BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFN031K17

Length=612
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP13516.1|  unnamed protein product                                271   2e-84   Coffea canephora [robusta coffee]
ref|XP_002515516.1|  grr1, plant, putative                              271   2e-83   Ricinus communis
gb|KDP33594.1|  hypothetical protein JCGZ_07165                         269   2e-82   Jatropha curcas
ref|XP_006483363.1|  PREDICTED: EIN3-binding F-box protein 1-like       266   2e-81   Citrus sinensis [apfelsine]
ref|XP_006450435.1|  hypothetical protein CICLE_v10007708mg             266   2e-81   Citrus clementina [clementine]
ref|XP_009801071.1|  PREDICTED: EIN3-binding F-box protein 1            264   2e-80   Nicotiana sylvestris
gb|KJB55011.1|  hypothetical protein B456_009G058000                    263   4e-80   Gossypium raimondii
ref|XP_002324298.2|  hypothetical protein POPTR_0018s01710g             261   1e-79   Populus trichocarpa [western balsam poplar]
ref|XP_009614726.1|  PREDICTED: EIN3-binding F-box protein 1-like       261   3e-79   Nicotiana tomentosiformis
ref|XP_007011864.1|  EIN3-binding F box protein 1                       261   4e-79   
ref|XP_009376923.1|  PREDICTED: EIN3-binding F-box protein 1-like       259   6e-79   Pyrus x bretschneideri [bai li]
ref|XP_007225116.1|  hypothetical protein PRUPE_ppa002673mg             259   1e-78   Prunus persica
gb|AFT92041.1|  EIN3 binding F-box 1                                    259   1e-78   Malus domestica [apple tree]
ref|XP_009376911.1|  PREDICTED: EIN3-binding F-box protein 1-like       258   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_009355743.1|  PREDICTED: EIN3-binding F-box protein 1-like       258   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_008378375.1|  PREDICTED: EIN3-binding F-box protein 1-like...    258   4e-78   
ref|XP_010250120.1|  PREDICTED: EIN3-binding F-box protein 1-like       258   4e-78   Nelumbo nucifera [Indian lotus]
ref|XP_008378376.1|  PREDICTED: EIN3-binding F-box protein 1-like...    258   9e-78   
emb|CBI21043.3|  unnamed protein product                                255   2e-77   Vitis vinifera
ref|XP_008445218.1|  PREDICTED: EIN3-binding F-box protein 1            255   4e-77   Cucumis melo [Oriental melon]
ref|XP_007161212.1|  hypothetical protein PHAVU_001G051300g             255   4e-77   Phaseolus vulgaris [French bean]
ref|XP_008394083.1|  PREDICTED: EIN3-binding F-box protein 1-like       255   4e-77   
gb|KHN33913.1|  EIN3-binding F-box protein 1                            254   4e-77   Glycine soja [wild soybean]
ref|XP_004291457.1|  PREDICTED: EIN3-binding F-box protein 1-like       254   5e-77   Fragaria vesca subsp. vesca
ref|XP_008365190.1|  PREDICTED: EIN3-binding F-box protein 1-like...    254   5e-77   
ref|XP_002285126.1|  PREDICTED: EIN3-binding F-box protein 1-like       255   5e-77   Vitis vinifera
gb|KJB82811.1|  hypothetical protein B456_013G215000                    254   5e-77   Gossypium raimondii
ref|XP_004138725.1|  PREDICTED: EIN3-binding F-box protein 1-like       254   6e-77   Cucumis sativus [cucumbers]
ref|XP_011017769.1|  PREDICTED: EIN3-binding F-box protein 1-like       254   7e-77   Populus euphratica
ref|XP_011036551.1|  PREDICTED: EIN3-binding F-box protein 1-like       254   8e-77   Populus euphratica
ref|XP_011016246.1|  PREDICTED: EIN3-binding F-box protein 1-like       254   9e-77   Populus euphratica
gb|KHG15742.1|  EIN3-binding F-box 1 -like protein                      254   1e-76   Gossypium arboreum [tree cotton]
ref|XP_008365191.1|  PREDICTED: EIN3-binding F-box protein 1-like...    254   1e-76   
ref|XP_003544614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    253   2e-76   Glycine max [soybeans]
ref|XP_003588766.1|  Ein3-binding f-box protein                         253   2e-76   Medicago truncatula
ref|XP_002308665.2|  grr1 family protein                                253   2e-76   
gb|KHG28503.1|  EIN3-binding F-box 1 -like protein                      251   9e-76   Gossypium arboreum [tree cotton]
ref|XP_002308982.2|  hypothetical protein POPTR_0006s06770g             251   9e-76   
ref|XP_006364926.1|  PREDICTED: EIN3-binding F-box protein 1-like       251   2e-75   Solanum tuberosum [potatoes]
ref|XP_011039690.1|  PREDICTED: EIN3-binding F-box protein 1-like       250   2e-75   Populus euphratica
ref|XP_002325221.1|  hypothetical protein POPTR_0018s13070g             249   3e-75   
ref|XP_011020134.1|  PREDICTED: EIN3-binding F-box protein 1-like       249   4e-75   Populus euphratica
gb|KJB65824.1|  hypothetical protein B456_010G114900                    249   4e-75   Gossypium raimondii
gb|KJB65823.1|  hypothetical protein B456_010G114900                    249   6e-75   Gossypium raimondii
ref|XP_010254418.1|  PREDICTED: EIN3-binding F-box protein 1-like       249   6e-75   Nelumbo nucifera [Indian lotus]
gb|KDP32417.1|  hypothetical protein JCGZ_13342                         249   8e-75   Jatropha curcas
ref|XP_010048202.1|  PREDICTED: EIN3-binding F-box protein 1-like       248   1e-74   
ref|XP_010102671.1|  EIN3-binding F-box protein 1                       249   2e-74   
ref|XP_002285249.2|  PREDICTED: EIN3-binding F-box protein 1-like       248   3e-74   Vitis vinifera
ref|NP_001234864.1|  EIN3-binding F-box protein 2                       248   4e-74   
ref|XP_011069870.1|  PREDICTED: EIN3-binding F-box protein 1            247   5e-74   Sesamum indicum [beniseed]
gb|KDO80236.1|  hypothetical protein CISIN_1g006749mg                   246   5e-74   Citrus sinensis [apfelsine]
ref|XP_006450916.1|  hypothetical protein CICLE_v10007739mg             246   5e-74   
ref|XP_004498740.1|  PREDICTED: EIN3-binding F-box protein 1-like       245   2e-73   Cicer arietinum [garbanzo]
emb|CAN82790.1|  hypothetical protein VITISV_030601                     247   2e-73   Vitis vinifera
emb|CAN83761.1|  hypothetical protein VITISV_043743                     246   2e-73   Vitis vinifera
ref|XP_004508488.1|  PREDICTED: EIN3-binding F-box protein 2-like       245   2e-73   Cicer arietinum [garbanzo]
ref|XP_006475854.1|  PREDICTED: EIN3-binding F-box protein 2-like       246   4e-73   
gb|KCW81401.1|  hypothetical protein EUGRSUZ_C02778                     244   6e-73   Eucalyptus grandis [rose gum]
ref|XP_010048972.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    243   8e-73   Eucalyptus grandis [rose gum]
gb|EYU20264.1|  hypothetical protein MIMGU_mgv1a002548mg                242   4e-72   Erythranthe guttata [common monkey flower]
ref|XP_007204219.1|  hypothetical protein PRUPE_ppa003009mg             240   6e-72   
ref|XP_002524506.1|  grr1, plant, putative                              241   1e-71   Ricinus communis
ref|XP_011081561.1|  PREDICTED: EIN3-binding F-box protein 1-like       240   2e-71   Sesamum indicum [beniseed]
ref|XP_011078374.1|  PREDICTED: EIN3-binding F-box protein 1-like       239   3e-71   Sesamum indicum [beniseed]
gb|KJB27084.1|  hypothetical protein B456_004G276800                    238   1e-70   Gossypium raimondii
ref|XP_008219497.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    236   2e-70   Prunus mume [ume]
ref|XP_003522614.1|  PREDICTED: EIN3-binding F-box protein 1-like...    236   3e-70   Glycine max [soybeans]
gb|EYU32346.1|  hypothetical protein MIMGU_mgv1a002758mg                236   4e-70   Erythranthe guttata [common monkey flower]
ref|XP_010696236.1|  PREDICTED: EIN3-binding F-box protein 1            236   5e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003542675.1|  PREDICTED: EIN3-binding F-box protein 1-like       236   5e-70   Glycine max [soybeans]
ref|XP_003549759.1|  PREDICTED: EIN3-binding F-box protein 1-like       235   1e-69   Glycine max [soybeans]
ref|XP_007013466.1|  Ein3-binding f-box protein 4                       236   1e-69   
ref|XP_009791397.1|  PREDICTED: EIN3-binding F-box protein 2-like       235   1e-69   Nicotiana sylvestris
gb|KJB54023.1|  hypothetical protein B456_009G017100                    234   3e-69   Gossypium raimondii
ref|XP_010086585.1|  hypothetical protein L484_002248                   233   5e-69   Morus notabilis
ref|XP_010526214.1|  PREDICTED: EIN3-binding F-box protein 1-like       233   7e-69   Tarenaya hassleriana [spider flower]
ref|XP_007137020.1|  hypothetical protein PHAVU_009G093200g             231   5e-68   Phaseolus vulgaris [French bean]
gb|EYU23011.1|  hypothetical protein MIMGU_mgv1a002803mg                230   6e-68   Erythranthe guttata [common monkey flower]
ref|NP_001234858.1|  EIN3-binding F-box protein 1                       230   7e-68   Solanum lycopersicum
ref|XP_007155011.1|  hypothetical protein PHAVU_003G165500g             230   1e-67   Phaseolus vulgaris [French bean]
ref|XP_006345227.1|  PREDICTED: EIN3-binding F-box protein 1-like       230   1e-67   Solanum tuberosum [potatoes]
ref|XP_009607234.1|  PREDICTED: EIN3-binding F-box protein 2-like       229   1e-67   Nicotiana tomentosiformis
ref|XP_004287307.1|  PREDICTED: EIN3-binding F-box protein 1-like       229   1e-67   Fragaria vesca subsp. vesca
ref|XP_007136869.1|  hypothetical protein PHAVU_009G080700g             229   1e-67   Phaseolus vulgaris [French bean]
ref|XP_010525963.1|  PREDICTED: EIN3-binding F-box protein 1-like       229   2e-67   Tarenaya hassleriana [spider flower]
gb|KHG14715.1|  EIN3-binding F-box 1 -like protein                      229   2e-67   Gossypium arboreum [tree cotton]
gb|KHN07078.1|  EIN3-binding F-box protein 1                            229   3e-67   Glycine soja [wild soybean]
gb|KHG24906.1|  EIN3-binding F-box 1 -like protein                      228   7e-67   Gossypium arboreum [tree cotton]
ref|XP_010429542.1|  PREDICTED: EIN3-binding F-box protein 1            226   2e-66   Camelina sativa [gold-of-pleasure]
gb|AFU61111.1|  F-box protein                                           226   3e-66   Capsicum annuum
emb|CDP10419.1|  unnamed protein product                                226   4e-66   Coffea canephora [robusta coffee]
dbj|BAF01819.1|  putative glucose regulated repressor protein           219   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009625259.1|  PREDICTED: EIN3-binding F-box protein 1-like       226   5e-66   Nicotiana tomentosiformis
ref|XP_009758784.1|  PREDICTED: EIN3-binding F-box protein 1-like       225   5e-66   Nicotiana sylvestris
ref|XP_008466405.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    225   9e-66   
ref|XP_010541915.1|  PREDICTED: EIN3-binding F-box protein 1-like       224   2e-65   Tarenaya hassleriana [spider flower]
ref|XP_008466407.1|  PREDICTED: EIN3-binding F-box protein 1 isof...    224   3e-65   
ref|XP_003522913.1|  PREDICTED: EIN3-binding F-box protein 1-like       223   3e-65   Glycine max [soybeans]
gb|KJB07737.1|  hypothetical protein B456_001G042600                    223   4e-65   Gossypium raimondii
ref|XP_003603398.1|  Ein3-binding f-box protein                         222   6e-65   
ref|XP_004173614.1|  PREDICTED: EIN3-binding F-box protein 1-like       222   1e-64   
gb|AES73649.2|  EIN3-binding F-box-like protein                         222   1e-64   Medicago truncatula
ref|XP_007138419.1|  hypothetical protein PHAVU_009G207300g             221   2e-64   Phaseolus vulgaris [French bean]
gb|KEH32122.1|  EIN3-binding F-box-like protein                         222   2e-64   Medicago truncatula
gb|KEH32121.1|  EIN3-binding F-box-like protein                         222   2e-64   Medicago truncatula
ref|NP_001281254.1|  EIN3-binding F-box protein 1-like                  221   2e-64   Cucumis sativus [cucumbers]
ref|XP_008792024.1|  PREDICTED: EIN3-binding F-box protein 1-like       221   3e-64   
ref|XP_003609344.1|  Ein3-binding f-box protein                         222   3e-64   
ref|XP_010907280.1|  PREDICTED: EIN3-binding F-box protein 1-like       221   3e-64   Elaeis guineensis
ref|XP_006358273.1|  PREDICTED: EIN3-binding F-box protein 1-like       221   3e-64   Solanum tuberosum [potatoes]
ref|XP_010533156.1|  PREDICTED: EIN3-binding F-box protein 1-like       220   5e-64   Tarenaya hassleriana [spider flower]
ref|XP_010417316.1|  PREDICTED: EIN3-binding F-box protein 1-like       220   5e-64   Camelina sativa [gold-of-pleasure]
dbj|BAH20224.1|  AT2G25490                                              219   5e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565597.1|  EIN3-binding F-box protein 1                          219   7e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KJB07621.1|  hypothetical protein B456_001G033400                    219   8e-64   Gossypium raimondii
ref|XP_006293838.1|  hypothetical protein CARUB_v10022822mg             218   2e-63   Capsella rubella
ref|XP_004242782.1|  PREDICTED: EIN3-binding F-box protein 1-like       218   2e-63   Solanum lycopersicum
ref|XP_008362900.1|  PREDICTED: EIN3-binding F-box protein 1-like       218   5e-63   
ref|XP_010047961.1|  PREDICTED: EIN3-binding F-box protein 1-like       218   5e-63   Eucalyptus grandis [rose gum]
ref|XP_002880682.1|  ein3-binding F box protein 1                       217   6e-63   
ref|XP_010907279.1|  PREDICTED: EIN3-binding F-box protein 1-like       218   6e-63   Elaeis guineensis
ref|XP_006405190.1|  hypothetical protein EUTSA_v10000087mg             216   1e-62   Eutrema salsugineum [saltwater cress]
ref|XP_010048082.1|  PREDICTED: EIN3-binding F-box protein 1-like       216   1e-62   Eucalyptus grandis [rose gum]
gb|KFK32577.1|  hypothetical protein AALP_AA6G261300                    216   2e-62   Arabis alpina [alpine rockcress]
ref|NP_001237471.1|  grr1 protein                                       217   2e-62   
ref|XP_008337284.1|  PREDICTED: EIN3-binding F-box protein 1-like       215   4e-62   
ref|XP_010472548.1|  PREDICTED: EIN3-binding F-box protein 1            214   7e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009368857.1|  PREDICTED: EIN3-binding F-box protein 1-like       214   8e-62   Pyrus x bretschneideri [bai li]
gb|AES91540.2|  EIN3-binding F-box-like protein                         214   1e-61   Medicago truncatula
ref|XP_008457494.1|  PREDICTED: EIN3-binding F-box protein 1-like       213   2e-61   Cucumis melo [Oriental melon]
emb|CDY35358.1|  BnaA04g14890D                                          212   3e-61   Brassica napus [oilseed rape]
ref|XP_009140675.1|  PREDICTED: EIN3-binding F-box protein 1            212   3e-61   Brassica rapa
ref|XP_004139306.1|  PREDICTED: EIN3-binding F-box protein 1-like       213   4e-61   Cucumis sativus [cucumbers]
ref|XP_003609343.1|  Ein3-binding f-box protein                         215   7e-61   
dbj|BAJ34438.1|  unnamed protein product                                207   8e-61   Eutrema halophilum
ref|XP_006842065.1|  hypothetical protein AMTR_s00078p00046140          210   2e-60   Amborella trichopoda
ref|XP_009364023.1|  PREDICTED: EIN3-binding F-box protein 1-like       210   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_008805624.1|  PREDICTED: EIN3-binding F-box protein 1-like       210   4e-60   Phoenix dactylifera
ref|XP_008805623.1|  PREDICTED: EIN3-binding F-box protein 1-like       208   2e-59   Phoenix dactylifera
ref|XP_010687976.1|  PREDICTED: EIN3-binding F-box protein 2-like       207   3e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004170235.1|  PREDICTED: LOW QUALITY PROTEIN: EIN3-binding...    205   3e-59   
ref|XP_006394785.1|  hypothetical protein EUTSA_v10003828mg             207   3e-59   Eutrema salsugineum [saltwater cress]
ref|XP_008443991.1|  PREDICTED: EIN3-binding F-box protein 1-like       206   6e-59   Cucumis melo [Oriental melon]
ref|XP_010541601.1|  PREDICTED: EIN3-binding F-box protein 2            206   6e-59   Tarenaya hassleriana [spider flower]
ref|XP_004150592.1|  PREDICTED: EIN3-binding F-box protein 1-like       204   3e-58   Cucumis sativus [cucumbers]
gb|ACB59221.1|  F-box protein                                           204   5e-58   Brassica oleracea
ref|XP_010454859.1|  PREDICTED: EIN3-binding F-box protein 2            203   6e-58   Camelina sativa [gold-of-pleasure]
gb|ADW83728.1|  EIN3-binding F-box protein 1                            198   4e-57   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010493788.1|  PREDICTED: EIN3-binding F-box protein 2-like       201   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009388655.1|  PREDICTED: EIN3-binding F-box protein 1-like       200   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS63568.1|  ein3-binding f-box protein 3                            199   2e-56   Genlisea aurea
ref|XP_010421385.1|  PREDICTED: EIN3-binding F-box protein 2-like       199   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010555012.1|  PREDICTED: EIN3-binding F-box protein 2-like       198   7e-56   Tarenaya hassleriana [spider flower]
gb|EMS45959.1|  hypothetical protein TRIUR3_29988                       192   9e-56   Triticum urartu
ref|XP_002453497.1|  hypothetical protein SORBIDRAFT_04g006870          197   1e-55   Sorghum bicolor [broomcorn]
ref|XP_009403463.1|  PREDICTED: EIN3-binding F-box protein 1-like       196   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004951542.1|  PREDICTED: EIN3-binding F-box protein 1-like       196   6e-55   Setaria italica
gb|EMT32544.1|  hypothetical protein F775_30491                         192   8e-55   
ref|XP_006648432.1|  PREDICTED: EIN3-binding F-box protein 1-like       192   1e-54   
ref|NP_001132560.1|  F-box family member                                188   3e-54   
ref|XP_010322126.1|  PREDICTED: EIN3-binding F-box protein 1-like       192   9e-54   
ref|NP_001145991.1|  uncharacterized protein LOC100279520               191   9e-54   
dbj|BAJ88579.1|  predicted protein                                      191   3e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68820.1|  hypothetical protein TRIUR3_29831                       188   3e-53   Triticum urartu
ref|XP_006657116.1|  PREDICTED: EIN3-binding F-box protein 1-like       190   4e-53   Oryza brachyantha
ref|XP_008677099.1|  PREDICTED: uncharacterized protein LOC100279...    191   4e-53   
ref|XP_009419280.1|  PREDICTED: EIN3-binding F-box protein 1-like       191   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS63879.1|  f-box family protein                                    190   8e-53   Genlisea aurea
ref|XP_003563656.1|  PREDICTED: EIN3-binding F-box protein 1            189   1e-52   Brachypodium distachyon [annual false brome]
gb|AFW66152.1|  hypothetical protein ZEAMMB73_923849                    190   1e-52   
dbj|BAD35544.1|  putative F-box protein Fbl2                            189   1e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006287278.1|  hypothetical protein CARUB_v10000473mg             189   1e-52   Capsella rubella
gb|EAZ01599.1|  hypothetical protein OsI_23635                          189   2e-52   Oryza sativa Indica Group [Indian rice]
ref|NP_197917.1|  EIN3-binding F-box protein 2                          188   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25485.1|  unknown                                                 187   3e-52   Picea sitchensis
emb|CDX80503.1|  BnaC07g29410D                                          188   3e-52   
gb|ACR35519.1|  unknown                                                 186   4e-52   Zea mays [maize]
gb|KCW80001.1|  hypothetical protein EUGRSUZ_C01334                     186   8e-52   Eucalyptus grandis [rose gum]
ref|XP_002437255.1|  hypothetical protein SORBIDRAFT_10g023670          179   1e-51   
ref|XP_008681226.1|  PREDICTED: F-box family member isoform X1          186   2e-51   
ref|NP_001046222.1|  Os02g0200900                                       184   2e-51   
gb|AEK81539.1|  EIN3 binding F-box 1                                    186   2e-51   Dianthus caryophyllus [carnation]
emb|CBI28209.3|  unnamed protein product                                184   2e-51   Vitis vinifera
dbj|BAD15849.1|  putative F-box protein                                 184   9e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EMT19526.1|  hypothetical protein F775_07091                         186   1e-50   
gb|AFA36487.1|  EIN3-binding F-box protein                              176   2e-50   Lolium perenne [perennial ryegrass]
ref|XP_009397481.1|  PREDICTED: EIN3-binding F-box protein 1-like       183   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002874252.1|  ein3-binding F box protein 2                       181   6e-50   
emb|CDX88173.1|  BnaA06g27640D                                          181   7e-50   
gb|EAY84905.1|  hypothetical protein OsI_06273                          182   7e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_004965933.1|  PREDICTED: EIN3-binding F-box protein 1-like       181   9e-50   Setaria italica
ref|NP_001147557.1|  LOC100281166                                       181   1e-49   Zea mays [maize]
ref|XP_003571400.1|  PREDICTED: EIN3-binding F-box protein 1-like       181   2e-49   Brachypodium distachyon [annual false brome]
emb|CDX87090.1|  BnaC09g04050D                                          179   5e-49   
ref|XP_009151059.1|  PREDICTED: EIN3-binding F-box protein 2            179   8e-49   Brassica rapa
ref|XP_009111664.1|  PREDICTED: EIN3-binding F-box protein 2-like       175   1e-47   Brassica rapa
emb|CDX76980.1|  BnaC04g37750D                                          175   2e-47   
gb|AFW87207.1|  hypothetical protein ZEAMMB73_795948                    174   3e-47   
ref|XP_009381112.1|  PREDICTED: EIN3-binding F-box protein 1-like       171   4e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY19807.1|  BnaA09g04600D                                          170   6e-46   Brassica napus [oilseed rape]
gb|ACF81449.1|  unknown                                                 130   8e-34   Zea mays [maize]
tpg|DAA44558.1|  TPA: hypothetical protein ZEAMMB73_857721              123   7e-31   
ref|XP_006849175.1|  hypothetical protein AMTR_s00027p00189050          117   6e-27   
ref|XP_001775242.1|  predicted protein                                  112   3e-25   
ref|XP_002981899.1|  hypothetical protein SELMODRAFT_233861             112   4e-25   
ref|XP_002986021.1|  hypothetical protein SELMODRAFT_123441             112   4e-25   
ref|XP_001783097.1|  predicted protein                                  110   3e-24   
ref|XP_010251723.1|  PREDICTED: EIN3-binding F-box protein 1-like       108   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010264613.1|  PREDICTED: EIN3-binding F-box protein 2-like       108   1e-23   Nelumbo nucifera [Indian lotus]
gb|KHM99176.1|  EIN3-binding F-box protein 1                          92.0    1e-19   Glycine soja [wild soybean]
ref|WP_032114111.1|  hypothetical protein                             95.5    4e-19   Candidatus Paracaedibacter symbiosus
ref|XP_002682758.1|  predicted protein                                91.3    1e-18   Naegleria gruberi strain NEG-M
ref|WP_032113191.1|  hypothetical protein                             88.6    5e-18   
ref|XP_010521976.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-re...  91.7    5e-18   Tarenaya hassleriana [spider flower]
ref|WP_032112559.1|  hypothetical protein                             88.6    1e-17   
gb|KJE94442.1|  hypothetical protein, variant                         92.0    1e-17   Capsaspora owczarzaki ATCC 30864
ref|XP_004346768.1|  hypothetical protein CAOG_05083                  92.0    1e-17   Capsaspora owczarzaki ATCC 30864
ref|XP_010908612.1|  PREDICTED: EIN3-binding F-box protein 1-like     90.1    2e-17   Elaeis guineensis
gb|KHN29896.1|  Putative methyltransferase PMT2                       86.3    8e-17   Glycine soja [wild soybean]
ref|XP_009150869.1|  PREDICTED: F-box/LRR-repeat protein 2            87.4    8e-17   Brassica rapa
emb|CDX88014.1|  BnaA06g26050D                                        87.0    9e-17   
emb|CDY45764.1|  BnaC02g42180D                                        87.0    3e-16   Brassica napus [oilseed rape]
ref|XP_009842087.1|  hypothetical protein H257_15620                  87.8    4e-16   Aphanomyces astaci
ref|XP_009386195.1|  PREDICTED: EIN3-binding F-box protein 1-like     86.3    5e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005828541.1|  hypothetical protein GUITHDRAFT_112273           87.0    6e-16   Guillardia theta CCMP2712
ref|XP_009592242.1|  PREDICTED: F-box/LRR-repeat protein 2            84.3    1e-15   Nicotiana tomentosiformis
emb|CBJ28117.1|  Hypothetical leucine rich repeat calmodulin bind...  85.9    1e-15   Ectocarpus siliculosus
gb|EEC80178.1|  hypothetical protein OsI_22033                        84.7    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006663624.1|  PREDICTED: F-box/LRR-repeat protein 4-like       84.7    2e-15   
