLENVRIFALAESLGGVESLIEHPAIMTHAT  351

Query  406  LTQAERAAYGIMDNLVRFSFGVEDFEDVKADVLQALETI  522
            +  A RA  GI D LVR S GVED ED++AD+ QAL TI
Sbjct  352  IPPATRAELGIGDALVRLSVGVEDVEDLRADLAQALATI  390



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090