ref|XP_010547706.1|  PREDICTED: F-box/LRR-repeat protein 2-like       83.6    2e-15   Tarenaya hassleriana [spider flower]
ref|XP_008870505.1|  hypothetical protein H310_07015                  85.5    2e-15   Aphanomyces invadans
ref|XP_002872053.1|  protein binding protein                          83.2    2e-15   Arabidopsis lyrata subsp. lyrata
ref|NP_741248.1|  Protein C02F5.7, isoform b                          84.0    2e-15   Caenorhabditis elegans [roundworm]
ref|NP_741249.1|  Protein C02F5.7, isoform a                          84.0    2e-15   Caenorhabditis elegans [roundworm]
ref|NP_567467.1|  F-box/LRR-repeat protein 4                          84.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009782053.1|  PREDICTED: F-box/LRR-repeat protein 4            84.3    3e-15   Nicotiana sylvestris
gb|ABA95013.1|  Leucine Rich Repeat family protein, expressed         84.0    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52434.1|  hypothetical protein OsJ_34572                        84.0    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010424250.1|  PREDICTED: F-box/LRR-repeat protein 2-like       82.4    3e-15   Camelina sativa [gold-of-pleasure]
gb|ESA18827.1|  hypothetical protein GLOINDRAFT_40076                 83.6    3e-15   
ref|XP_006419761.1|  hypothetical protein CICLE_v100047052mg          83.6    4e-15   
ref|NP_197725.1|  RNI-like superfamily protein                        82.8    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|EYE99357.1|  hypothetical protein EURHEDRAFT_511604                84.7    4e-15   Aspergillus ruber CBS 135680
ref|XP_007245724.1|  PREDICTED: F-box/LRR-repeat protein 2            82.8    4e-15   
ref|XP_006489225.1|  PREDICTED: F-box/LRR-repeat protein 4-like       83.6    5e-15   Citrus sinensis [apfelsine]
ref|XP_006283360.1|  hypothetical protein CARUB_v10004403mg           83.6    5e-15   Capsella rubella
gb|KDO74919.1|  hypothetical protein CISIN_1g007312mg                 82.8    5e-15   Citrus sinensis [apfelsine]
ref|XP_006359273.1|  PREDICTED: F-box/LRR-repeat protein 2-like       82.4    5e-15   Solanum tuberosum [potatoes]
ref|XP_008619596.1|  hypothetical protein SDRG_15207                  82.4    6e-15   Saprolegnia diclina VS20
ref|XP_002870235.1|  F-box family protein                             83.2    6e-15   
ref|XP_010454612.1|  PREDICTED: F-box/LRR-repeat protein 2-like       82.0    7e-15   Camelina sativa [gold-of-pleasure]
emb|CDY19741.1|  BnaA09g03940D                                        83.2    7e-15   Brassica napus [oilseed rape]
ref|XP_010493455.1|  PREDICTED: F-box/LRR-repeat protein 2-like       82.0    7e-15   Camelina sativa [gold-of-pleasure]
gb|KFK39198.1|  hypothetical protein AALP_AA3G212400                  82.0    7e-15   Arabis alpina [alpine rockcress]
ref|XP_006812292.1|  PREDICTED: uncharacterized protein LOC102803243  83.6    7e-15   Saccoglossus kowalevskii
gb|KDO31371.1|  hypothetical protein SPRG_03988                       82.0    8e-15   Saprolegnia parasitica CBS 223.65
ref|XP_009623080.1|  PREDICTED: F-box/LRR-repeat protein 4            82.8    8e-15   Nicotiana tomentosiformis
ref|WP_039361036.1|  hypothetical protein                             83.2    8e-15   
gb|KIC70692.1|  F-box/LRR-repeat protein 14                           82.8    1e-14   Candidatus Protochlamydia amoebophila
ref|XP_001652767.1|  AAEL007442-PA                                    81.6    1e-14   
gb|KDO74916.1|  hypothetical protein CISIN_1g007312mg                 82.0    1e-14   Citrus sinensis [apfelsine]
ref|XP_006847795.1|  hypothetical protein AMTR_s00029p00023180        81.3    1e-14   Amborella trichopoda
ref|XP_010524499.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  82.0    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_010524501.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  82.0    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_010434975.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  82.0    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_009111737.1|  PREDICTED: F-box/LRR-repeat protein 3-like       82.0    1e-14   Brassica rapa
ref|XP_006287878.1|  hypothetical protein CARUB_v10001105mg           80.9    2e-14   Capsella rubella
gb|KFB36115.1|  AGAP007807-PA-like protein                            81.3    2e-14   Anopheles sinensis
ref|XP_793918.2|  PREDICTED: F-box/LRR-repeat protein 20-like         80.9    2e-14   Strongylocentrotus purpuratus [purple urchin]
emb|CDY46953.1|  BnaA02g32930D                                        80.9    2e-14   Brassica napus [oilseed rape]
gb|EGT53215.1|  hypothetical protein CAEBREN_03873                    80.9    2e-14   Caenorhabditis brenneri
ref|XP_008862817.1|  hypothetical protein H310_01483                  82.4    2e-14   Aphanomyces invadans
ref|XP_002981401.1|  hypothetical protein SELMODRAFT_420841           80.5    2e-14   Selaginella moellendorffii
gb|EKC18517.1|  F-box/LRR-repeat protein 7                            81.6    3e-14   Crassostrea gigas
ref|XP_004241061.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  81.3    3e-14   Solanum lycopersicum
gb|KFK39475.1|  hypothetical protein AALP_AA3G249000                  81.3    3e-14   Arabis alpina [alpine rockcress]
ref|XP_011418884.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  81.3    3e-14   Crassostrea gigas
ref|XP_007222700.1|  hypothetical protein PRUPE_ppa006391mg           80.5    3e-14   Prunus persica
ref|XP_006356687.1|  PREDICTED: F-box/LRR-repeat protein 4-like       81.3    3e-14   
ref|XP_007222308.1|  hypothetical protein PRUPE_ppa003937mg           80.9    3e-14   
ref|XP_010434348.1|  PREDICTED: F-box/LRR-repeat protein 4            80.9    3e-14   
ref|XP_008619390.1|  hypothetical protein SDRG_15005                  81.6    3e-14   
ref|XP_011418878.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  80.9    4e-14   
ref|XP_011019053.1|  PREDICTED: F-box/LRR-repeat protein 3-like       80.9    4e-14   
ref|XP_010067019.1|  PREDICTED: F-box/LRR-repeat protein 4            79.7    4e-14   
ref|XP_009059139.1|  hypothetical protein LOTGIDRAFT_164359           79.7    4e-14   
ref|XP_008221080.1|  PREDICTED: F-box/LRR-repeat protein 20           79.7    5e-14   
ref|XP_002309168.1|  F-box family protein                             80.5    5e-14   
ref|XP_010440303.1|  PREDICTED: F-box/LRR-repeat protein 4-like       80.1    6e-14   
dbj|BAJ92833.1|  predicted protein                                    80.1    6e-14   
gb|EKG17120.1|  Leucine-rich repeat cysteine-containing subtype       80.1    6e-14   
ref|XP_002960088.1|  hypothetical protein SELMODRAFT_437235           80.1    6e-14   
ref|XP_006394600.1|  hypothetical protein EUTSA_v10004329mg           79.3    6e-14   
gb|ETN67343.1|  f-box/leucine rich repeat protein                     79.3    6e-14   
ref|XP_003968885.1|  PREDICTED: F-box/LRR-repeat protein 20-like      79.3    7e-14   
ref|XP_009130116.1|  PREDICTED: F-box/LRR-repeat protein 4-like       79.0    8e-14   
emb|CDY53337.1|  BnaCnng24950D                                        80.1    8e-14   
ref|XP_005103243.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...  80.1    8e-14   
ref|XP_005103244.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...  80.1    8e-14   
ref|XP_005103245.1|  PREDICTED: F-box/LRR-repeat protein 13-like ...  80.1    8e-14   
ref|XP_002448875.1|  hypothetical protein SORBIDRAFT_05g000740        80.1    8e-14   
gb|EMS59315.1|  hypothetical protein TRIUR3_13623                     79.7    9e-14   
ref|XP_008390798.1|  PREDICTED: F-box/LRR-repeat protein 4            79.7    1e-13   
ref|XP_005761773.1|  hypothetical protein EMIHUDRAFT_420548           79.3    1e-13   
emb|CDP19947.1|  unnamed protein product                              79.7    1e-13   
ref|XP_009352146.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  79.3    1e-13   
ref|XP_009352145.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  79.3    1e-13   
ref|XP_010546742.1|  PREDICTED: F-box/LRR-repeat protein 3 isofor...  79.3    1e-13   
gb|KDO28250.1|  hypothetical protein SPRG_06300                       80.1    1e-13   
ref|XP_010546741.1|  PREDICTED: F-box/LRR-repeat protein 3 isofor...  79.3    1e-13   
ref|XP_010105692.1|  F-box/LRR-repeat protein 4                       79.0    1e-13   
ref|XP_010322268.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  79.0    1e-13   
emb|CDO98963.1|  unnamed protein product                              79.0    1e-13   
ref|XP_002984048.1|  hypothetical protein SELMODRAFT_445748           79.0    2e-13   
ref|XP_007035363.1|  F-box/RNI-like superfamily protein isoform 2     78.6    2e-13   
ref|XP_001862087.1|  f-box/leucine rich repeat protein                78.2    2e-13   
ref|XP_008366959.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  78.2    2e-13   
ref|XP_008366958.1|  PREDICTED: F-box/LRR-repeat protein 20-like ...  78.2    2e-13   
gb|EFX86579.1|  hypothetical protein DAPPUDRAFT_208061                78.2    2e-13   
ref|XP_005658145.1|  PREDICTED: F-box/LRR-repeat protein 2-like       76.3    2e-13   
ref|XP_010733131.1|  PREDICTED: F-box/LRR-repeat protein 2            78.2    2e-13   
ref|XP_002872252.1|  F-box family protein                             78.6    2e-13   
ref|NP_956400.1|  F-box/LRR-repeat protein 2                          78.2    2e-13   
ref|XP_004979833.1|  PREDICTED: F-box/LRR-repeat protein 4-like       78.6    2e-13   
ref|XP_008223044.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  78.6    2e-13   
ref|XP_006414505.1|  hypothetical protein EUTSA_v10024700mg           78.6    2e-13   
ref|XP_004147107.1|  PREDICTED: F-box/LRR-repeat protein 20-like      77.8    2e-13   
ref|XP_011341367.1|  PREDICTED: F-box/LRR-repeat protein 7-like       78.2    2e-13   
ref|XP_009136697.1|  PREDICTED: F-box/LRR-repeat protein 4            78.6    2e-13   
ref|XP_003577298.1|  PREDICTED: F-box/LRR-repeat protein 4            78.6    2e-13   
ref|XP_008223043.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  78.6    2e-13   
gb|KDP40070.1|  hypothetical protein JCGZ_02068                       77.8    2e-13   
ref|XP_005728394.1|  PREDICTED: F-box/LRR-repeat protein 20-like ...  77.4    3e-13   
gb|KJB38461.1|  hypothetical protein B456_006G255600                  77.8    3e-13   
ref|XP_317696.4|  AGAP007807-PA                                       77.4    3e-13   
emb|CAF23757.1|  hypothetical protein pc1033                          78.2    3e-13   
emb|CAG10004.1|  unnamed protein product                              77.4    3e-13   
ref|XP_007035362.1|  F-box/RNI-like superfamily protein isoform 1     78.2    3e-13   
ref|XP_004236856.1|  PREDICTED: F-box/LRR-repeat protein 2            77.4    3e-13   
gb|EIE81542.1|  hypothetical protein RO3G_06247                       77.8    3e-13   
ref|XP_006036339.1|  PREDICTED: F-box/LRR-repeat protein 13           78.2    3e-13   
ref|XP_011418917.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  78.2    3e-13   
ref|XP_006850831.1|  hypothetical protein AMTR_s00025p00128860        78.2    3e-13   
ref|XP_006266653.1|  PREDICTED: F-box/LRR-repeat protein 13           78.2    3e-13   
ref|XP_008340892.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  78.2    3e-13   
gb|KJB38462.1|  hypothetical protein B456_006G255600                  77.8    3e-13   
ref|XP_011418892.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  77.8    3e-13   
ref|XP_002969928.1|  hypothetical protein SELMODRAFT_410553           77.0    3e-13   
ref|XP_004344941.1|  leucine rich repeat domain containing protein    75.9    3e-13   
ref|XP_006414504.1|  hypothetical protein EUTSA_v10024700mg           77.8    3e-13   
ref|XP_009032915.1|  hypothetical protein AURANDRAFT_11299            76.3    4e-13   
ref|XP_009517397.1|  hypothetical protein PHYSODRAFT_475925           77.0    4e-13   
ref|XP_011418908.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  77.8    4e-13   
gb|KJB38464.1|  hypothetical protein B456_006G255600                  77.8    4e-13   
ref|XP_005478637.1|  PREDICTED: F-box/LRR-repeat protein 20-like ...  77.0    4e-13   
ref|XP_011418900.1|  PREDICTED: F-box/LRR-repeat protein 7-like i...  77.8    4e-13   
emb|CDY40798.1|  BnaC02g41670D                                        77.0    4e-13   
ref|XP_002449912.1|  hypothetical protein SORBIDRAFT_05g025540        77.8    4e-13   
ref|XP_003113016.1|  hypothetical protein CRE_25417                   77.0    4e-13   
ref|XP_007581076.1|  putative ubiquitin ligase complex f-box prot...  77.4    5e-13   
gb|EGI65879.1|  F-box/LRR-repeat protein 20                           76.6    5e-13   
ref|XP_011053675.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  76.6    5e-13   
emb|CDX88253.1|  BnaA06g28440D                                        77.4    5e-13   
gb|KFK26555.1|  hypothetical protein AALP_AA8G263800                  77.4    5e-13   
ref|XP_002983796.1|  hypothetical protein SELMODRAFT_118815           77.4    5e-13   
ref|XP_007125300.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  76.6    5e-13   
ref|XP_010257003.1|  PREDICTED: F-box/LRR-repeat protein 3-like       77.4    5e-13   
ref|XP_006484494.1|  PREDICTED: F-box/LRR-repeat protein 4-like       76.3    6e-13   
gb|EZA48578.1|  F-box/LRR-repeat protein                              76.6    6e-13   
ref|XP_003400284.1|  PREDICTED: f-box/LRR-repeat protein 20-like ...  76.6    6e-13   
ref|XP_010871599.1|  PREDICTED: F-box/LRR-repeat protein 2            76.6    6e-13   
ref|XP_003400286.1|  PREDICTED: f-box/LRR-repeat protein 20-like ...  76.6    6e-13   
ref|XP_004342110.1|  leucine rich repeat domain containing protein    77.0    6e-13   
ref|XP_011347997.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  76.6    6e-13   
ref|XP_002641953.1|  Hypothetical protein CBG16659                    76.6    6e-13   
ref|XP_004296974.2|  PREDICTED: F-box/LRR-repeat protein 4            77.0    6e-13   
ref|XP_008420120.1|  PREDICTED: F-box/LRR-repeat protein 2            76.6    6e-13   
ref|XP_008812006.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  77.0    6e-13   
gb|EFN77163.1|  F-box/LRR-repeat protein 20                           76.3    6e-13   
ref|NP_568502.1|  F-box protein                                       77.0    7e-13   
ref|XP_007447757.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  75.5    7e-13   
ref|XP_006633529.1|  PREDICTED: F-box/LRR-repeat protein 13-like      77.0    7e-13   
ref|XP_011164028.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  76.6    7e-13   
ref|XP_007191583.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  76.3    7e-13   
gb|KFW81651.1|  F-box/LRR-repeat protein 20                           75.9    7e-13   
ref|XP_006822465.1|  PREDICTED: F-box/LRR-repeat protein 13-like      77.0    8e-13   
ref|XP_008812004.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  77.0    8e-13   
ref|XP_008922985.1|  PREDICTED: F-box/LRR-repeat protein 20           75.9    8e-13   
ref|XP_008812005.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  76.6    8e-13   
ref|XP_002989023.1|  hypothetical protein SELMODRAFT_184280           76.6    8e-13   
ref|XP_011150600.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  76.3    8e-13   
gb|KDO31312.1|  hypothetical protein SPRG_03928                       77.4    8e-13   
ref|XP_003493957.1|  PREDICTED: F-box/LRR-repeat protein 20-like ...  76.3    9e-13   
ref|XP_003400285.1|  PREDICTED: f-box/LRR-repeat protein 20-like ...  76.3    9e-13   
ref|XP_011297967.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  75.9    1e-12   
ref|XP_007547701.1|  PREDICTED: F-box/LRR-repeat protein 2            75.9    1e-12   
ref|XP_011053674.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  75.9    1e-12   
ref|XP_008555912.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  75.9    1e-12   
gb|EFN68516.1|  F-box/LRR-repeat protein 20                           75.9    1e-12   
ref|XP_009388454.1|  PREDICTED: F-box protein At3g58530               75.1    1e-12   
ref|XP_007447755.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  75.9    1e-12   
ref|XP_001945889.2|  PREDICTED: F-box/LRR-repeat protein 20           75.9    1e-12   
ref|XP_011090837.1|  PREDICTED: F-box/LRR-repeat protein 4            76.3    1e-12   
ref|XP_007896288.1|  PREDICTED: F-box/LRR-repeat protein 2            75.9    1e-12   
ref|XP_008478743.1|  PREDICTED: F-box/LRR-repeat protein 20-like      75.5    1e-12   
ref|XP_004409032.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 3  74.7    1e-12   
ref|XP_008608110.1|  hypothetical protein SDRG_04225                  77.0    1e-12   
ref|XP_003414736.2|  PREDICTED: F-box/LRR-repeat protein 20           75.9    1e-12   
ref|XP_009985327.1|  PREDICTED: F-box/LRR-repeat protein 20           75.5    1e-12   
ref|XP_008288944.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  75.9    1e-12   
ref|XP_003978719.1|  PREDICTED: F-box/LRR-repeat protein 7-like       75.9    1e-12   
ref|XP_011347996.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  75.9    1e-12   
ref|XP_009487783.1|  PREDICTED: F-box/LRR-repeat protein 20           75.5    1e-12   
ref|XP_011256034.1|  PREDICTED: F-box/LRR-repeat protein 20           75.9    1e-12   
gb|KFV18535.1|  F-box/LRR-repeat protein 20                           75.5    1e-12   
ref|XP_008288945.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  75.5    1e-12   
ref|XP_004279749.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 2  74.7    1e-12   
ref|XP_001986492.1|  GH20493                                          76.3    1e-12   
ref|XP_001950086.2|  PREDICTED: F-box/LRR-repeat protein 7-like       75.9    1e-12   
ref|XP_011053673.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  75.9    1e-12   
ref|XP_007154190.1|  hypothetical protein PHAVU_003G097600g           76.3    1e-12   
ref|XP_011297964.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  75.9    1e-12   
gb|KJB49959.1|  hypothetical protein B456_008G147100                  75.5    1e-12   
ref|XP_008445892.1|  PREDICTED: F-box/LRR-repeat protein 20           75.5    1e-12   
ref|XP_004409031.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 2  74.7    1e-12   
ref|XP_008340891.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  75.9    1e-12   
ref|XP_011297966.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  75.9    1e-12   
ref|XP_007035364.1|  F-box/RNI-like superfamily protein isoform 3     75.9    1e-12   
ref|XP_010747620.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-12   
emb|CDX80608.1|  BnaC07g28360D                                        75.9    2e-12   
ref|XP_004249058.1|  PREDICTED: F-box/LRR-repeat protein 3            75.9    2e-12   
gb|EHJ64057.1|  hypothetical protein KGM_09638                        75.1    2e-12   
emb|CBN82132.1|  F-box/LRR-repeat protein 7                           75.5    2e-12   
ref|XP_006433468.1|  hypothetical protein CICLE_v10000558mg           75.9    2e-12   
ref|XP_007177599.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  75.1    2e-12   
ref|XP_004409030.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 1  75.1    2e-12   
ref|XP_010866366.1|  PREDICTED: F-box/LRR-repeat protein 7-like       75.1    2e-12   
ref|XP_005430439.1|  PREDICTED: F-box/LRR-repeat protein 20           75.1    2e-12   
ref|XP_008914169.1|  hypothetical protein, variant 2                  73.9    2e-12   
ref|XP_008292199.1|  PREDICTED: F-box/LRR-repeat protein 7            75.5    2e-12   
ref|XP_004279748.1|  PREDICTED: F-box/LRR-repeat protein 2 isoform 1  75.1    2e-12   
ref|XP_011150599.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  75.5    2e-12   
ref|XP_002062979.1|  GK21630                                          75.5    2e-12   
ref|XP_008555911.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  75.5    2e-12   
gb|ETP03020.1|  hypothetical protein, variant 2                       73.6    2e-12   
ref|XP_004980134.1|  PREDICTED: F-box/LRR-repeat protein 3-like       75.5    2e-12   
gb|ETO61931.1|  hypothetical protein, variant 2                       73.6    2e-12   
gb|KHG11100.1|  F-box/LRR-repeat 4 -like protein                      74.7    2e-12   
ref|XP_008388303.1|  PREDICTED: F-box/LRR-repeat protein 3-like       75.5    2e-12   
gb|ETL80199.1|  hypothetical protein, variant 2                       73.6    2e-12   
gb|ETK73524.1|  hypothetical protein, variant 2                       73.6    2e-12   
ref|XP_010189680.1|  PREDICTED: F-box/LRR-repeat protein 20           73.6    2e-12   
ref|XP_010455073.1|  PREDICTED: F-box/LRR-repeat protein 3-like       75.5    2e-12   
gb|KDO81776.1|  hypothetical protein CISIN_1g006499mg                 75.5    2e-12   
ref|XP_004186202.1|  PREDICTED: LOW QUALITY PROTEIN: F-box and le...  74.3    2e-12   
gb|ETI33227.1|  hypothetical protein, variant 2                       73.6    2e-12   
ref|XP_010921960.1|  PREDICTED: F-box/LRR-repeat protein 4            75.5    2e-12   
ref|XP_008306391.1|  PREDICTED: F-box/LRR-repeat protein 7            75.1    2e-12   
ref|XP_003572520.1|  PREDICTED: F-box protein At3g58530               73.9    2e-12   
ref|XP_006189316.1|  PREDICTED: F-box/LRR-repeat protein 2            73.9    2e-12   
gb|KFQ40153.1|  F-box/LRR-repeat protein 20                           73.6    2e-12   
ref|XP_010279078.1|  PREDICTED: F-box/LRR-repeat protein 4 isofor...  75.5    3e-12   
ref|XP_005108158.1|  PREDICTED: F-box/LRR-repeat protein 20-like      74.7    3e-12   
ref|XP_004676399.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  73.9    3e-12   
gb|KJB17134.1|  hypothetical protein B456_002G266900                  75.5    3e-12   
gb|KHN37544.1|  F-box/LRR-repeat protein 4                            75.1    3e-12   
ref|XP_006787825.1|  PREDICTED: F-box/LRR-repeat protein 20-like      74.7    3e-12   
ref|XP_006290009.1|  hypothetical protein CARUB_v10003640mg           75.1    3e-12   
ref|XP_004676400.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  73.9    3e-12   
ref|XP_003542901.1|  PREDICTED: F-box/LRR-repeat protein 4-like i...  75.1    3e-12   
ref|XP_006795208.1|  PREDICTED: F-box/LRR-repeat protein 7-like       74.3    3e-12   
ref|XP_007289375.1|  F-box domain-containing protein                  75.1    3e-12   
ref|XP_004676398.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  74.3    3e-12   
ref|XP_010264511.1|  PREDICTED: F-box/LRR-repeat protein 3-like i...  75.1    3e-12   
ref|XP_001779622.1|  predicted protein                                75.1    3e-12   
ref|XP_005531467.1|  PREDICTED: F-box/LRR-repeat protein 20           74.3    3e-12   
gb|KFQ47258.1|  F-box/LRR-repeat protein 13                           74.7    3e-12   
ref|XP_011155765.1|  PREDICTED: F-box/LRR-repeat protein 7            74.7    3e-12   
ref|XP_002940984.2|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  74.7    3e-12   
ref|NP_001087065.1|  F-box and leucine-rich repeat protein 20         74.3    3e-12   
gb|KDO69901.1|  hypothetical protein CISIN_1g015721mg                 74.3    3e-12   
ref|XP_003439319.1|  PREDICTED: F-box/LRR-repeat protein 7-like       74.7    3e-12   
ref|XP_001603165.2|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  74.3    3e-12   
ref|XP_008264333.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  73.9    3e-12   
gb|EFZ20596.1|  hypothetical protein SINV_10543                       74.3    3e-12   
emb|CDP04080.1|  unnamed protein product                              75.1    3e-12   
ref|XP_008264332.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  73.9    3e-12   
gb|AAM60829.1|  F-box protein family, AtFBL4                          74.7    3e-12   
ref|XP_010722901.1|  PREDICTED: F-box/LRR-repeat protein 20 isofo...  73.6    3e-12   
gb|ETP03019.1|  hypothetical protein, variant 1                       73.9    4e-12   
ref|XP_008264334.1|  PREDICTED: F-box/LRR-repeat protein 2 isofor...  73.9    4e-12   
ref|XP_010264510.1|  PREDICTED: F-box/LRR-repeat protein 3-like i...  75.1    4e-12   
ref|XP_010693838.1|  PREDICTED: F-box protein At3g58530 isoform X2    73.6    4e-12   
ref|XP_009393361.1|  PREDICTED: F-box/LRR-repeat protein 4            74.7    4e-12   
ref|XP_008914168.1|  hypothetical protein, variant 1                  73.9    4e-12   
ref|XP_009778014.1|  PREDICTED: F-box/LRR-repeat protein 2            73.9    4e-12   
ref|XP_004551974.1|  PREDICTED: F-box/LRR-repeat protein 7-like       74.3    4e-12   
ref|XP_002602530.1|  hypothetical protein BRAFLDRAFT_281976           73.2    4e-12   
ref|XP_005922659.1|  PREDICTED: F-box/LRR-repeat protein 7-like       74.3    4e-12   



>emb|CDP13516.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KG PN+K++CL+KC  LSDNG+VSFVKAA S+E  QL+ECHRI+Q+G FG+L++S G
Sbjct  264  AVGKGSPNLKRVCLKKCAFLSDNGLVSFVKAAASLEIFQLDECHRITQSGFFGMLINSCG  323

Query  182  KLKALAFENCFGMKDLAFG--VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
            KLKALA  NCFG+KDL FG    ALP  +S+RSL++ NC GFGD SL  L++LCPNLVHL
Sbjct  324  KLKALALANCFGIKDLVFGSHFRALP--SSIRSLAVRNCPGFGDGSLSTLAKLCPNLVHL  381

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             LS L G+TD GLLP V+S +AGLVKVNLSGC+N+TDK  +AIAKLHG TLE LNL+GC 
Sbjct  382  ELSTLGGITDEGLLPLVESSEAGLVKVNLSGCVNLTDKVTAAIAKLHGCTLEELNLDGCK  441

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
            CVTDA+L AIA++CS+L +LD+SKS
Sbjct  442  CVTDATLFAIAEHCSLLSELDVSKS  466


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 88/195 (45%), Gaps = 14/195 (7%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L   + +SD G++        +E L L  C+ ++   +  I   +  
Sbjct  80   AIAHGCPSLRVLSLWNTSAISDEGLIEIASGCHRLEKLDLFHCNAVTDKALLAI-AKNCP  138

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPN-LVHLN  358
             L +L  E+C  + + +        C+SL+S++I NC+  GD  +  L     N L  + 
Sbjct  139  NLTSLTIESCPNIGNGSLEAVG-HYCSSLKSVTIKNCSLVGDHGIASLFSKAGNVLAKVR  197

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLN----  526
            L  LN ++D  L    +  +A L  + L G  NV ++    +    G    LLNL     
Sbjct  198  LESLN-ISDVSLAVIGRYGNA-LTDLALIGLQNVNERGFWIMGNCQG----LLNLRSILV  251

Query  527  -GCGCVTDASLAAIA  568
              C  VTD  L A+ 
Sbjct  252  TACQGVTDVGLEAVG  266



>ref|XP_002515516.1| grr1, plant, putative [Ricinus communis]
 gb|EEF46965.1| grr1, plant, putative [Ricinus communis]
Length=651

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 161/203 (79%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN++Q CLRKCT LSDNG+VSFVKAA S+ESLQLEECHRI+Q G FG +++   
Sbjct  375  AVGKGCPNLRQFCLRKCTFLSDNGLVSFVKAAGSLESLQLEECHRITQLGFFGSILNCGA  434

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKALA  NC G++DL  G P L PC SLRSL I NC GFGDASL +L +LCP L H+ L
Sbjct  435  KLKALALVNCLGIRDLNLGSPQLSPCESLRSLIIRNCPGFGDASLSLLGKLCPQLQHVEL  494

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD GL+P + SC AG+VKVNLSGC+N++DK +SA+ + HG TLE+LNL GC  +
Sbjct  495  SGLQGVTDAGLIPLLDSCGAGMVKVNLSGCLNLSDKAVSALTEQHGWTLEVLNLEGCEKI  554

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDASLAAIA+ C +L +LD+SKS
Sbjct  555  TDASLAAIAENCFLLSELDVSKS  577


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 96/205 (47%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L     +SD G+         +E L L  C  IS  G+  I   +  
Sbjct  191  AIARGCPSLRALSLWNLPFVSDEGLFEIANGCHMLEKLDLCGCPAISDKGLLAI-AKNCP  249

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  L  E+C  + +   G+ A+   C +L+S+SI +C+  GD  +  ++S     L  +
Sbjct  250  NLTDLTIESCAKIGN--EGLQAVGQYCTNLKSISIKDCSAVGDQGISGLVSSTTYYLTKV  307

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  +      +  + L+   NV+++    + K HG + L+   +  C
Sbjct  308  KLQALN-ITDVS-LAVIGHYGKAVSDIVLTNLPNVSERGFWVMGKGHGLQKLKSFTVTSC  365

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTDA L A+   C  LR   + K
Sbjct  366  RGVTDAGLEAVGKGCPNLRQFCLRK  390


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/180 (24%), Positives = 84/180 (47%), Gaps = 2/180 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    D  +    K    ++ ++L     ++ AG+  +L      +  +
Sbjct  460  CESLRSLIIRNCPGFGDASLSLLGKLCPQLQHVELSGLQGVTDAGLIPLLDSCGAGMVKV  519

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A          +L  L++  C    DASL  ++  C  L  L++S  + 
Sbjct  520  NLSGCLNLSDKAVSALTEQHGWTLEVLNLEGCEKITDASLAAIAENCFLLSELDVSK-SA  578

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            ++D GL+   +S    L   + SGC  ++D+++ A+ KL G+TL  LNL  C  ++ +++
Sbjct  579  ISDSGLMVLARSKQLNLQIFSASGCSMISDRSLPALVKL-GQTLLGLNLQHCNAISTSAI  637


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/254 (20%), Positives = 102/254 (40%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++K CPN+  L +  C  + + G+ +  +   +++S+ +++C  +   G+ G++  +  
Sbjct  243  AIAKNCPNLTDLTIESCAKIGNEGLQAVGQYCTNLKSISIKDCSAVGDQGISGLVSSTTY  302

Query  182  KLKALAFENCFGMKDLAFGVPA-------------LPPCNS--------------LRSLS  280
             L  +  +    + D++  V               LP  +               L+S +
Sbjct  303  YLTKVKLQ-ALNITDVSLAVIGHYGKAVSDIVLTNLPNVSERGFWVMGKGHGLQKLKSFT  361

Query  281  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS----------------  412
            + +C G  DA L  + + CPNL    L     ++D GL+ FV++                
Sbjct  362  VTSCRGVTDAGLEAVGKGCPNLRQFCLRKCTFLSDNGLVSFVKAAGSLESLQLEECHRIT  421

Query  413  ----------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
                      C A L  + L  C+ + D  + +      E+L  L +  C    DASL+ 
Sbjct  422  QLGFFGSILNCGAKLKALALVNCLGIRDLNLGSPQLSPCESLRSLIIRNCPGFGDASLSL  481

Query  563  IADYCSVLRDLDIS  604
            +   C  L+ +++S
Sbjct  482  LGKLCPQLQHVELS  495



>gb|KDP33594.1| hypothetical protein JCGZ_07165 [Jatropha curcas]
Length=645

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN++  CLRKC  LSDNG+VSFVKAA+S+E LQLEECHRI+Q G FG L++S  
Sbjct  369  AMGKGCPNLRHFCLRKCVFLSDNGLVSFVKAAQSLEVLQLEECHRIAQLGFFGSLLNSGS  428

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+  NC G+++L   +P +PPCNSLRSLSI NC GFGD  L +L +LCP L +L L
Sbjct  429  KLKALSLVNCMGIRELNLRLPQVPPCNSLRSLSIRNCPGFGDGGLALLGKLCPQLQNLEL  488

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL+GVTD G +P +++C+AGLVKVNLSGC+N+TDK +SA+ + HG TLE+LNL+GCG +
Sbjct  489  SGLHGVTDAGFIPLLENCEAGLVKVNLSGCVNLTDKVVSALTEQHGWTLEVLNLDGCGKI  548

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD SL AIA+ C +L DLD+SK
Sbjct  549  TDESLTAIAENCLMLSDLDVSK  570


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/228 (24%), Positives = 98/228 (43%), Gaps = 30/228 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSA-  178
            A++K CPN+ +L +  C  + ++G+ +  +   +++S+ +++C  +   G+   LV SA 
Sbjct  237  AIAKSCPNLTELTIESCANIGNDGLQAIGQCCNNLKSISIKDCPVVGDQGIAS-LVSSAT  295

Query  179  ---GKLK---------ALAFENCFGMKDLAFGVPALPPC--------------NSLRSLS  280
                KLK         +LA    +G       +  LP                  L+S +
Sbjct  296  CVLAKLKLQSLNITDVSLAVIGHYGKAVTDLVITNLPNVTERGFWVMGNGHGLQKLKSFA  355

Query  281  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV  460
            + +C G  DA +  + + CPNL H  L     ++D GL+ FV++  + L  + L  C  +
Sbjct  356  VTSCRGVTDAGIEAMGKGCPNLRHFCLRKCVFLSDNGLVSFVKAAQS-LEVLQLEECHRI  414

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASLA-AIADYCSVLRDLDI  601
                        G  L+ L+L  C  + + +L       C+ LR L I
Sbjct  415  AQLGFFGSLLNSGSKLKALSLVNCMGIRELNLRLPQVPPCNSLRSLSI  462



>ref|XP_006483363.1| PREDICTED: EIN3-binding F-box protein 1-like [Citrus sinensis]
 gb|KDO61730.1| hypothetical protein CISIN_1g006426mg [Citrus sinensis]
Length=645

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CLRKC  LSDNG++SF KAA S+ESLQLEECHRI+Q G FG L++   
Sbjct  369  AVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGE  428

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+  +C G+KD   GV ++ PC SLRSLSI NC GFGDASL VL +LCP L +++L
Sbjct  429  KLKALSLVSCLGIKDQNLGVRSVSPCKSLRSLSIRNCPGFGDASLAVLGKLCPQLQNVDL  488

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD G LP ++SC+AGL KVNLSGC+N+TDK +S +A+LHG TLE+LNL+GC  +
Sbjct  489  SGLQGVTDAGFLPVLESCEAGLAKVNLSGCVNLTDKVVSTMAELHGWTLEMLNLDGCRKI  548

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIAD C +L DLD+SK
Sbjct  549  SDASLMAIADNCPLLCDLDVSK  570


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 55/230 (24%), Positives = 101/230 (44%), Gaps = 32/230 (14%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAE-SIESLQLEECHRISQAGV-FGILVHS  175
            AV + CPN+K + ++ C L+ D G+ S + +A  S+E ++L+   R++   V   ++ H 
Sbjct  263  AVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQ---RLNITDVSLAVIGHY  319

Query  176  AGKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVH  352
               +  L       + +  F V         L+SL+I +C G  D  L  + + CPNL  
Sbjct  320  GMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQ  379

Query  353  LNLSGLNGVTDYGLLPFVQS--------------------------CDAGLVKVNLSGCI  454
              L     ++D GL+ F ++                          C   L  ++L  C+
Sbjct  380  FCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKLKALSLVSCL  439

Query  455  NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             + D+ +   +    ++L  L++  C    DASLA +   C  L+++D+S
Sbjct  440  GIKDQNLGVRSVSPCKSLRSLSIRNCPGFGDASLAVLGKLCPQLQNVDLS  489


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 86/229 (38%), Gaps = 56/229 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + + D G+         +E L L +C  I+   +  I  +   
Sbjct  185  AIARGCPSLRVLSLWNTSSVGDEGLCEIANGCHQLEKLDLCQCPAITDRALITIAKN---  241

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C  L  L+I +C+  G+  L  + R CPNL  +++
Sbjct  242  -------------------------CPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISI  276

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL----------------  493
                 V D G+   + S    L KV L   +N+TD +++ I                   
Sbjct  277  KDCRLVGDQGIASLLSSATYSLEKVKLQR-LNITDVSLAVIGHYGMAVTDLFLTGLPHVS  335

Query  494  ----------HG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                      HG + L+ L +  C  VTD  L A+   C  L+   + K
Sbjct  336  ERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRK  384



>ref|XP_006450435.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
 gb|ESR63675.1| hypothetical protein CICLE_v10007708mg [Citrus clementina]
Length=645

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CLRKC  LSDNG++SF KAA S+ESLQLEECHRI+Q G FG L++   
Sbjct  369  AVGKGCPNLKQFCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGE  428

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+  +C G+KD   GV ++ PC SLRSLSI NC GFGDASL VL +LCP L +++L
Sbjct  429  KLKALSLVSCLGIKDQNLGVRSVSPCKSLRSLSIRNCPGFGDASLAVLGKLCPQLQNVDL  488

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD G LP ++SC+AGL KVNLSGC+N+TDK +S +A+LHG TLE+LNL+GC  +
Sbjct  489  SGLQGVTDAGFLPVLESCEAGLAKVNLSGCVNLTDKVVSTMAELHGWTLEMLNLDGCRKI  548

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIAD C +L DLD+SK
Sbjct  549  SDASLMAIADNCPLLCDLDVSK  570


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 55/230 (24%), Positives = 101/230 (44%), Gaps = 32/230 (14%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAE-SIESLQLEECHRISQAGV-FGILVHS  175
            AV + CPN+K + ++ C L+ D G+ S + +A  S+E ++L+   R++   V   ++ H 
Sbjct  263  AVGRFCPNLKSISIKDCRLVGDQGIASLLSSATYSLEKVKLQ---RLNITDVSLAVIGHY  319

Query  176  AGKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVH  352
               +  L       + +  F V         L+SL+I +C G  D  L  + + CPNL  
Sbjct  320  GMAVTDLFLTGLPHVSERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQ  379

Query  353  LNLSGLNGVTDYGLLPFVQS--------------------------CDAGLVKVNLSGCI  454
              L     ++D GL+ F ++                          C   L  ++L  C+
Sbjct  380  FCLRKCAFLSDNGLISFAKAAFSLESLQLEECHRITQLGFFGSLLNCGEKLKALSLVSCL  439

Query  455  NVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             + D+ +   +    ++L  L++  C    DASLA +   C  L+++D+S
Sbjct  440  GIKDQNLGVRSVSPCKSLRSLSIRNCPGFGDASLAVLGKLCPQLQNVDLS  489


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 86/229 (38%), Gaps = 56/229 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + + D G+         +E L L +C  I+   +  I  +   
Sbjct  185  AIARGCPSLRVLSLWNTSSVGDEGLCEIANGCHQLEKLDLCQCPAITDRALITIAKN---  241

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C  L  L+I +C+  G+  L  + R CPNL  +++
Sbjct  242  -------------------------CPKLIDLTIESCSSIGNEGLQAVGRFCPNLKSISI  276

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL----------------  493
                 V D G+   + S    L KV L   +N+TD +++ I                   
Sbjct  277  KDCRLVGDQGIASLLSSATYSLEKVKLQR-LNITDVSLAVIGHYGMAVTDLFLTGLPHVS  335

Query  494  ----------HG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                      HG + L+ L +  C  VTD  L A+   C  L+   + K
Sbjct  336  ERGFWVMGSGHGLQKLKSLTITSCMGVTDLGLEAVGKGCPNLKQFCLRK  384



>ref|XP_009801071.1| PREDICTED: EIN3-binding F-box protein 1 [Nicotiana sylvestris]
Length=669

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+K  CLRKC  LSDNG+V+F K + S+E+LQLEECHRI+QAG+FG+L+    
Sbjct  393  ALGKGCPNLKLFCLRKCAFLSDNGLVAFAKGSASLENLQLEECHRITQAGLFGVLLSCGK  452

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+  NCFG+K+LA   P++ PCNSL+SLSI NC G G+A+L V  RLCP L HL L
Sbjct  453  KLKALSLVNCFGVKELACRFPSVLPCNSLQSLSIRNCPGVGNATLAVAGRLCPKLTHLEL  512

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GL P VQSC+AGLVKVNLSGC+NVTDK++SAI +LHG +LE LN++GC  V
Sbjct  513  SGLVGITDEGLFPLVQSCEAGLVKVNLSGCVNVTDKSVSAITELHGGSLEFLNVDGCKYV  572

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDA+L AI++ C +L +LD+SK
Sbjct  573  TDATLVAISNNCWLLSELDLSK  594


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 69/162 (43%), Gaps = 29/162 (18%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + +SD G+    +    +E L L +C  I+ A +  I      
Sbjct  209  AIARGCPSLRALSLWNVSSVSDEGLSEIAQGCHLLEKLDLCQCPAITDASLVAI------  262

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L SL+I +C   G+ SL  + R CP L  ++L
Sbjct  263  ----------------------AKSCPNLTSLTIESCANIGNESLQAVGRFCPKLKFVSL  300

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA  487
                 + D G+     S    L KV L   +N++D +++ I 
Sbjct  301  KNCPLIGDQGIASLFSSAGHVLTKVKLHA-LNISDVSLAVIG  341



>gb|KJB55011.1| hypothetical protein B456_009G058000 [Gossypium raimondii]
Length=652

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 157/202 (78%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+KQ CLRKC  LSDNG+VSF KAA S+ESL+LEECHR++Q G FG L++   
Sbjct  377  AIGKGCPNLKQFCLRKCAFLSDNGLVSFAKAAGSLESLELEECHRVTQFGFFGSLINCGA  436

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K KA++  NC G+KDL  G+P LPPC SLRSLSI NC GFGDASL  L +LCP L ++ L
Sbjct  437  KFKAISLMNCLGIKDLNVGLPPLPPCESLRSLSIRNCPGFGDASLAALGKLCPQLQNVEL  496

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL+G+TD G LP ++SC+AGLVKVNLSGC N+ DK +  +A LHG TLE+LNL+GC  V
Sbjct  497  SGLHGITDVGFLPLLESCEAGLVKVNLSGCPNLGDKVVCKMADLHGWTLEMLNLDGCK-V  555

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA L AIA+ C VL DLD+SK
Sbjct  556  SDAGLVAIAENCRVLSDLDVSK  577


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 92/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S+GCP+++ L L     + D G+    +    ++ L L  C  I+   +   L     
Sbjct  193  AISRGCPSLRVLSLWNLATVGDGGLCEIAEGCHQLQKLDLCHCPAITNESLLS-LAKGCP  251

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  L  E C  + +   G+ A+   C +L+S+SI +C   GD  +  +L+    +L  L
Sbjct  252  DLTDLTIEGCANIGN--EGIQAIARCCPNLKSVSIKDCPLLGDQGIASLLTSASYSLSKL  309

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  +      +  ++L+   NVT+K    +   HG + L+   +  C
Sbjct  310  KLQALN-ITDVS-LAVIGHYGKAVTDLSLTSLPNVTEKGFWVMGNGHGLQKLKSFTVKAC  367

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L AI   C  L+   + K
Sbjct  368  RGVTDLGLEAIGKGCPNLKQFCLRK  392


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/253 (21%), Positives = 103/253 (41%), Gaps = 52/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILV---H  172
            +++KGCP++  L +  C  + + G+ +  +   +++S+ +++C  +   G+  +L    +
Sbjct  245  SLAKGCPDLTDLTIEGCANIGNEGIQAIARCCPNLKSVSIKDCPLLGDQGIASLLTSASY  304

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPC--------------NSLRSLSI  283
            S  KLK         +LA    +G       + +LP                  L+S ++
Sbjct  305  SLSKLKLQALNITDVSLAVIGHYGKAVTDLSLTSLPNVTEKGFWVMGNGHGLQKLKSFTV  364

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
              C G  D  L  + + CPNL    L     ++D GL+ F ++                 
Sbjct  365  KACRGVTDLGLEAIGKGCPNLKQFCLRKCAFLSDNGLVSFAKAAGSLESLELEECHRVTQ  424

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C A    ++L  C+ + D  +        E+L  L++  C    DASLAA+
Sbjct  425  FGFFGSLINCGAKFKAISLMNCLGIKDLNVGLPPLPPCESLRSLSIRNCPGFGDASLAAL  484

Query  566  ADYCSVLRDLDIS  604
               C  L+++++S
Sbjct  485  GKLCPQLQNVELS  497



>ref|XP_002324298.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
 gb|EEF02863.2| hypothetical protein POPTR_0018s01710g [Populus trichocarpa]
Length=646

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CL KC  LSDNG+VSF KAAE++ESLQLEECHRI+Q G FG L++   
Sbjct  370  AVGKGCPNLKQFCLHKCAFLSDNGLVSFAKAAETLESLQLEECHRITQFGFFGSLLNCGA  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LKA++  NCFG++DL   +P L PCNSLRSLSI NC GFGD SL +L  LCP L ++ L
Sbjct  430  NLKAISLVNCFGIRDLKLDLPELSPCNSLRSLSIRNCPGFGDGSLALLGNLCPQLRNVEL  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD G L  +++C+AGLVKVNLSGCIN++DK +S + + HG TLE+LNL+GC  +
Sbjct  490  SGLQGVTDAGFLSVLENCEAGLVKVNLSGCINLSDKVVSVMTEQHGWTLEMLNLDGCRRI  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ C +L DLD+SK
Sbjct  550  TDASLVAIAENCFLLYDLDVSK  571


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 92/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L     + D G+         +E L L +C  I+  G+  I   +  
Sbjct  186  AIARGCPSLKVLSLWNLPSVGDEGLSEISNGCHMLEKLDLSQCPAITDKGLLAI-AKNCI  244

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPN-LVHL  355
             L  L  E+C  + +   G+ A+   C +L+S+SI NC G GD  +  L     N L  L
Sbjct  245  NLTDLVLESCSNIGN--EGLQAVGKHCTNLKSISITNCPGVGDQGIAALVSSASNVLTKL  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  V      +  + L+   NV+++    +    G   L+ L +  C
Sbjct  303  KLQSLN-ITDVS-LAVVGHYGKAVTDLVLTSLPNVSERGFWVMGNGQGLHKLKSLTVTSC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  361  LGVTDIGLEAVGKGCPNLKQFCLHK  385


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 85/185 (46%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    D  +         + +++L     ++ AG   +L +    L  +
Sbjct  455  CNSLRSLSIRNCPGFGDGSLALLGNLCPQLRNVELSGLQGVTDAGFLSVLENCEAGLVKV  514

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D    V       +L  L++  C    DASLV ++  C  L  L++S    
Sbjct  515  NLSGCINLSDKVVSVMTEQHGWTLEMLNLDGCRRITDASLVAIAENCFLLYDLDVSKC-A  573

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
             TD G+    +S    L  +++SGC  ++DK++ A+ KL G+TL  LNL  C  ++ +++
Sbjct  574  TTDSGIAAMARSKQLCLQVLSVSGCSMISDKSLPALVKL-GQTLLGLNLQHCNAISSSTV  632

Query  557  AAIAD  571
              + +
Sbjct  633  DILVE  637


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 93/229 (41%), Gaps = 30/229 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESI-ESLQLEECHRISQAGVFGILVHSA  178
            AV K C N+K + +  C  + D G+ + V +A ++   L+L+  +    +    ++ H  
Sbjct  264  AVGKHCTNLKSISITNCPGVGDQGIAALVSSASNVLTKLKLQSLNITDVS--LAVVGHYG  321

Query  179  GKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVH-  352
              +  L   +   + +  F V       + L+SL++ +C G  D  L  + + CPNL   
Sbjct  322  KAVTDLVLTSLPNVSERGFWVMGNGQGLHKLKSLTVTSCLGVTDIGLEAVGKGCPNLKQF  381

Query  353  -------------------------LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
                                     L L   + +T +G    + +C A L  ++L  C  
Sbjct  382  CLHKCAFLSDNGLVSFAKAAETLESLQLEECHRITQFGFFGSLLNCGANLKAISLVNCFG  441

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + D  +         +L  L++  C    D SLA + + C  LR++++S
Sbjct  442  IRDLKLDLPELSPCNSLRSLSIRNCPGFGDGSLALLGNLCPQLRNVELS  490



>ref|XP_009614726.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=669

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 163/202 (81%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+K  CLRKC  LSDNG+V+F K + S+E+LQLEECHRI+QAG+FG+L+    
Sbjct  393  AIGKGCPNLKLFCLRKCAFLSDNGLVAFAKGSASLENLQLEECHRITQAGLFGVLLSCGK  452

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+  NCFG+K+LA   P++ PCNSL+SLSI NC G G+A+L V+ RLCP L +L L
Sbjct  453  KLKALSLVNCFGVKELACRFPSVLPCNSLQSLSIRNCPGVGNATLAVVGRLCPKLTYLEL  512

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GL P +QSC+AGLVK+NLSGC+NVTDK++SAI +LHG +LE LN++GC  V
Sbjct  513  SGLVGITDEGLFPLMQSCEAGLVKMNLSGCVNVTDKSVSAITELHGGSLEFLNVDGCRYV  572

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDA+L AI++ C +L +LD+SK
Sbjct  573  TDATLVAISNNCWLLSELDLSK  594


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 51/223 (23%), Positives = 85/223 (38%), Gaps = 56/223 (25%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + +SD G+    +    +E L L +C  I+   +  I      
Sbjct  209  AIARGCPSLRALSLWNVSSVSDEGLSEIAQGCHLLEKLDLCQCPAITDTSLVAI------  262

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L SL+I +C   G+ SL  + R CP L  ++L
Sbjct  263  ----------------------AKSCPNLTSLTIESCANIGNESLQAVGRFCPKLKFVSL  300

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL----------------  493
                 + D G+     S    L KV L   +N++D +++ I                   
Sbjct  301  KNCPLIGDQGIASLFSSAGHVLTKVKLHA-LNISDVSLAVIGHYGIAVTDIALIGLQSIN  359

Query  494  --------HGETLE---LLNLNGCGCVTDASLAAIADYCSVLR  589
                    +G+ L+    L +  C  VTD  L AI   C  L+
Sbjct  360  ERGFWVMGNGQGLQKLRFLAITACNGVTDVGLEAIGKGCPNLK  402


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 84/180 (47%), Gaps = 2/180 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C  + +  +    +    +  L+L     I+  G+F ++      L  +
Sbjct  478  CNSLQSLSIRNCPGVGNATLAVVGRLCPKLTYLELSGLVGITDEGLFPLMQSCEAGLVKM  537

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D +          SL  L++  C    DA+LV +S  C  L  L+LS   G
Sbjct  538  NLSGCVNVTDKSVSAITELHGGSLEFLNVDGCRYVTDATLVAISNNCWLLSELDLSKC-G  596

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD G+     +    L  ++LSGC  ++DK++  + KL G+TL  LN+  C  ++ +++
Sbjct  597  ITDSGIASLAGAVQLNLQILSLSGCSMLSDKSLPFLQKL-GQTLMGLNIQHCNGISSSAV  655


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/229 (24%), Positives = 92/229 (40%), Gaps = 30/229 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV-FGILVHSA  178
            AV + CP +K + L+ C L+ D G+ S   +A  +  L   + H ++ + V   ++ H  
Sbjct  287  AVGRFCPKLKFVSLKNCPLIGDQGIASLFSSAGHV--LTKVKLHALNISDVSLAVIGHYG  344

Query  179  GKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLV--  349
              +  +A      + +  F V         LR L+I  C G  D  L  + + CPNL   
Sbjct  345  IAVTDIALIGLQSINERGFWVMGNGQGLQKLRFLAITACNGVTDVGLEAIGKGCPNLKLF  404

Query  350  ------------------------HLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
                                    +L L   + +T  GL   + SC   L  ++L  C  
Sbjct  405  CLRKCAFLSDNGLVAFAKGSASLENLQLEECHRITQAGLFGVLLSCGKKLKALSLVNCFG  464

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            V +      + L   +L+ L++  C  V +A+LA +   C  L  L++S
Sbjct  465  VKELACRFPSVLPCNSLQSLSIRNCPGVGNATLAVVGRLCPKLTYLELS  513


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 51/98 (52%), Gaps = 2/98 (2%)
 Frame = +2

Query  296  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI  475
            G  D  L  ++R CP+L  L+L  ++ V+D GL    Q C   L K++L  C  +TD ++
Sbjct  201  GVTDTGLKAIARGCPSLRALSLWNVSSVSDEGLSEIAQGCHL-LEKLDLCQCPAITDTSL  259

Query  476  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLR  589
             AIAK     L  L +  C  + + SL A+  +C  L+
Sbjct  260  VAIAK-SCPNLTSLTIESCANIGNESLQAVGRFCPKLK  296



>ref|XP_007011864.1| EIN3-binding F box protein 1 [Theobroma cacao]
 gb|EOY29483.1| EIN3-binding F box protein 1 [Theobroma cacao]
Length=696

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 162/202 (80%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CLRKC  LSDNG+VSF KAA S+ESLQLEECHRI+Q G FG L++   
Sbjct  421  AVGKGCPNLKQFCLRKCAFLSDNGLVSFAKAAGSLESLQLEECHRITQFGFFGSLLNCGA  480

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA++F NC G+KDL  G+P+L PC SLRSLSI +C GFGD+SL  L +LCP L ++ L
Sbjct  481  KLKAISFVNCLGIKDLNLGLPSLSPCESLRSLSIRDCPGFGDSSLATLGKLCPQLQNVEL  540

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL+G+TD G+LP ++SC+AGLVKVNLSGC+N++DK +  +A LHG TLE++NL+GC  +
Sbjct  541  SGLHGITDAGILPLLESCEAGLVKVNLSGCVNLSDKAVCVMADLHGWTLEMINLDGCK-I  599

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +D S+ AIA+ C +L DLD+SK
Sbjct  600  SDGSVVAIAENCLLLSDLDVSK  621


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/255 (20%), Positives = 101/255 (40%), Gaps = 56/255 (22%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            AV+K CPN+  L +  C  + + G+ +      +++S+ +++C  +   G+         
Sbjct  289  AVAKSCPNLTDLTIEGCANIGNEGLQAVASCCPNLKSVSIKDCPLVGDQGIASLLSSASY  348

Query  155  ------------------------------------------FGILVHSAG--KLKALAF  202
                                                      F ++ +  G  KLK+   
Sbjct  349  SLTKVKLHALKITDVSLAVIGHYGNAVTDLSLISLPNVSEKGFWVMGNGHGLQKLKSFTV  408

Query  203  ENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV  379
             +C G+ DL  G+ A+   C +L+   +  C    D  LV  ++   +L  L L   + +
Sbjct  409  TSCRGVTDL--GLEAVGKGCPNLKQFCLRKCAFLSDNGLVSFAKAAGSLESLQLEECHRI  466

Query  380  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  559
            T +G    + +C A L  ++   C+ + D  +   +    E+L  L++  C    D+SLA
Sbjct  467  TQFGFFGSLLNCGAKLKAISFVNCLGIKDLNLGLPSLSPCESLRSLSIRDCPGFGDSSLA  526

Query  560  AIADYCSVLRDLDIS  604
             +   C  L+++++S
Sbjct  527  TLGKLCPQLQNVELS  541


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 2/115 (2%)
 Frame = +2

Query  257  CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV  436
            C+ L  L +C+C    D SL+ +++ CPNL  L + G   + + GL   V SC   L  V
Sbjct  268  CHQLEKLDLCHCPAITDKSLIAVAKSCPNLTDLTIEGCANIGNEGLQA-VASCCPNLKSV  326

Query  437  NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            ++  C  V D+ I+++      +L  + L+    +TD SLA I  Y + + DL +
Sbjct  327  SIKDCPLVGDQGIASLLSSASYSLTKVKLHALK-ITDVSLAVIGHYGNAVTDLSL  380



>ref|XP_009376923.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   259 bits (663),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCP++KQ CLRKC  +SD+G+VSF KAA S+ESL LEECHRI+Q G+FG L     
Sbjct  371  AVGKGCPDLKQFCLRKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGALSTGGS  430

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LAF +C G+KDL FG PA+ PC SLRSLSI +C GFG+  L +L +LCP L H++ 
Sbjct  431  KLKSLAFVSCLGLKDLNFGSPAVSPCQSLRSLSIRSCPGFGNVGLALLGKLCPQLQHVDF  490

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG TLE+LNL GC  V
Sbjct  491  SGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMAGLHGWTLEVLNLEGCRMV  550

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA LAAIA  C++L DLD+S+
Sbjct  551  SDAGLAAIAGNCTLLSDLDVSR  572


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 88/204 (43%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+         +E L L  C  IS  G+  I      
Sbjct  187  AISHGCPSLRVLSLWNMSSIGDEGLCEIANRCHLLEKLDLSRCPAISDKGLIAI-AKKCP  245

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L  ++ E+C  + + +        C +LRS+SI NC   GD  +  +LS     L  + 
Sbjct  246  NLTDVSLESCSNIGNGSLQAIG-QCCPNLRSISIKNCHLVGDQGIASLLSSTSYVLTKVK  304

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  L  ++D   L  +      ++ + L+   NVT++    +    G + L+   +  C 
Sbjct  305  LQALT-ISDVS-LAVIGHYGKAVMDLVLTRLSNVTERGFWVMGNGQGLQKLKSFTVTSCQ  362

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTD  L A+   C  L+   + K
Sbjct  363  GVTDTGLEAVGKGCPDLKQFCLRK  386



>ref|XP_007225116.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
 gb|EMJ26315.1| hypothetical protein PRUPE_ppa002673mg [Prunus persica]
Length=646

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 156/202 (77%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CLRKC  +SD+G+VSF KAA S+ESL LEECHRI+Q G FG L   A 
Sbjct  371  AVGKGCPNLKQFCLRKCLFISDSGLVSFCKAAGSLESLHLEECHRITQYGFFGALSTGA-  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA+AF  C G+KDL  G+P + PC SLRSLSI NC GFG+A L +L RLCP L H++ 
Sbjct  430  KLKAVAFVYCLGLKDLNLGLPEVSPCQSLRSLSIRNCPGFGNAGLALLGRLCPQLQHVDF  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G LP +++C+AGLVKVNLSGC+NVTDK +S++AKLHG TLE++NL GC  +
Sbjct  490  SGLEGITDAGFLPLLENCEAGLVKVNLSGCVNVTDKMVSSMAKLHGWTLEMVNLEGCKMI  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA L AI   C +L DLD+S+
Sbjct  550  SDAGLVAITGNCPLLSDLDVSR  571


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 93/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+         +E L L +C  IS  G+  I      
Sbjct  187  AISHGCPSLRVLSLWNVSSIGDEGLCEIANRCHMLEKLDLSQCPAISDKGLVAI-AKKCP  245

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  L+ E+C  + +   G+ A+   C +L+S+SI NC   GD  +  +LS +   L  +
Sbjct  246  NLTDLSLESCSNIGN--EGLQAIGQCCPNLKSISIKNCPLVGDQGIASLLSSVSYVLTKV  303

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  +TD   L  +      +  + L+   NVT++    +   HG + L+   +  C
Sbjct  304  KLQAL-AITDVS-LAVIGHYGKAITDLVLTSIPNVTERGFWVMGNGHGLQKLKSFTVTSC  361

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  362  QGVTDTGLEAVGKGCPNLKQFCLRK  386



>gb|AFT92041.1| EIN3 binding F-box 1 [Malus domestica]
Length=646

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CLRKC  +SD+G+VSF KAA S+ESL LEECHRI+Q G+FG+L     
Sbjct  370  AVGKGCPNLKQFCLRKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGVLSTGGS  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LAF +C G+KDL FG P + PC SL+SLSI +C GFG+  L +L +LCP L H++ 
Sbjct  430  KLKSLAFVSCLGLKDLNFGSPGVSPCQSLQSLSIRSCPGFGNVGLALLGKLCPQLQHVDF  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG T+E+LNL GC  V
Sbjct  490  SGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLV  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA LAAIA  C++L DLD+S+
Sbjct  550  SDAGLAAIAGNCTLLSDLDVSR  571


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 93/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+         +E L L  C  IS  G+  I      
Sbjct  186  AISHGCPSLRVLSLWNMSSIGDEGLCEIANRCHLLEKLDLSRCPAISDKGLIAI-AKKCP  244

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  ++ E+C  + +   G+ A+   C +L+S+SI NC   GD  +V +LS +   L  +
Sbjct  245  NLTDVSLESCSNIGN--EGLQAIGQCCPNLKSISIKNCHLVGDQGIVSLLSSISYVLTKV  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  ++D  L       +A +  + L+   NVT++    +    G + L+   +  C
Sbjct  303  KLQALT-ISDVSLAVIGHYGNA-VTDLVLTSLSNVTERGFWVMGNGQGLQKLKSFTVTSC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  361  QGVTDTGLEAVGKGCPNLKQFCLRK  385



>ref|XP_009376911.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=651

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCP++KQ CLRKC  +SD+G+VSF KAA S+ESL LEECHRI+Q G+FG L     
Sbjct  375  AVGKGCPDLKQFCLRKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGALSTGGS  434

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK++AF +C G+KDL FG PA+ PC SLRSLSI +C GFG+  L +L +LCP L H++ 
Sbjct  435  KLKSVAFVSCLGLKDLNFGSPAVSPCQSLRSLSIRSCPGFGNVGLALLGKLCPQLQHVDF  494

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG TLE+LNL GC  V
Sbjct  495  SGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMAGLHGWTLEVLNLEGCRMV  554

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA LAAIA  C++L DLD+S+
Sbjct  555  SDAGLAAIAGNCTLLSDLDVSR  576


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 82/228 (36%), Gaps = 54/228 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+         +E L L  C  IS  G+  I      
Sbjct  191  AISHGCPSLRVLSLWNMSSIGDEGLCEIANRCHLLEKLDLSRCPAISDKGLIAI------  244

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L  +S+ +C+  G+ SL  + + CPNL  +++
Sbjct  245  ----------------------AKKCPNLTDVSLESCSNIGNGSLQAIGQCCPNLRSISI  282

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI-------------------------NVTD  466
               N V D G+   + S    L KV L                             NVT+
Sbjct  283  KNCNLVGDQGIASLLSSTSCVLTKVKLQALTISDVSLAVIGHYGKAVTDLVLTSLSNVTE  342

Query  467  KTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            +    +    G + L+   +  C  VTD  L A+   C  L+   + K
Sbjct  343  RGFWVMGNGQGLQKLKSFTVTSCQGVTDTGLEAVGKGCPDLKQFCLRK  390


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 83/185 (45%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    + G+    K    ++ +       I+  G   ++ +    L  +
Sbjct  460  CQSLRSLSIRSCPGFGNVGLALLGKLCPQLQHVDFSGLESITDVGFLPLVENCEAGLVKV  519

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D      A     +L  L++  C    DA L  ++  C  L  L++S    
Sbjct  520  NLSGCVNLTDKVVSSMAGLHGWTLEVLNLEGCRMVSDAGLAAIAGNCTLLSDLDVSRC-A  578

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD+G+     +    L  +++SGC  V+DK++ A+ K+ G+TL  LNL  C  ++ +++
Sbjct  579  ITDFGIASLGHADQLNLQILSVSGCPLVSDKSLPALVKM-GQTLHGLNLQHCNAISSSTV  637

Query  557  AAIAD  571
              + +
Sbjct  638  DRLVE  642



>ref|XP_009355743.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=646

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CLRKC  +SD+G+VSF KA  S+ESL LEECHRI+Q G FG L     
Sbjct  370  AVGKGCPNLKQFCLRKCLFISDSGLVSFCKATRSLESLHLEECHRITQFGFFGALSTGGS  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK++AF +C G+KD+ FG PA+ PC SLRSLSI  C GFG+  L +L +LCP L H++ 
Sbjct  430  KLKSVAFASCMGLKDVNFGSPAVSPCQSLRSLSIRRCPGFGNVGLALLGKLCPQLEHVDF  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG TLE++NL+GC  V
Sbjct  490  SGLEAITDAGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSLADLHGWTLEVVNLDGCRRV  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA LAAIA  C++L DLD+SK
Sbjct  550  SDAGLAAIAGNCTLLSDLDVSK  571


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 90/205 (44%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+    K    +E L L +C  IS  G+  I      
Sbjct  186  AISHGCPSLRVLSLWNVSSVGDEGLCEIAKRCHLLEKLDLTQCPAISDKGLIAI-AKKCP  244

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  ++ E C  + +   G+ A+   C +LRS+SI NC   GD  +  +LS     L  +
Sbjct  245  NLTDVSLEFCSNIGNE--GLQAIGQCCPNLRSISIKNCRLVGDQGIAGLLSSTSYVLTKV  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  ++D   L  +      +  + L+   NVT +    +    G + L+   +  C
Sbjct  303  KLQALT-ISDVS-LAVIGHYGLAVTDLVLASLRNVTQRGFLFMGNGQGLQKLKSFTIASC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  361  QGVTDTGLQAVGKGCPNLKQFCLRK  385


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/229 (22%), Positives = 95/229 (41%), Gaps = 28/229 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL-----  166
            A++K CPN+  + L  C+ + + G+ +  +   ++ S+ ++ C  +   G+ G+L     
Sbjct  238  AIAKKCPNLTDVSLEFCSNIGNEGLQAIGQCCPNLRSISIKNCRLVGDQGIAGLLSSTSY  297

Query  167  VHSAGKLKALAFENC-------FGMKDLAFGVPAL--------------PPCNSLRSLSI  283
            V +  KL+AL   +        +G+      + +L                   L+S +I
Sbjct  298  VLTKVKLQALTISDVSLAVIGHYGLAVTDLVLASLRNVTQRGFLFMGNGQGLQKLKSFTI  357

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
             +C G  D  L  + + CPNL    L     ++D GL+ F ++  + L  ++L  C  +T
Sbjct  358  ASCQGVTDTGLQAVGKGCPNLKQFCLRKCLFISDSGLVSFCKATRS-LESLHLEECHRIT  416

Query  464  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIA-DYCSVLRDLDISK  607
                       G  L+ +    C  + D +  + A   C  LR L I +
Sbjct  417  QFGFFGALSTGGSKLKSVAFASCMGLKDVNFGSPAVSPCQSLRSLSIRR  465



>ref|XP_008378375.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CL KC  +SD+G+VSF KAA S+ESL LEECHRI+Q G+FG+L     
Sbjct  370  AVGKGCPNLKQFCLXKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGVLSTGGS  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LAF +C G+KDL FG P + PC SLRSLSI +C GFG+  L +L +LCP L H++ 
Sbjct  430  KLKSLAFVSCLGLKDLNFGSPGVSPCQSLRSLSIRSCPGFGNVGLALLGKLCPQLQHVDF  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG T+E+LNL GC  V
Sbjct  490  SGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLV  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA LAAIA  C++L DLD+S+
Sbjct  550  SDAGLAAIAGNCTLLSDLDVSR  571


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 92/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+         +E L L  C  IS  G+  I      
Sbjct  186  AISHGCPSLRVLSLWNMSSIGDEGLCEIANRCXLLEKLDLSRCPAISDKGLIAI-AKKCP  244

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  ++ E+C  + +   G+ A+   C +L+S+SI NC   GD  +  +LS +   L  +
Sbjct  245  NLTDVSLESCSNIGN--EGLQAIGQCCPNLKSISIKNCHLVGDQGIXSLLSSISYVLTKV  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  ++D  L       +A +  + L+   NVT++    +    G + L+   +  C
Sbjct  303  KLQALT-ISDVSLAVIGHYGNA-VTDLVLTSLSNVTERGFWVMGNGQGLQKLKSFTVTSC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  361  QGVTDTGLEAVGKGCPNLKQFCLXK  385


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 96/227 (42%), Gaps = 28/227 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL-----  166
            A++K CPN+  + L  C+ + + G+ +  +   +++S+ ++ CH +   G+  +L     
Sbjct  238  AIAKKCPNLTDVSLESCSNIGNEGLQAIGQCCPNLKSISIKNCHLVGDQGIXSLLSSISY  297

Query  167  VHSAGKLKALAFENC-------FG-------------MKDLAFGVPAL-PPCNSLRSLSI  283
            V +  KL+AL   +        +G             + +  F V         L+S ++
Sbjct  298  VLTKVKLQALTISDVSLAVIGHYGNAVTDLVLTSLSNVTERGFWVMGNGQGLQKLKSFTV  357

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
             +C G  D  L  + + CPNL    L     V+D GL+ F ++  + L  ++L  C  +T
Sbjct  358  TSCQGVTDTGLEAVGKGCPNLKQFCLXKCLFVSDSGLVSFCKAAGS-LESLHLEECHRIT  416

Query  464  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIA-DYCSVLRDLDI  601
               +  +    G  L+ L    C  + D +  +     C  LR L I
Sbjct  417  QFGLFGVLSTGGSKLKSLAFVSCLGLKDLNFGSPGVSPCQSLRSLSI  463



>ref|XP_010250120.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=671

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCP++KQL LRKC+ +SDNG+V F +AA S+E+LQLEEC+RI+Q+GV G + +   
Sbjct  395  AVGKGCPDLKQLILRKCSFVSDNGLVDFARAAASLENLQLEECNRITQSGVLGAISNCGS  454

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKALAF  C G+KD+   +P L PC+SLRSLSI NC GFG +SL V+ +LCP L ++ L
Sbjct  455  KLKALAFVKCMGIKDMVLELPMLSPCDSLRSLSIRNCPGFGSSSLAVVGKLCPRLQNIEL  514

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP V++C+ GLVKVNLSGC+N+TD  ++ +AK HG TL+LLNL+GC  +
Sbjct  515  SGLCGITDAGLLPLVENCEPGLVKVNLSGCLNLTDAVVTTMAKHHGGTLQLLNLDGCRKI  574

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ CSVLRDLDISK
Sbjct  575  TDASLIAIANNCSVLRDLDISK  596


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 94/204 (46%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + + D G+         +E L L +C  IS  G+  I   +  
Sbjct  211  AIARGCPSLRVLSLWNVSSVGDKGLSDIASGCHMLEKLDLCQCSSISDKGLMAI-AENCP  269

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L AL  E C  + +          C +L+S+SI +C   GD  +  +LS     L  + 
Sbjct  270  NLAALTIECCSKIGNGTLQAIG-QYCPNLQSISIKDCPLIGDQGIANLLSSASHVLTKVK  328

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN +TD   L  V      + ++ L+G  NV+++    +   HG   L+ + ++ C 
Sbjct  329  LQALN-ITDVS-LAVVGHYGKAVTELVLTGLQNVSERGFWVMGNTHGLLKLKSITISSCR  386

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTD  L A+   C  L+ L + K
Sbjct  387  GVTDLGLQAVGKGCPDLKQLILRK  410


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 86/202 (43%), Gaps = 4/202 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ + CPN++ + ++ C L+ D G+ + + +A  + +    +   I+      ++ H   
Sbjct  289  AIGQYCPNLQSISIKDCPLIGDQGIANLLSSASHVLTKVKLQALNITDVS-LAVVGHYGK  347

Query  182  KLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  L       + +  F V         L+S++I +C G  D  L  + + CP+L  L 
Sbjct  348  AVTELVLTGLQNVSERGFWVMGNTHGLLKLKSITISSCRGVTDLGLQAVGKGCPDLKQLI  407

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            L   + V+D GL+ F ++  A L  + L  C  +T   +       G  L+ L    C  
Sbjct  408  LRKCSFVSDNGLVDFARAA-ASLENLQLEECNRITQSGVLGAISNCGSKLKALAFVKCMG  466

Query  539  VTDASLA-AIADYCSVLRDLDI  601
            + D  L   +   C  LR L I
Sbjct  467  IKDMVLELPMLSPCDSLRSLSI  488



>ref|XP_008378376.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   258 bits (658),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CL KC  +SD+G+VSF KAA S+ESL LEECHRI+Q G+FG+L     
Sbjct  418  AVGKGCPNLKQFCLXKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGVLSTGGS  477

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LAF +C G+KDL FG P + PC SLRSLSI +C GFG+  L +L +LCP L H++ 
Sbjct  478  KLKSLAFVSCLGLKDLNFGSPGVSPCQSLRSLSIRSCPGFGNVGLALLGKLCPQLQHVDF  537

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG T+E+LNL GC  V
Sbjct  538  SGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLV  597

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA LAAIA  C++L DLD+S+
Sbjct  598  SDAGLAAIAGNCTLLSDLDVSR  619


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 92/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+         +E L L  C  IS  G+  I      
Sbjct  234  AISHGCPSLRVLSLWNMSSIGDEGLCEIANRCXLLEKLDLSRCPAISDKGLIAI-AKKCP  292

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  ++ E+C  + +   G+ A+   C +L+S+SI NC   GD  +  +LS +   L  +
Sbjct  293  NLTDVSLESCSNIGN--EGLQAIGQCCPNLKSISIKNCHLVGDQGIXSLLSSISYVLTKV  350

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  ++D  L       +A +  + L+   NVT++    +    G + L+   +  C
Sbjct  351  KLQALT-ISDVSLAVIGHYGNA-VTDLVLTSLSNVTERGFWVMGNGQGLQKLKSFTVTSC  408

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  409  QGVTDTGLEAVGKGCPNLKQFCLXK  433


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 96/227 (42%), Gaps = 28/227 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL-----  166
            A++K CPN+  + L  C+ + + G+ +  +   +++S+ ++ CH +   G+  +L     
Sbjct  286  AIAKKCPNLTDVSLESCSNIGNEGLQAIGQCCPNLKSISIKNCHLVGDQGIXSLLSSISY  345

Query  167  VHSAGKLKALAFENC-------FG-------------MKDLAFGVPAL-PPCNSLRSLSI  283
            V +  KL+AL   +        +G             + +  F V         L+S ++
Sbjct  346  VLTKVKLQALTISDVSLAVIGHYGNAVTDLVLTSLSNVTERGFWVMGNGQGLQKLKSFTV  405

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
             +C G  D  L  + + CPNL    L     V+D GL+ F ++  + L  ++L  C  +T
Sbjct  406  TSCQGVTDTGLEAVGKGCPNLKQFCLXKCLFVSDSGLVSFCKAAGS-LESLHLEECHRIT  464

Query  464  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIA-DYCSVLRDLDI  601
               +  +    G  L+ L    C  + D +  +     C  LR L I
Sbjct  465  QFGLFGVLSTGGSKLKSLAFVSCLGLKDLNFGSPGVSPCQSLRSLSI  511



>emb|CBI21043.3| unnamed protein product [Vitis vinifera]
Length=610

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CLRKC  LSDNG+VS  K A S+ESLQLEECH I+Q GVFG LV   G
Sbjct  359  AVGKGCPNLKQFCLRKCAFLSDNGLVSLAKVAASLESLQLEECHHITQYGVFGALVSCGG  418

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LA  NCFG+KD   G+P + PC SL SLSI NC GFG+ASL ++ +LCP L  L+L
Sbjct  419  KLKSLALVNCFGIKDTVEGLPLMTPCKSLSSLSIRNCPGFGNASLCMVGKLCPQLQRLDL  478

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SG   +T+ G LP ++SC+A L+KVNLSGC+N+TD  +SA+AK+HG TLE LNL+GC  +
Sbjct  479  SGALRITNAGFLPLLESCEASLIKVNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKI  538

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDAS+ AIA+ C++L DLD+SK+
Sbjct  539  TDASMFAIAENCALLSDLDVSKT  561


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 97/205 (47%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + ++D G++        +E L L  C  IS   +  I   +  
Sbjct  175  AIARGCPSLRVLSLWNVSSIADEGLIEIANGCHQLEKLDLCGCPTISDKALVAI-AKNCH  233

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L AL  E+C  + +   G+ A+   C +L+S+SI NC   GD  +  +LS     L  +
Sbjct  234  NLTALTIESCPRIGNA--GLQAVGQFCPNLKSISIKNCPLVGDQGVASLLSSASYALTKV  291

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  +      +  ++L+G  NV ++    +   HG + L+ L +  C
Sbjct  292  KLHALN-ITDVS-LAVIGHYGKAITDLDLTGLQNVGERGFWVMGSGHGLQKLKSLTVTSC  349

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  350  QGVTDMGLEAVGKGCPNLKQFCLRK  374


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 56/108 (52%), Gaps = 5/108 (5%)
 Frame = +2

Query  278  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
            S C  T  G   L  ++R CP+L  L+L  ++ + D GL+     C   L K++L GC  
Sbjct  164  SSCRVTNLG---LGAIARGCPSLRVLSLWNVSSIADEGLIEIANGCHQ-LEKLDLCGCPT  219

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            ++DK + AIAK +   L  L +  C  + +A L A+  +C  L+ + I
Sbjct  220  ISDKALVAIAK-NCHNLTALTIESCPRIGNAGLQAVGQFCPNLKSISI  266



>ref|XP_008445218.1| PREDICTED: EIN3-binding F-box protein 1 [Cucumis melo]
Length=646

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ KGCPN+K+ CLRKC+ LSDNG+VSFV+AA SIE+LQLEECHRI+Q G+FG +++   
Sbjct  370  SIGKGCPNMKKFCLRKCSFLSDNGMVSFVQAATSIENLQLEECHRITQLGLFGTILNCGA  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+  NC G+KDL+  +P+L  C SL+SLSI NC GFG+ASL +LS+LCP L H+  
Sbjct  430  KLKALSLVNCLGIKDLSLNLPSLSSCKSLQSLSIRNCPGFGNASLTLLSKLCPQLQHVEF  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGLNG+ D GLLP   +C AGLV VNLSGC+N+TDK IS++ KLHG TLELLNL+GC  V
Sbjct  490  SGLNGIRDSGLLPLFMNCKAGLVNVNLSGCVNLTDKVISSLTKLHGWTLELLNLDGCLKV  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD+SL AIA+ C +L DLD+SK
Sbjct  550  TDSSLVAIAENCPLLNDLDVSK  571


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 92/204 (45%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP +K + L   + + D G++   K  + +E L L +C  IS   +  +  H   
Sbjct  186  AVAHGCPALKAISLWNLSSIGDEGMIEIAKGCQLLEKLDLSQCPGISNKALLELAKHCP-  244

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVL-SRLCPNLVHLN  358
             L  +  E C  + + +        C++L+S+SI +C   GD  +  L S     L    
Sbjct  245  NLTDITIEACANIGNESIQAIG-QYCSNLKSISIRDCPLIGDQGISSLFSSTSYTLNKAK  303

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L GLN VTD   L  +      +  + L+G  NV+++   A+   HG + L    L+ C 
Sbjct  304  LQGLN-VTDVS-LAVIGHYGRAITDLTLTGLTNVSERGFWAMGNGHGLQKLRSFTLSSCH  361

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTD  L +I   C  ++   + K
Sbjct  362  GVTDVGLQSIGKGCPNMKKFCLRK  385


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/229 (20%), Positives = 96/229 (42%), Gaps = 30/229 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVS-FVKAAESIESLQLEECHRISQAGVFGILVHSA  178
            A+ + C N+K + +R C L+ D G+ S F   + ++   +L+  +    +    ++ H  
Sbjct  264  AIGQYCSNLKSISIRDCPLIGDQGISSLFSSTSYTLNKAKLQGLNVTDVS--LAVIGHYG  321

Query  179  GKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
              +  L       + +  F           LRS ++ +C G  D  L  + + CPN+   
Sbjct  322  RAITDLTLTGLTNVSERGFWAMGNGHGLQKLRSFTLSSCHGVTDVGLQSIGKGCPNMKKF  381

Query  356  NLSGLNGVTDYGLLPFVQS--------------------------CDAGLVKVNLSGCIN  457
             L   + ++D G++ FVQ+                          C A L  ++L  C+ 
Sbjct  382  CLRKCSFLSDNGMVSFVQAATSIENLQLEECHRITQLGLFGTILNCGAKLKALSLVNCLG  441

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + D +++  +    ++L+ L++  C    +ASL  ++  C  L+ ++ S
Sbjct  442  IKDLSLNLPSLSSCKSLQSLSIRNCPGFGNASLTLLSKLCPQLQHVEFS  490



>ref|XP_007161212.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
 gb|ESW33206.1| hypothetical protein PHAVU_001G051300g [Phaseolus vulgaris]
Length=643

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+K   L KC  LSDNG++SF KAA S+++L+LEECHRI+Q G+FG+L +  G
Sbjct  367  AVGKGCPNLKIAHLHKCAFLSDNGLISFAKAASSLQTLRLEECHRITQFGLFGVLFNCGG  426

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA++   C+G+KDL+  +P + PC SLRSL+I NC GFG+ASL VL +LCP L H+ L
Sbjct  427  KLKAISVVRCYGIKDLSLVLPTVSPCESLRSLTISNCPGFGNASLSVLGKLCPKLQHVEL  486

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL+GVTD GLLP ++S +AGLVKVNLSGC NVTDK +S++A LHG TLE LNL+GC  +
Sbjct  487  SGLDGVTDAGLLPVLESSEAGLVKVNLSGCTNVTDKVVSSLANLHGWTLENLNLDGCKNI  546

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIA+ C++L DLD+SK
Sbjct  547  SDASLMAIAENCALLCDLDVSK  568


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 100/227 (44%), Gaps = 27/227 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI----LV  169
            A++K C N+ +L L  C  + + G+ +  K    + S+ +++C  +S  G+ G+    LV
Sbjct  236  AIAKNCQNLTELSLESCPNVGNEGLRAIGKFCPDLRSITIKDCTGVSDQGIAGLFSTSLV  295

Query  170  HSAGKLKALAFENC-------FGMKDLAFGVPALPPCNS--------------LRSLSIC  286
             +  KL+AL+  +        +G       +  LP  +               L+SL++ 
Sbjct  296  LTKVKLQALSVSDLSLAVIGHYGKSVTDLVLNCLPNVSEKGFWVMGNGSGLQKLKSLTVA  355

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
            +C G  D  L  + + CPNL   +L     ++D GL+ F ++  + L  + L  C  +T 
Sbjct  356  SCRGVTDIGLEAVGKGCPNLKIAHLHKCAFLSDNGLISFAKAASS-LQTLRLEECHRITQ  414

Query  467  KTISAIAKLHGETLELLNLNGCGCVTDASLA-AIADYCSVLRDLDIS  604
              +  +    G  L+ +++  C  + D SL       C  LR L IS
Sbjct  415  FGLFGVLFNCGGKLKAISVVRCYGIKDLSLVLPTVSPCESLRSLTIS  461


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 100/212 (47%), Gaps = 25/212 (12%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GC  +++L L KC  ++D  +V+  K  +++  L LE C  +   G+  I     GK
Sbjct  211  IANGCHQLEKLDLCKCPAITDKALVAIAKNCQNLTELSLESCPNVGNEGLRAI-----GK  265

Query  185  ----LKALAFENCFGMKDLA----FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCP  340
                L+++  ++C G+ D      F    +     L++LS+       D SL V+     
Sbjct  266  FCPDLRSITIKDCTGVSDQGIAGLFSTSLVLTKVKLQALSV------SDLSLAVIGHYGK  319

Query  341  NLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAKLHGETLE  511
            ++  L L+ L  V++ G   +V    +GL K+    ++ C  VTD  + A+ K     L+
Sbjct  320  SVTDLVLNCLPNVSEKGF--WVMGNGSGLQKLKSLTVASCRGVTDIGLEAVGK-GCPNLK  376

Query  512  LLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            + +L+ C  ++D  L + A   S L+ L + +
Sbjct  377  IAHLHKCAFLSDNGLISFAKAASSLQTLRLEE  408


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/185 (23%), Positives = 86/185 (46%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +  C    +  +    K    ++ ++L     ++ AG+  +L  S   L  +
Sbjct  452  CESLRSLTISNCPGFGNASLSVLGKLCPKLQHVELSGLDGVTDAGLLPVLESSEAGLVKV  511

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D      A     +L +L++  C    DASL+ ++  C  L  L++S  + 
Sbjct  512  NLSGCTNVTDKVVSSLANLHGWTLENLNLDGCKNISDASLMAIAENCALLCDLDVSKCS-  570

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD G+     +    L  ++LSGC  V+D+++ A+ K+ G TL  LN+  C  +  +++
Sbjct  571  ITDAGIAALAHAQQINLQILSLSGCALVSDRSLPALRKV-GRTLLGLNIQHCNAINSSTV  629

Query  557  AAIAD  571
              + +
Sbjct  630  DMLVE  634



>ref|XP_008394083.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
 ref|XP_008352056.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=646

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+KQ CLRKC  +SD+G+VSF KAA S+ESL LEECHRI+Q G FG L     
Sbjct  370  ALGKGCPNLKQFCLRKCLFVSDSGLVSFCKAARSLESLHLEECHRITQFGFFGALSTGGS  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK++AF +C G+KD+ FG PA+ PC SLRSLSI  C GFG+  L +L +LCP L H++ 
Sbjct  430  KLKSVAFASCLGLKDVNFGSPAVSPCQSLRSLSIRRCPGFGNVGLALLGKLCPQLEHVDF  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG TL+ +NL GC  V
Sbjct  490  SGLEAITDAGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSLADLHGWTLKAVNLEGCRRV  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA LAAIA  C++L DLD+SK
Sbjct  550  SDAGLAAIAGNCTLLSDLDVSK  571


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 90/205 (44%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+    K    +E L L +C  IS  G+  I      
Sbjct  186  AISHGCPSLRVLSLWNVSSVGDEGLCEIAKRCHLLEKLDLTQCPAISDKGLIAI-AKKCP  244

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  ++ E C  + +   G+ A+   C +LRS+SI NC   GD  +  +LS     L  +
Sbjct  245  NLTDVSLEFCSNIGN--EGLQAIGQCCPNLRSISIKNCRLVGDQGIAGLLSSTSYVLTKV  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  ++D   L  +      +  + L+   NVT +    +    G + L+   +  C
Sbjct  303  KLQALT-ISDVS-LAVIGHYGLAVTDLVLTSLRNVTQRGFLVMGNGQGLQKLKSFTVASC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  361  QGVTDTGLEALGKGCPNLKQFCLRK  385


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 94/229 (41%), Gaps = 28/229 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL-----  166
            A++K CPN+  + L  C+ + + G+ +  +   ++ S+ ++ C  +   G+ G+L     
Sbjct  238  AIAKKCPNLTDVSLEFCSNIGNEGLQAIGQCCPNLRSISIKNCRLVGDQGIAGLLSSTSY  297

Query  167  VHSAGKLKALAFENC----FGMKDLAFGVPALPPCNS-----------------LRSLSI  283
            V +  KL+AL   +      G   LA     L    +                 L+S ++
Sbjct  298  VLTKVKLQALTISDVSLAVIGHYGLAVTDLVLTSLRNVTQRGFLVMGNGQGLQKLKSFTV  357

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
             +C G  D  L  L + CPNL    L     V+D GL+ F ++  + L  ++L  C  +T
Sbjct  358  ASCQGVTDTGLEALGKGCPNLKQFCLRKCLFVSDSGLVSFCKAARS-LESLHLEECHRIT  416

Query  464  DKTISAIAKLHGETLELLNLNGCGCVTDASLAAIA-DYCSVLRDLDISK  607
                       G  L+ +    C  + D +  + A   C  LR L I +
Sbjct  417  QFGFFGALSTGGSKLKSVAFASCLGLKDVNFGSPAVSPCQSLRSLSIRR  465



>gb|KHN33913.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+K   L KC  LSDNG++SF KAA S+ESL+LEECHRI+Q G FG+L +   
Sbjct  368  AVGKGCPNLKIAHLHKCAFLSDNGLMSFAKAASSLESLRLEECHRITQLGFFGVLFNCGA  427

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA++  +C+G+KDL   +P + PC SLRSLSI NC+GFG+ASL VL +LCP L H+ L
Sbjct  428  KLKAISLVSCYGIKDLNLVLPTVSPCESLRSLSISNCSGFGNASLSVLGKLCPQLQHVEL  487

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD GLLP ++S +AGLVKVNLSGC N+TDK +S++A LHG TLE LNL+GC  +
Sbjct  488  SGLEGVTDAGLLPLLESSEAGLVKVNLSGCTNITDKVVSSLANLHGWTLENLNLDGCKNI  547

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIA+ C++L DLD+SK
Sbjct  548  SDASLMAIAENCALLCDLDVSK  569


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 89/186 (48%), Gaps = 2/186 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +  C+   +  +    K    ++ ++L     ++ AG+  +L  S   L  +
Sbjct  453  CESLRSLSISNCSGFGNASLSVLGKLCPQLQHVELSGLEGVTDAGLLPLLESSEAGLVKV  512

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D      A     +L +L++  C    DASL+ ++  C  L  L++S    
Sbjct  513  NLSGCTNITDKVVSSLANLHGWTLENLNLDGCKNISDASLMAIAENCALLCDLDVSKCT-  571

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD G+     +    L  ++LSGC  V+D++++A+ KL G TL  LN+  C  + ++++
Sbjct  572  ITDAGIAVLAHAEQINLQILSLSGCTLVSDRSLTALRKL-GHTLLGLNIQHCNAINNSTV  630

Query  557  AAIADY  574
              + ++
Sbjct  631  DTLVEF  636


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 103/232 (44%), Gaps = 36/232 (16%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP++K L L     + D G++        +E L L +C  I+   +  I   +  
Sbjct  184  AVARGCPSLKALSLWNVATVGDEGLIEIANGCHQLEKLDLCKCPAITDKALVAI-AKNCQ  242

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDA----------------  310
             L  L+FE+C  + +   G+ A+   C++L+S+SI +CTG  D                 
Sbjct  243  NLTELSFESCPNIGN--EGLRAIGKLCSNLKSISIKDCTGVSDHGIAGLLSSTSLVLSKV  300

Query  311  ----------SLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGC  451
                      SL V+     ++  L L+ L  V++ G   +V     GL K+    ++ C
Sbjct  301  KLQALTVSDLSLAVIGHYGKSVTDLVLNCLPNVSERGF--WVMGNGNGLQKLKSLTVASC  358

Query  452  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
              VTD  + A+ K     L++ +L+ C  ++D  L + A   S L  L + +
Sbjct  359  KGVTDIGLEAVGK-GCPNLKIAHLHKCAFLSDNGLMSFAKAASSLESLRLEE  409



>ref|XP_004291457.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=645

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+KGCPN+KQ CLRKC  LSD+G+VSF KAA S+ESL LEECHRI+Q G FG L +S  
Sbjct  369  AVAKGCPNLKQFCLRKCLYLSDSGLVSFCKAAGSLESLHLEECHRITQYGFFGALSNSGA  428

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKALAF  C G+KDL  G+P + PC SLRSLSI NC GFG++ + VL +LCP L H++ 
Sbjct  429  KLKALAFVYCLGLKDLNLGLPVVSPCESLRSLSIRNCPGFGNSGMAVLGQLCPQLQHVDF  488

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G L  ++S +AGLVKVNLSGC+N+TDK +S +A+LHG TLE +NL GC  +
Sbjct  489  SGLEGITDAGFLKLLKSTEAGLVKVNLSGCVNLTDKAVSVMAELHGWTLEKVNLEGCRMI  548

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +D+ L AI + C +L DLDIS+
Sbjct  549  SDSGLVAIGENCPLLSDLDISR  570


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 88/185 (48%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    ++G+    +    ++ +       I+ AG   +L  +   L  +
Sbjct  454  CESLRSLSIRNCPGFGNSGMAVLGQLCPQLQHVDFSGLEGITDAGFLKLLKSTEAGLVKV  513

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A  V A     +L  +++  C    D+ LV +   CP L  L++S    
Sbjct  514  NLSGCVNLTDKAVSVMAELHGWTLEKVNLEGCRMISDSGLVAIGENCPLLSDLDISRC-A  572

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD+G+     +    L  +++SGC  V+DK++ A+ K+ GETL  LNL  C  ++ +++
Sbjct  573  ITDFGIASLALAGQLNLQILSVSGCSCVSDKSLPALVKM-GETLLGLNLQQCNAISSSTV  631

Query  557  AAIAD  571
              + +
Sbjct  632  DRLVE  636


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 92/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L +   + + D G+    K    +E L L +C  IS  G+  I   S  
Sbjct  185  AISHGCPSLRVLSMWNVSSVGDEGLCEIAKRCHLLEKLDLSQCPAISDKGLAAI-ARSCP  243

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVL-SRLCPNLVHL  355
             L  LA E+C  + +   G+ A+   C  L+S+SI NC   GD  +  L S     L  +
Sbjct  244  NLTDLALESCSNIGN--EGLQAIGKCCPKLKSVSIKNCPLVGDQGIASLVSSASDVLEKV  301

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  +TD   L  +      +  + L+   NV ++    +   HG + L+ L +  C
Sbjct  302  KLQALT-ITDV-CLAVIGCYGKAVTDLVLTNLPNVCERGFWVMGNGHGLQKLKSLAVTSC  359

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD  L A+A  C  L+   + K
Sbjct  360  QGATDTGLEAVAKGCPNLKQFCLRK  384


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 95/228 (42%), Gaps = 30/228 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++ CPN+  L L  C+ + + G+ +  K    ++S+ ++ C  +   G+   LV SA 
Sbjct  237  AIARSCPNLTDLALESCSNIGNEGLQAIGKCCPKLKSVSIKNCPLVGDQGI-ASLVSSAS  295

Query  182  ------KLKALAFEN-------CFGMKDLAFGVPALPPC--------------NSLRSLS  280
                  KL+AL   +       C+G       +  LP                  L+SL+
Sbjct  296  DVLEKVKLQALTITDVCLAVIGCYGKAVTDLVLTNLPNVCERGFWVMGNGHGLQKLKSLA  355

Query  281  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV  460
            + +C G  D  L  +++ CPNL    L     ++D GL+ F ++  + L  ++L  C  +
Sbjct  356  VTSCQGATDTGLEAVAKGCPNLKQFCLRKCLYLSDSGLVSFCKAAGS-LESLHLEECHRI  414

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASLA-AIADYCSVLRDLDI  601
            T           G  L+ L    C  + D +L   +   C  LR L I
Sbjct  415  TQYGFFGALSNSGAKLKALAFVYCLGLKDLNLGLPVVSPCESLRSLSI  462



>ref|XP_008365190.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X1 [Malus 
domestica]
Length=646

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CL KC  +SD+G+VSF KAA S+ESL LEECHRI+Q G+FG+L     
Sbjct  370  AVGKGCPNLKQFCLXKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGVLSTGGS  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LAF +C G+KDL FG P + PC SL SLSI +C GFG+  L +L +LCP L H++ 
Sbjct  430  KLKSLAFVSCLGLKDLNFGSPGVSPCQSLXSLSIRSCPGFGNVGLALLGKLCPQLQHVDF  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG T+E+LNL GC  V
Sbjct  490  SGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLV  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA LAAIA  C++L DLD+S+
Sbjct  550  SDAGLAAIAGNCTLLSDLDVSR  571


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 92/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+         +E L L  C  IS  G+  I      
Sbjct  186  AISHGCPSLRVLSLWNMSSIGDEGLCEIANRCXLLEKLDLSRCPAISDKGLIAI-AKKCP  244

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  ++ E+C  + +   G+ A+   C +L+S+SI NC   GD  +  +LS +   L  +
Sbjct  245  NLTDVSLESCSNIGN--EGLQAIGQCCPNLKSISIKNCHLVGDQGIXSLLSSISYVLTKV  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  ++D  L       +A +  + L+   NVT++    +    G + L+   +  C
Sbjct  303  KLQALT-ISDVSLAVIGHYGNA-VTDLVLTSLSNVTERGFWVMGNGQGLQKLKSFTVTSC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  361  QGVTDTGLEAVGKGCPNLKQFCLXK  385



>ref|XP_002285126.1| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=667

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CLRKC  LSDNG+VS  K A S+ESLQLEECH I+Q GVFG LV   G
Sbjct  391  AVGKGCPNLKQFCLRKCAFLSDNGLVSLAKVAASLESLQLEECHHITQYGVFGALVSCGG  450

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LA  NCFG+KD   G+P + PC SL SLSI NC GFG+ASL ++ +LCP L  L+L
Sbjct  451  KLKSLALVNCFGIKDTVEGLPLMTPCKSLSSLSIRNCPGFGNASLCMVGKLCPQLQRLDL  510

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SG   +T+ G LP ++SC+A L+KVNLSGC+N+TD  +SA+AK+HG TLE LNL+GC  +
Sbjct  511  SGALRITNAGFLPLLESCEASLIKVNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKI  570

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDAS+ AIA+ C++L DLD+SK+
Sbjct  571  TDASMFAIAENCALLSDLDVSKT  593


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 97/205 (47%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + ++D G++        +E L L  C  IS   +  I   +  
Sbjct  207  AIARGCPSLRVLSLWNVSSIADEGLIEIANGCHQLEKLDLCGCPTISDKALVAI-AKNCH  265

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L AL  E+C  + +   G+ A+   C +L+S+SI NC   GD  +  +LS     L  +
Sbjct  266  NLTALTIESCPRIGNA--GLQAVGQFCPNLKSISIKNCPLVGDQGVASLLSSASYALTKV  323

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  +      +  ++L+G  NV ++    +   HG + L+ L +  C
Sbjct  324  KLHALN-ITDVS-LAVIGHYGKAITDLDLTGLQNVGERGFWVMGSGHGLQKLKSLTVTSC  381

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  382  QGVTDMGLEAVGKGCPNLKQFCLRK  406


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 79/178 (44%), Gaps = 2/178 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C ++  L +R C    +  +    K    ++ L L    RI+ AG   +L      L  +
Sbjct  476  CKSLSSLSIRNCPGFGNASLCMVGKLCPQLQRLDLSGALRITNAGFLPLLESCEASLIKV  535

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D      A     +L  L++  C    DAS+  ++  C  L  L++S    
Sbjct  536  NLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKITDASMFAIAENCALLSDLDVSK-TA  594

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA  550
            +TDYG+     +    +  ++LSGC  ++++++  + KL G+TL  LNL  C  ++ +
Sbjct  595  ITDYGVAALASAKHLNVQILSLSGCSLISNQSVPFLRKL-GQTLLGLNLQQCNTISSS  651


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 56/108 (52%), Gaps = 5/108 (5%)
 Frame = +2

Query  278  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
            S C  T  G   L  ++R CP+L  L+L  ++ + D GL+     C   L K++L GC  
Sbjct  196  SSCRVTNLG---LGAIARGCPSLRVLSLWNVSSIADEGLIEIANGCHQ-LEKLDLCGCPT  251

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            ++DK + AIAK +   L  L +  C  + +A L A+  +C  L+ + I
Sbjct  252  ISDKALVAIAK-NCHNLTALTIESCPRIGNAGLQAVGQFCPNLKSISI  298



>gb|KJB82811.1| hypothetical protein B456_013G215000 [Gossypium raimondii]
Length=639

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 157/202 (78%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQLCL KC  LSD G+VSF K A S+ESLQLEECHRI+Q G FG L++   
Sbjct  364  AVGKGCPNLKQLCLHKCAFLSDKGLVSFAKTASSLESLQLEECHRITQFGFFGSLLNCGA  423

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA++  NC+G+KDL  G+P++ PC SLRSLSI NC GFGDASL  L +LCP L H+ L
Sbjct  424  KLKAISLVNCYGIKDLNLGLPSVLPCKSLRSLSIRNCPGFGDASLAALGKLCPQLQHVEL  483

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL+G++D GLLP +++ +A LVKVNLSGC+N++DK +  +A LHG TLE+LNL GC  +
Sbjct  484  SGLHGISDAGLLPLLETREADLVKVNLSGCVNLSDKAVCIMADLHGWTLEMLNLEGCK-I  542

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIA  C +L DLD+SK
Sbjct  543  SDASLVAIAKNCQLLSDLDVSK  564


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 90/180 (50%), Gaps = 3/180 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    D  + +  K    ++ ++L   H IS AG+  +L      L  +
Sbjct  449  CKSLRSLSIRNCPGFGDASLAALGKLCPQLQHVELSGLHGISDAGLLPLLETREADLVKV  508

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A  + A     +L  L++  C    DASLV +++ C  L  L++S    
Sbjct  509  NLSGCVNLSDKAVCIMADLHGWTLEMLNLEGCK-ISDASLVAIAKNCQLLSDLDVSKC-A  566

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD G+    +S    L  +++SGC  V+DK++ ++ KL G+TL  LNL  C  ++ +++
Sbjct  567  ITDSGIAALARSNQIKLQILSMSGCSKVSDKSMPSLRKL-GQTLLGLNLQQCKAISSSTV  625


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/253 (23%), Positives = 108/253 (43%), Gaps = 52/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+KGCPN+K L +  C  + + G+ +  +   +++++ +++C  I   G+  +L  ++ 
Sbjct  232  AVAKGCPNLKDLTIEGCANIENEGLQALARCCPNLKAISIKDCPLIGDQGIASMLSSASF  291

Query  182  -----KLKALAFENC-------FGMKDLAFGVPALPPCNS--------------LRSLSI  283
                 KL+AL   +        +G       + +LP  +               L+S ++
Sbjct  292  TLTKIKLQALNITDVSLAVIGHYGRAVTDLSLISLPNVSEKGFWVMGNGHGLQKLKSFAV  351

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D  L  + + CPNL  L L     ++D GL+ F ++                 
Sbjct  352  TSCRGVTDLGLEAVGKGCPNLKQLCLHKCAFLSDKGLVSFAKTASSLESLQLEECHRITQ  411

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C A L  ++L  C  + D  +   + L  ++L  L++  C    DASLAA+
Sbjct  412  FGFFGSLLNCGAKLKAISLVNCYGIKDLNLGLPSVLPCKSLRSLSIRNCPGFGDASLAAL  471

Query  566  ADYCSVLRDLDIS  604
               C  L+ +++S
Sbjct  472  GKLCPQLQHVELS  484


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 93/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S+GCP+++ L L   + + D G+         +E L L  C  I+   +  +      
Sbjct  180  AISRGCPSLRVLSLWDSSSVGDEGLFEIADGCHQLEKLDLCHCPAITDKSLLAV-AKGCP  238

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             LK L  E C  +++   G+ AL   C +L+++SI +C   GD  +  +LS     L  +
Sbjct  239  NLKDLTIEGCANIEN--EGLQALARCCPNLKAISIKDCPLIGDQGIASMLSSASFTLTKI  296

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  +      +  ++L    NV++K    +   HG + L+   +  C
Sbjct  297  KLQALN-ITDVS-LAVIGHYGRAVTDLSLISLPNVSEKGFWVMGNGHGLQKLKSFAVTSC  354

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+ L + K
Sbjct  355  RGVTDLGLEAVGKGCPNLKQLCLHK  379



>ref|XP_004138725.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004160764.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN62950.1| hypothetical protein Csa_2G381760 [Cucumis sativus]
Length=646

 Score =   254 bits (649),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ KGCPN+K+ CL KC+ LSDNG+VSFV+AA SIE+LQLEECHRI+Q G+FG +++   
Sbjct  370  SIGKGCPNLKKFCLHKCSFLSDNGMVSFVQAATSIENLQLEECHRITQLGLFGTILNCGA  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+  NC G+KDL+  +P+L  C SL+SLSI NC GFG+ASL +LS+LCP L H+  
Sbjct  430  KLKALSLVNCLGIKDLSLNLPSLSSCKSLQSLSIRNCPGFGNASLTLLSKLCPQLQHVEF  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGLN +TD GLLP   +C AGLVKVNLSGC+N+TDK IS++ KLHG TLELLNL+GC  V
Sbjct  490  SGLNAITDSGLLPLFMNCKAGLVKVNLSGCVNLTDKVISSLTKLHGWTLELLNLDGCLKV  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD+SL AIA+ C +L DLD+SK
Sbjct  550  TDSSLVAIAENCPLLNDLDVSK  571


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 95/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP +K + L   + + D G++   K  + +E L L +C  IS   +   L  +  
Sbjct  186  AVAHGCPGLKAISLWNLSSIGDEGLIEIAKGCQLLEKLDLSQCPGISNKALLE-LAKNCP  244

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVL-SRLCPNLVHL  355
             L  +  E C  + + +  V A+   C++L+S+SI +C   GD  +  L S     L   
Sbjct  245  NLTDITVEACANIGNES--VQAIGQYCSNLKSISIRDCPLIGDQGISSLFSSTSYTLNKA  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L GLN VTD   L  +      +  + L+G  NV+++   A+   HG + L    L+ C
Sbjct  303  KLQGLN-VTDVS-LAVIGHYGRAITDLTLTGLTNVSERGFWAMGNGHGLQKLRSFTLSSC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L +I   C  L+   + K
Sbjct  361  HGVTDVGLQSIGKGCPNLKKFCLHK  385


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/180 (23%), Positives = 85/180 (47%), Gaps = 2/180 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    +  +    K    ++ ++    + I+ +G+  + ++    L  +
Sbjct  455  CKSLQSLSIRNCPGFGNASLTLLSKLCPQLQHVEFSGLNAITDSGLLPLFMNCKAGLVKV  514

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D            +L  L++  C    D+SLV ++  CP L  L++S    
Sbjct  515  NLSGCVNLTDKVISSLTKLHGWTLELLNLDGCLKVTDSSLVAIAENCPLLNDLDVSKC-C  573

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD+G+    Q+    L  +++ GC  +TD+++ A+ KL G++L  LNL  C  ++  S+
Sbjct  574  ITDFGVAALAQANQFNLQLLSVYGCSALTDQSLLALVKL-GDSLLGLNLQHCNSISTRSI  632


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/229 (21%), Positives = 96/229 (42%), Gaps = 30/229 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVS-FVKAAESIESLQLEECHRISQAGVFGILVHSA  178
            A+ + C N+K + +R C L+ D G+ S F   + ++   +L+  +    +    ++ H  
Sbjct  264  AIGQYCSNLKSISIRDCPLIGDQGISSLFSSTSYTLNKAKLQGLNVTDVS--LAVIGHYG  321

Query  179  GKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
              +  L       + +  F           LRS ++ +C G  D  L  + + CPNL   
Sbjct  322  RAITDLTLTGLTNVSERGFWAMGNGHGLQKLRSFTLSSCHGVTDVGLQSIGKGCPNLKKF  381

Query  356  NLSGLNGVTDYGLLPFVQS--------------------------CDAGLVKVNLSGCIN  457
             L   + ++D G++ FVQ+                          C A L  ++L  C+ 
Sbjct  382  CLHKCSFLSDNGMVSFVQAATSIENLQLEECHRITQLGLFGTILNCGAKLKALSLVNCLG  441

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + D +++  +    ++L+ L++  C    +ASL  ++  C  L+ ++ S
Sbjct  442  IKDLSLNLPSLSSCKSLQSLSIRNCPGFGNASLTLLSKLCPQLQHVEFS  490



>ref|XP_011017769.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=655

 Score =   254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 162/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KG  N+KQ+CLRKC  +SDNG+V+F KAA S+ESLQLEEC+RISQ+G+ G   +   
Sbjct  379  AIAKGSVNLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRISQSGIVGAFSNCGA  438

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+   C G+KD+AFG+ A  PC+SLR LSI NC GFG AS+ ++ +LCP L H++L
Sbjct  439  KLKALSLVKCMGIKDMAFGMSASSPCSSLRYLSIRNCPGFGSASMAMIGKLCPQLQHVDL  498

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC+AGLVKVNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +
Sbjct  499  SGLCGITDAGLLPLLESCEAGLVKVNLSGCLSLTDEVVSALARLHGGTLELLNLDGCRKI  558

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ C  L DLD+SK
Sbjct  559  TDASLLAIAENCLFLSDLDVSK  580


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/230 (26%), Positives = 95/230 (41%), Gaps = 34/230 (15%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GCP+++ L L     + D G+    K   S+E L L  C  IS  G+  +   +   
Sbjct  196  IARGCPSLRALSLWNVPFVGDEGLFEIAKECHSLEKLDLTNCPSISNKGLVAV-AENCPN  254

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDA------------------  310
            L +L  E+C  + +          C  L+S+SI +C   GD                   
Sbjct  255  LSSLNIESCSKIGNEGLQTIG-KLCPRLQSISIKDCPLVGDHGVSSLLSSASSVLTRVKL  313

Query  311  --------SLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCIN  457
                    SL V+      + +L LSGL  V++ G   +V     GL K   + ++ C  
Sbjct  314  QALNITDFSLAVIGHYGKAVTNLALSGLQHVSEKGF--WVMGNAKGLQKLMSLTITSCRG  371

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            +TD ++ AIAK     L+ + L  C  V+D  L A A     L  L + +
Sbjct  372  ITDVSLEAIAK-GSVNLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEE  420


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 99/255 (39%), Gaps = 56/255 (22%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC-----------------  130
            AV++ CPN+  L +  C+ + + G+ +  K    ++S+ +++C                 
Sbjct  247  AVAENCPNLSSLNIESCSKIGNEGLQTIGKLCPRLQSISIKDCPLVGDHGVSSLLSSASS  306

Query  131  -----------------------------------HRISQAGVFGILVHSAG--KLKALA  199
                                                 +S+ G F ++ ++ G  KL +L 
Sbjct  307  VLTRVKLQALNITDFSLAVIGHYGKAVTNLALSGLQHVSEKG-FWVMGNAKGLQKLMSLT  365

Query  200  FENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV  379
              +C G+ D++    A    N L+ + +  C    D  LV  ++   +L  L L   N +
Sbjct  366  ITSCRGITDVSLEAIAKGSVN-LKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRI  424

Query  380  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  559
            +  G++    +C A L  ++L  C+ + D      A     +L  L++  C     AS+A
Sbjct  425  SQSGIVGAFSNCGAKLKALSLVKCMGIKDMAFGMSASSPCSSLRYLSIRNCPGFGSASMA  484

Query  560  AIADYCSVLRDLDIS  604
             I   C  L+ +D+S
Sbjct  485  MIGKLCPQLQHVDLS  499



>ref|XP_011036551.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCP++KQ CL KC  LSDNG+VSF KAAE +ESLQLEECHRI+  G FG L++   
Sbjct  370  AVGKGCPSLKQFCLHKCAFLSDNGLVSFAKAAEKLESLQLEECHRITLLGFFGSLLNCGA  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LKA++  NCFG++DL   +P L PCNSLRSLSI NC GFGD SL +L  LCP L ++ L
Sbjct  430  NLKAISLVNCFGIRDLKLDLPQLSPCNSLRSLSIRNCPGFGDGSLALLGNLCPQLRNVEL  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G L  +++C+AGLVKVNLSGCIN++DK +  + + HG TLE+LNL+GC  +
Sbjct  490  SGLQGITDAGFLSVLENCEAGLVKVNLSGCINLSDKVVGVMTEQHGWTLEMLNLDGCKRI  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ C +L DLD+SK
Sbjct  550  TDASLVAIAENCFLLYDLDVSK  571


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 92/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L     + D G+         +E L L +C  I+  G+  I   +  
Sbjct  186  AIARGCPSLKVLSLWNLPSVGDEGLSEIANGCHMLEKLDLSQCPAITDKGLLAI-AKNCI  244

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPN-LVHL  355
             L  L  E+C  + +   G+ A+   C +L+S+SI NC G GD  +  L     N L  L
Sbjct  245  NLTDLVLESCSNIGN--EGLQAVGQYCTNLKSISITNCPGVGDQGIAALVSSASNVLTKL  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  V      +  + L+   NV+++    +    G   L+ L +  C
Sbjct  303  KLQSLN-ITDVS-LAVVGHYGKAVTDLVLTSLPNVSERGFWVMGNGQGLHKLKSLTVTSC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  361  LGVTDIGLEAVGKGCPSLKQFCLHK  385


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 86/185 (46%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    D  +         + +++L     I+ AG   +L +    L  +
Sbjct  455  CNSLRSLSIRNCPGFGDGSLALLGNLCPQLRNVELSGLQGITDAGFLSVLENCEAGLVKV  514

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D   GV       +L  L++  C    DASLV ++  C  L  L++S    
Sbjct  515  NLSGCINLSDKVVGVMTEQHGWTLEMLNLDGCKRITDASLVAIAENCFLLYDLDVSKC-A  573

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
             TD G+    +S    L  +++SGC  ++DK++ A+ KL G+TL  LNL  C  ++ +++
Sbjct  574  TTDSGIAAMARSQQLCLQVLSVSGCSMISDKSLPALVKL-GQTLLGLNLQHCNAISSSTV  632

Query  557  AAIAD  571
              + +
Sbjct  633  DILVE  637



>ref|XP_011016246.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   254 bits (648),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCP++KQ CL KC  LSDNG+VSF KAAE +ESLQLEECHRI+  G FG L++   
Sbjct  370  AVGKGCPSLKQFCLHKCAFLSDNGLVSFAKAAEKLESLQLEECHRITLLGFFGSLLNCGA  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LKA++  NCFG++DL   +P L PCNSLRSLSI NC GFGD SL +L  LCP L ++ L
Sbjct  430  NLKAISLVNCFGIRDLKLDLPQLSPCNSLRSLSIRNCPGFGDGSLALLGNLCPQLRNVEL  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G L  +++C+AGLVKVNLSGCIN++DK +  + + HG TLE+LNL+GC  +
Sbjct  490  SGLQGITDAGFLSVLENCEAGLVKVNLSGCINLSDKVVGVMTEQHGWTLEMLNLDGCKRI  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ C +L DLD+SK
Sbjct  550  TDASLVAIAENCFLLYDLDVSK  571


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 92/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L     + D G+         +E L L +C  I+  G+  I   +  
Sbjct  186  AIARGCPSLKVLSLWNLPSVGDEGLSEIANGCHMLEKLDLSQCPAITDKGLLAI-AKNCI  244

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPN-LVHL  355
             L  L  E+C  + +   G+ A+   C +L+S+SI NC G GD  +  L     N L  L
Sbjct  245  NLTDLVLESCSNIGN--EGLQAVGQYCTNLKSISITNCPGVGDQGIAALVSSASNVLTKL  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  V      +  + L+   NV+++    +    G   L+ L +  C
Sbjct  303  KLQSLN-ITDVS-LAVVGHYGKAVTDLVLTSLPNVSERGFWVMGNGQGLHKLKSLTVTSC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  361  LGVTDIGLEAVGKGCPSLKQFCLHK  385


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 86/185 (46%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    D  +         + +++L     I+ AG   +L +    L  +
Sbjct  455  CNSLRSLSIRNCPGFGDGSLALLGNLCPQLRNVELSGLQGITDAGFLSVLENCEAGLVKV  514

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D   GV       +L  L++  C    DASLV ++  C  L  L++S    
Sbjct  515  NLSGCINLSDKVVGVMTEQHGWTLEMLNLDGCKRITDASLVAIAENCFLLYDLDVSKC-A  573

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
             TD G+    +S    L  +++SGC  ++DK++ A+ KL G+TL  LNL  C  ++ +++
Sbjct  574  TTDSGIAAMARSQQLCLQVLSVSGCSMISDKSLPALVKL-GQTLLGLNLQHCNAISSSTV  632

Query  557  AAIAD  571
              + +
Sbjct  633  DILVE  637



>gb|KHG15742.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=651

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 155/202 (77%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQLCL KC  LSD G+ S  KAA S+E LQLEECHRI+Q G F  L++   
Sbjct  376  AVGKGCPNLKQLCLSKCPFLSDKGLSSLAKAASSLECLQLEECHRITQFGFFCSLINCGA  435

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK ++F NC G+KDL  G+P L PC SLRSLSI NC GFGDASL  L +LCP+L H+ L
Sbjct  436  KLKVISFANCLGIKDLNSGLPPLSPCESLRSLSIHNCPGFGDASLFALGKLCPHLQHVEL  495

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL+G+TD G+LP ++SC+AGL+KVNLSGC+N++DK +  I+ LHG TLELLNLNGC  +
Sbjct  496  CGLHGITDAGVLPLLESCEAGLLKVNLSGCVNLSDKVVQTISNLHGWTLELLNLNGCK-I  554

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AI + C +L DLDISK
Sbjct  555  SDASLVAIGENCQLLTDLDISK  576



>ref|XP_008365191.1| PREDICTED: EIN3-binding F-box protein 1-like isoform X2 [Malus 
domestica]
Length=694

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ CL KC  +SD+G+VSF KAA S+ESL LEECHRI+Q G+FG+L     
Sbjct  418  AVGKGCPNLKQFCLXKCLFVSDSGLVSFCKAAGSLESLHLEECHRITQFGLFGVLSTGGS  477

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LAF +C G+KDL FG P + PC SL SLSI +C GFG+  L +L +LCP L H++ 
Sbjct  478  KLKSLAFVSCLGLKDLNFGSPGVSPCQSLXSLSIRSCPGFGNVGLALLGKLCPQLQHVDF  537

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD G LP V++C+AGLVKVNLSGC+N+TDK +S++A LHG T+E+LNL GC  V
Sbjct  538  SGLESITDVGFLPLVENCEAGLVKVNLSGCVNLTDKVVSSMADLHGWTMEVLNLEGCRLV  597

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA LAAIA  C++L DLD+S+
Sbjct  598  SDAGLAAIAGNCTLLSDLDVSR  619


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 92/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+         +E L L  C  IS  G+  I      
Sbjct  234  AISHGCPSLRVLSLWNMSSIGDEGLCEIANRCXLLEKLDLSRCPAISDKGLIAI-AKKCP  292

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  ++ E+C  + +   G+ A+   C +L+S+SI NC   GD  +  +LS +   L  +
Sbjct  293  NLTDVSLESCSNIGNE--GLQAIGQCCPNLKSISIKNCHLVGDQGIXSLLSSISYVLTKV  350

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  ++D  L       +A +  + L+   NVT++    +    G + L+   +  C
Sbjct  351  KLQALT-ISDVSLAVIGHYGNA-VTDLVLTSLSNVTERGFWVMGNGQGLQKLKSFTVTSC  408

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  409  QGVTDTGLEAVGKGCPNLKQFCLXK  433



>ref|XP_003544614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN13750.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=644

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+K   L KC  LSDNG++SF KAA S+ESL+LEECHRI+Q G FG+L +   
Sbjct  368  AVGKGCPNLKIAHLHKCAFLSDNGLISFAKAASSLESLRLEECHRITQLGFFGVLFNCGA  427

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA++  +C+G+KDL   +P + PC SLRSLSI NC GFG+ASL VL +LCP L H+ L
Sbjct  428  KLKAISLVSCYGIKDLNLVLPTVSPCESLRSLSISNCPGFGNASLSVLGKLCPQLQHVEL  487

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD GLLP ++S +AGLVKVNLSGC NVT+K +S++A LHG TLE LNL+GC  +
Sbjct  488  SGLEGVTDAGLLPLLESSEAGLVKVNLSGCTNVTNKVVSSLANLHGWTLENLNLDGCKNI  547

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIA+ C++L DLD+SK
Sbjct  548  SDASLMAIAENCALLCDLDVSK  569


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 98/228 (43%), Gaps = 28/228 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI-----L  166
            A++K C N+ +L L  C  + + G+++  K   ++  + +++C  +S  G+ G+     L
Sbjct  236  AIAKNCQNLTELSLESCPNIGNEGLLAIGKLCSNLRFISIKDCSGVSDQGIAGLFSSTSL  295

Query  167  VHSAGKLKALAFENC-------FGMKDLAFGVPALPPCNS--------------LRSLSI  283
              +  KL+AL   +        +G       +  LP  +               L+SL++
Sbjct  296  FLTKVKLQALTVSDLSLAVIGHYGKSVTDLVLNCLPNVSERGFWVMGNGNGLQKLKSLTV  355

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
             +C G  D  L  + + CPNL   +L     ++D GL+ F ++  + L  + L  C  +T
Sbjct  356  ASCRGVTDIGLEAVGKGCPNLKIAHLHKCAFLSDNGLISFAKAASS-LESLRLEECHRIT  414

Query  464  DKTISAIAKLHGETLELLNLNGCGCVTDASLA-AIADYCSVLRDLDIS  604
                  +    G  L+ ++L  C  + D +L       C  LR L IS
Sbjct  415  QLGFFGVLFNCGAKLKAISLVSCYGIKDLNLVLPTVSPCESLRSLSIS  462


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/209 (26%), Positives = 96/209 (46%), Gaps = 18/209 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GC  +++L L KC  ++D  +V+  K  +++  L LE C  I   G+  I     GK
Sbjct  211  IANGCHQLEKLDLCKCPAITDKALVAIAKNCQNLTELSLESCPNIGNEGLLAI-----GK  265

Query  185  ----LKALAFENCFGMKDLAFGVPALPPCNSLRSLSI-CNCTGFGDASLVVLSRLCPNLV  349
                L+ ++ ++C G+ D   G+  L    SL    +        D SL V+     ++ 
Sbjct  266  LCSNLRFISIKDCSGVSDQ--GIAGLFSSTSLFLTKVKLQALTVSDLSLAVIGHYGKSVT  323

Query  350  HLNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAKLHGETLELLN  520
             L L+ L  V++ G   +V     GL K+    ++ C  VTD  + A+ K     L++ +
Sbjct  324  DLVLNCLPNVSERGF--WVMGNGNGLQKLKSLTVASCRGVTDIGLEAVGK-GCPNLKIAH  380

Query  521  LNGCGCVTDASLAAIADYCSVLRDLDISK  607
            L+ C  ++D  L + A   S L  L + +
Sbjct  381  LHKCAFLSDNGLISFAKAASSLESLRLEE  409



>ref|XP_003588766.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES59017.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=643

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 157/201 (78%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+K + L KC  LSDNG++SF KAA S+ESLQLEECHRI+Q G FG+L +   
Sbjct  367  AVGKGCPNLKSVHLHKCAFLSDNGLISFTKAAISLESLQLEECHRITQFGFFGVLFNCGA  426

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+  +CFG+KDL   +  + PC SLRSLSICNC GFG+A+L VL +LCP L  + L
Sbjct  427  KLKALSMISCFGIKDLDLELSPVSPCESLRSLSICNCPGFGNATLSVLGKLCPQLQQVEL  486

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL GVTD GLLP ++S +AGLVKVNLSGC+N+TDK +S++  LHG TLE+LNL GC  +
Sbjct  487  TGLKGVTDAGLLPLLESSEAGLVKVNLSGCVNLTDKVVSSLVNLHGWTLEILNLEGCINI  546

Query  542  TDASLAAIADYCSVLRDLDIS  604
            ++ASLAAIA++C +L DLD S
Sbjct  547  SNASLAAIAEHCQLLCDLDFS  567


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/227 (24%), Positives = 99/227 (44%), Gaps = 28/227 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI-----L  166
             V+K CPN+ +L L  C  + + G+ +  K   +++++ +++C  +   G+ G+     L
Sbjct  235  TVAKKCPNLTELSLESCPSIRNEGLQAIGKFCPNLKAISIKDCAGVGDQGIAGLFSSTSL  294

Query  167  VHSAGKLKALAFENC-------FGMKDLAFGVPALPPC--------------NSLRSLSI  283
            V +  KL+ALA  +        +G       +  LP                + L+SL+I
Sbjct  295  VLTKVKLQALAVSDLSLAVIGHYGKTVTDLVLNFLPNVSERGFWVMGNANGLHKLKSLTI  354

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
             +C G  D  +  + + CPNL  ++L     ++D GL+ F ++    L  + L  C  +T
Sbjct  355  ASCRGVTDVGIEAVGKGCPNLKSVHLHKCAFLSDNGLISFTKAA-ISLESLQLEECHRIT  413

Query  464  DKTISAIAKLHGETLELLNLNGCGCVTDASLA-AIADYCSVLRDLDI  601
                  +    G  L+ L++  C  + D  L  +    C  LR L I
Sbjct  414  QFGFFGVLFNCGAKLKALSMISCFGIKDLDLELSPVSPCESLRSLSI  460


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 94/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP++K   L   + + D G++      + +E L L +C  IS   +  +      
Sbjct  183  AVASGCPSLKSFSLWNVSSVGDEGLIEIANGCQKLEKLDLCKCPAISDKALITV-AKKCP  241

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  L+ E+C  +++   G+ A+   C +L+++SI +C G GD  +  + S     L  +
Sbjct  242  NLTELSLESCPSIRN--EGLQAIGKFCPNLKAISIKDCAGVGDQGIAGLFSSTSLVLTKV  299

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  V+D   L  +      +  + L+   NV+++    +   +G   L+ L +  C
Sbjct  300  KLQAL-AVSDLS-LAVIGHYGKTVTDLVLNFLPNVSERGFWVMGNANGLHKLKSLTIASC  357

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  + A+   C  L+ + + K
Sbjct  358  RGVTDVGIEAVGKGCPNLKSVHLHK  382



>ref|XP_002308665.2| grr1 family protein [Populus trichocarpa]
 gb|EEE92188.2| grr1 family protein [Populus trichocarpa]
Length=646

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ  L KC+ LSDNG+VSF K+A S+ESL LEECHRI+Q G FG L++   
Sbjct  370  AVGKGCPNLKQFNLHKCSFLSDNGLVSFAKSAVSLESLLLEECHRITQFGFFGSLLNCGA  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LKA +  NCFG+KDL   +P L PC SLRSLSI NC GFGD SL +L +LCP L ++ L
Sbjct  430  NLKAASLVNCFGIKDLKLDLPELSPCKSLRSLSIRNCPGFGDGSLALLGKLCPQLQNVEL  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD G LP +++C+AGLVKVNLSGC+N++DK +S + + HG TLE+LNL+GC  +
Sbjct  490  SGLQGVTDAGFLPVLENCEAGLVKVNLSGCVNLSDKVVSVMTEQHGWTLEVLNLDGCRRI  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ C +L DLD+SK
Sbjct  550  TDASLVAIAENCFLLSDLDVSK  571


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 93/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L     + D G+         +E L L +C  I+  G+  I   S  
Sbjct  186  AIARGCPSLKVLSLWNLPSVGDEGLSEIANGCHKLEKLDLSQCPAITDKGLLAI-AKSCP  244

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPN-LVHL  355
             L  L  E+C  + +   G+ A+   C +L+S+SI NC   GD  +  L     N L  +
Sbjct  245  NLTDLVIESCTNIGN--EGLQAVGQHCTNLKSISIKNCPAIGDQGIAALVSSATNVLTKV  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  V      +  + L+   NV+++    +    G + L+ + +  C
Sbjct  303  KLQALN-ITDVS-LAVVGHYGKAVTDLFLTSLSNVSERGFWVMGNGQGLQKLKSMTVASC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              +TD  L A+   C  L+  ++ K
Sbjct  361  VGLTDTGLEAVGKGCPNLKQFNLHK  385


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 86/185 (46%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    D  +    K    +++++L     ++ AG   +L +    L  +
Sbjct  455  CKSLRSLSIRNCPGFGDGSLALLGKLCPQLQNVELSGLQGVTDAGFLPVLENCEAGLVKV  514

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D    V       +L  L++  C    DASLV ++  C  L  L++S    
Sbjct  515  NLSGCVNLSDKVVSVMTEQHGWTLEVLNLDGCRRITDASLVAIAENCFLLSDLDVSKC-A  573

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
             TD G+    +S    L  +++SGC  ++DK++ A+ KL G TL  LNL  C  ++ +++
Sbjct  574  TTDSGIAAMARSNQLNLQVLSMSGCSMISDKSLLALIKL-GRTLLGLNLQHCNAISSSTV  632

Query  557  AAIAD  571
              + +
Sbjct  633  DVLVE  637


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 94/228 (41%), Gaps = 28/228 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV + C N+K + ++ C  + D G+ + V +A ++ +    +   I+   +  ++ H   
Sbjct  264  AVGQHCTNLKSISIKNCPAIGDQGIAALVSSATNVLTKVKLQALNITDVSL-AVVGHYGK  322

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  L   +   + +  F V         L+S+++ +C G  D  L  + + CPNL   N
Sbjct  323  AVTDLFLTSLSNVSERGFWVMGNGQGLQKLKSMTVASCVGLTDTGLEAVGKGCPNLKQFN  382

Query  359  LSGLNGVTDYGLLPFVQS--------------------------CDAGLVKVNLSGCINV  460
            L   + ++D GL+ F +S                          C A L   +L  C  +
Sbjct  383  LHKCSFLSDNGLVSFAKSAVSLESLLLEECHRITQFGFFGSLLNCGANLKAASLVNCFGI  442

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             D  +        ++L  L++  C    D SLA +   C  L+++++S
Sbjct  443  KDLKLDLPELSPCKSLRSLSIRNCPGFGDGSLALLGKLCPQLQNVELS  490



>gb|KHG28503.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=652

 Score =   251 bits (642),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+KQ CLRKC  LSDNG+VSF KAA S+ESL+LEECH ++Q G FG L++   
Sbjct  377  AIGKGCPNLKQFCLRKCAFLSDNGLVSFAKAAGSLESLELEECHWVTQFGFFGSLINCGA  436

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K K+++  NC G+KDL  G+P LPPC SLRSLSI NC GFGDASL  L +LCP L ++ L
Sbjct  437  KFKSISLVNCLGIKDLNVGLPPLPPCESLRSLSIRNCQGFGDASLAALGKLCPQLQNVEL  496

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL+G+T  G  P ++SC+AGLVKVNLSGC N+ +K +  +A LHG TLE+LNL+GC  +
Sbjct  497  SGLHGITHVGFFPLLESCEAGLVKVNLSGCPNLGNKVVCKMADLHGWTLEMLNLDGCK-I  555

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DA L AIA+ C +L DLD+SK
Sbjct  556  SDAGLVAIAENCQLLSDLDVSK  577


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 102/253 (40%), Gaps = 52/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILV---H  172
            A++KGCP++  L +  C  + + G+ +  +   +++S+ +++C  +   G+  +L    +
Sbjct  245  ALAKGCPDLTDLTIEGCANIGNEGIQAIARCCPNLKSVSIKDCALLGDQGIASLLTSTSY  304

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPC--------------NSLRSLSI  283
            S  KLK         +LA    +G       + +LP                  L+S ++
Sbjct  305  SLSKLKLQALNITDVSLAVIGHYGKAVTGLSLTSLPNVTEKGFWVMGNGHGLQKLKSFTV  364

Query  284  CNCTGFGDASLVVLSRLCPNLVH--------------------------LNLSGLNGVTD  385
              C G  D  L  + + CPNL                            L L   + VT 
Sbjct  365  KACCGVTDLGLEAIGKGCPNLKQFCLRKCAFLSDNGLVSFAKAAGSLESLELEECHWVTQ  424

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G    + +C A    ++L  C+ + D  +        E+L  L++  C    DASLAA+
Sbjct  425  FGFFGSLINCGAKFKSISLVNCLGIKDLNVGLPPLPPCESLRSLSIRNCQGFGDASLAAL  484

Query  566  ADYCSVLRDLDIS  604
               C  L+++++S
Sbjct  485  GKLCPQLQNVELS  497


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 93/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S+GCP+++ L L     + D+G+    +    ++ L L  C  I+   +   L     
Sbjct  193  AISRGCPSLRVLSLWNLATVGDDGLCEIAEGCHQLQKLDLCHCPAITNESLLA-LAKGCP  251

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  L  E C  + +   G+ A+   C +L+S+SI +C   GD  +  +L+    +L  L
Sbjct  252  DLTDLTIEGCANIGN--EGIQAIARCCPNLKSVSIKDCALLGDQGIASLLTSTSYSLSKL  309

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  +      +  ++L+   NVT+K    +   HG + L+   +  C
Sbjct  310  KLQALN-ITDVS-LAVIGHYGKAVTGLSLTSLPNVTEKGFWVMGNGHGLQKLKSFTVKAC  367

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L AI   C  L+   + K
Sbjct  368  CGVTDLGLEAIGKGCPNLKQFCLRK  392



>ref|XP_002308982.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
 gb|EEE92505.2| hypothetical protein POPTR_0006s06770g [Populus trichocarpa]
Length=656

 Score =   251 bits (642),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KG  N+KQ+CLRKC  +SDNG+V+F KAA S+ESLQLEEC+RI+Q+G+ G L +   
Sbjct  380  AIAKGSLNLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRITQSGIVGALSNCGT  439

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+   C G+KD+A G+P   PC+ LR LSI NC GFG ASL V+ +LCP L H++L
Sbjct  440  KLKALSLVKCMGIKDMALGMPVPSPCSYLRYLSIRNCPGFGSASLAVVGKLCPQLQHVDL  499

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+LP ++SC+AGLVKVNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +
Sbjct  500  SGLCGITDSGILPLLESCEAGLVKVNLSGCMSLTDEVVSALARLHGGTLELLNLDGCRKI  559

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ C  L DLD+SK
Sbjct  560  TDASLVAIAENCLFLSDLDLSK  581


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 98/232 (42%), Gaps = 36/232 (16%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L     + D G+    K    +E L L  C  IS  G+  I   +  
Sbjct  196  AIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLSNCPSISNKGLIAI-AENCP  254

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDA----------------  310
             L +L  E+C  + +   G+ A+   C  L S+SI +C   GD                 
Sbjct  255  NLSSLNIESCSKIGN--EGLQAIGKLCPRLHSISIKDCPLLGDHGVSSLLSSASSVLTRV  312

Query  311  ----------SLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV---NLSGC  451
                      SL V+      + +L+LS L  V++ G   +V     GL K+    ++ C
Sbjct  313  KLQGLNITDFSLAVIGHYGKAVTNLSLSVLQHVSERGF--WVMGNAQGLQKLMSLTITSC  370

Query  452  INVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
              +TD ++ AIAK     L+ + L  C  V+D  L A A     L  L + +
Sbjct  371  RGITDVSLEAIAK-GSLNLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEE  421



>ref|XP_006364926.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=669

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 160/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+K  CLRKCT+LSDNG+V+F K + ++E+LQLEECHRI+QAG  G+L+    
Sbjct  393  ALGKGCPNLKLFCLRKCTILSDNGLVAFAKGSVALENLQLEECHRITQAGFVGVLLSCGK  452

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L+  NCFG+K+LA   P++ PCNSL+SLSI NC G G+A+L ++ RLCP L HL L
Sbjct  453  KLKVLSMVNCFGVKELACRFPSVLPCNSLQSLSIRNCPGVGNATLAIVGRLCPKLTHLEL  512

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GL P VQSC+AGLVKVNLSGC+NVTD+++S I +LHG +LE LN++ C  V
Sbjct  513  SGLLEVTDEGLFPLVQSCEAGLVKVNLSGCVNVTDRSVSFITELHGGSLESLNVDECPYV  572

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDA+L AI++ C +L++LDISK
Sbjct  573  TDATLLAISNNCWLLKELDISK  594


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 71/162 (44%), Gaps = 29/162 (18%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + +SD G++   +    +E L L +C  I+   +  I  +   
Sbjct  209  AIARGCPSLRALSLWNVSSVSDEGLIEIAQGCHLLEKLDLCQCPAITDMSLMAIAKN---  265

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L SL+I +C+  G+ +L  + R CP L  ++L
Sbjct  266  -------------------------CPNLTSLTIESCSKIGNETLQAVGRFCPKLKFVSL  300

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA  487
                 + D G+     S    L KV L   +N++D +++ I 
Sbjct  301  KNCPLIGDQGIASLFSSAGNVLTKVKLYA-LNISDISLAVIG  341


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 82/176 (47%), Gaps = 2/176 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C  + +  +    +    +  L+L     ++  G+F ++      L  +
Sbjct  478  CNSLQSLSIRNCPGVGNATLAIVGRLCPKLTHLELSGLLEVTDEGLFPLVQSCEAGLVKV  537

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D +          SL SL++  C    DA+L+ +S  C  L  L++S   G
Sbjct  538  NLSGCVNVTDRSVSFITELHGGSLESLNVDECPYVTDATLLAISNNCWLLKELDISKC-G  596

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            +TD G+     +    L  ++LSGC  ++DK++  + KL G+TL  LN+  C  V+
Sbjct  597  ITDSGIASLASTVRLNLQILSLSGCSMLSDKSVPFLQKL-GQTLVGLNIQHCNGVS  651


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = +2

Query  296  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI  475
            G  D  L  ++R CP+L  L+L  ++ V+D GL+   Q C   L K++L  C  +TD ++
Sbjct  201  GVTDTGLKAIARGCPSLRALSLWNVSSVSDEGLIEIAQGCHL-LEKLDLCQCPAITDMSL  259

Query  476  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLR  589
             AIAK +   L  L +  C  + + +L A+  +C  L+
Sbjct  260  MAIAK-NCPNLTSLTIESCSKIGNETLQAVGRFCPKLK  296



>ref|XP_011039690.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=646

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ  L KC+ LSDNG+VSF K+A S+ESL LEECHRI+Q G FG L++   
Sbjct  370  AVGKGCPNLKQFYLHKCSFLSDNGLVSFAKSAVSLESLLLEECHRITQFGFFGSLLNCGA  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LKA +  NCFGMKD+   +P L P NSLRS+SI NC GFGD SL +L +LCP L ++ L
Sbjct  430  NLKAASLVNCFGMKDVKLDLPDLSPRNSLRSVSIRNCPGFGDGSLALLGKLCPQLQNVEL  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD G LP +++C+AGLVKVNLSGC+N++DK +S + + HG TLE+LNL+GC  +
Sbjct  490  SGLQGVTDAGFLPVLENCEAGLVKVNLSGCVNLSDKVVSVMTEQHGWTLEVLNLDGCRRI  549

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ C +L DLD+SK
Sbjct  550  TDASLVAIAENCFLLSDLDVSK  571


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 92/205 (45%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L     + D GV         +E L L +C  I+  G+  I   S  
Sbjct  186  AIARGCPSLKVLSLWNLPSVGDEGVSEIANGCHKLEKLDLSQCPAITDKGLLAI-AKSCP  244

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPN-LVHL  355
             L  L  E+C  + +   G+ A+   C +L+S+SI NC   GD  +  L     N L  +
Sbjct  245  NLTDLVIESCTNIGN--EGLQAVGQHCTNLQSISIKNCPAIGDQGIAALVSSATNVLTKV  302

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  V      +  + L+   NV+++    +    G + L+ + +  C
Sbjct  303  KLQALN-ITDVS-LAVVGHYGKAVTDLFLTNLSNVSERGFWVMGNGQGLQKLKSMTVASC  360

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              +TD  L A+   C  L+   + K
Sbjct  361  VGLTDTGLEAVGKGCPNLKQFYLHK  385


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/253 (19%), Positives = 95/253 (38%), Gaps = 52/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A++K CPN+  L +  CT + + G+ +  +   +++S+ ++ C  I   G+         
Sbjct  238  AIAKSCPNLTDLVIESCTNIGNEGLQAVGQHCTNLQSISIKNCPAIGDQGIAALVSSATN  297

Query  155  ----------------FGILVHSAGKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSI  283
                              ++ H    +  L   N   + +  F V         L+S+++
Sbjct  298  VLTKVKLQALNITDVSLAVVGHYGKAVTDLFLTNLSNVSERGFWVMGNGQGLQKLKSMTV  357

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D  L  + + CPNL    L   + ++D GL+ F +S                 
Sbjct  358  ASCVGLTDTGLEAVGKGCPNLKQFYLHKCSFLSDNGLVSFAKSAVSLESLLLEECHRITQ  417

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C A L   +L  C  + D  +         +L  +++  C    D SLA +
Sbjct  418  FGFFGSLLNCGANLKAASLVNCFGMKDVKLDLPDLSPRNSLRSVSIRNCPGFGDGSLALL  477

Query  566  ADYCSVLRDLDIS  604
               C  L+++++S
Sbjct  478  GKLCPQLQNVELS  490



>ref|XP_002325221.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
 gb|EEF03786.1| hypothetical protein POPTR_0018s13070g [Populus trichocarpa]
Length=632

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KG  N+KQ+CLRKC  +SDNG+V+F KAA S+ESLQLEEC+R+SQ+G+ G L +   
Sbjct  356  AIAKGSVNLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRVSQSGIVGSLSNCGA  415

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+   C G+KD+AF +    PC+SLR LSI NC GFG AS+ ++ +LCP L H++L
Sbjct  416  KLKALSLVKCMGIKDMAFRMSVSSPCSSLRYLSIRNCPGFGSASMAMIGKLCPQLQHVDL  475

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC+AGLVKVNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +
Sbjct  476  SGLCGITDAGLLPLLESCEAGLVKVNLSGCLSLTDEVVSALARLHGGTLELLNLDGCRKI  535

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ C  L DLD+SK
Sbjct  536  TDASLLAIAENCLFLSDLDVSK  557


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/190 (24%), Positives = 84/190 (44%), Gaps = 30/190 (16%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
             +++GCP+++ L L     + D G+    K    +E L L  C  IS  G+  +      
Sbjct  172  TIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLTNCPSISNKGLIAV------  225

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                   ENC                 +L SL+I +C+  G+  L  + +LCP L  +++
Sbjct  226  ------AENC----------------PNLSSLNIESCSKIGNEGLQTIGKLCPKLQSISI  263

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 V D+G+   + S  + L +V L   +N+TD +++ I   +G+ +  L L+G   V
Sbjct  264  KDCPLVGDHGVSSLLSSASSVLTRVKLQA-LNITDFSLAVIGH-YGKAVTNLALSGLQHV  321

Query  542  TDASLAAIAD  571
            ++     + +
Sbjct  322  SEKGFWVMGN  331


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 99/255 (39%), Gaps = 56/255 (22%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEEC-----------------  130
            AV++ CPN+  L +  C+ + + G+ +  K    ++S+ +++C                 
Sbjct  224  AVAENCPNLSSLNIESCSKIGNEGLQTIGKLCPKLQSISIKDCPLVGDHGVSSLLSSASS  283

Query  131  -----------------------------------HRISQAGVFGILVHSAG--KLKALA  199
                                                 +S+ G F ++ ++ G  KL +L 
Sbjct  284  VLTRVKLQALNITDFSLAVIGHYGKAVTNLALSGLQHVSEKG-FWVMGNAKGLQKLMSLT  342

Query  200  FENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV  379
              +C G+ D++    A    N L+ + +  C    D  LV  ++   +L  L L   N V
Sbjct  343  ITSCRGITDVSLEAIAKGSVN-LKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRV  401

Query  380  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  559
            +  G++  + +C A L  ++L  C+ + D            +L  L++  C     AS+A
Sbjct  402  SQSGIVGSLSNCGAKLKALSLVKCMGIKDMAFRMSVSSPCSSLRYLSIRNCPGFGSASMA  461

Query  560  AIADYCSVLRDLDIS  604
             I   C  L+ +D+S
Sbjct  462  MIGKLCPQLQHVDLS  476



>ref|XP_011020134.1| PREDICTED: EIN3-binding F-box protein 1-like [Populus euphratica]
Length=656

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KG  N+KQ+CLRKC  +SDNG+++F KAA S+ESLQLEEC+RI+Q+G+ G L +   
Sbjct  380  AIAKGSLNLKQMCLRKCCFVSDNGLIAFAKAAGSLESLQLEECNRITQSGIVGALSNCGT  439

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+   C G+KD++ G+P   PC+ LR LSI NC GFG ASL V+ +LCP L H++L
Sbjct  440  KLKALSLVKCMGIKDMSLGMPVPSPCSYLRYLSIRNCPGFGSASLAVVGKLCPQLQHVDL  499

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+LP ++SC+AGLVKVNLSGC+++TD+ +SA+A+LHG TLELLNL+GC  +
Sbjct  500  SGLCGITDSGILPLLESCEAGLVKVNLSGCMSLTDEVVSALARLHGGTLELLNLDGCRKI  559

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ C  L DLD+SK
Sbjct  560  TDASLVAIAENCLFLSDLDLSK  581


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 90/192 (47%), Gaps = 8/192 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L     + D G+    K    +E L L  C  IS  G+  I   +  
Sbjct  196  AIARGCPSLRALSLWNVPFVGDEGLFEIAKECHLLEKLDLANCPSISNKGLIAI-AENCP  254

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C  L S+SI +C   GD     +LS     L  +
Sbjct  255  NLSSLNIESCSKIGN--EGLQAIGKLCPRLYSISIKDCPLLGDHGVSSLLSSASSVLTRV  312

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L GLN +TD+ L   +      +  ++LS   +V+++    +    G + L  L +  C
Sbjct  313  KLQGLN-ITDFSL-AVIGHYGKAVTNLSLSVLQHVSERGFWVMGNAQGLQKLMSLTITSC  370

Query  533  GCVTDASLAAIA  568
              +TD SL AIA
Sbjct  371  RGITDVSLEAIA  382



>gb|KJB65824.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=651

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQLCL KC  LSD G+ S  KAA S+E LQLEECHRISQ G F  L++   
Sbjct  376  AVGKGCPNLKQLCLSKCPFLSDKGLASLAKAAGSLECLQLEECHRISQFGFFCSLINCGA  435

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK ++F NC G+KDL  G+P L PC SLRSLSI NC GFGDASL  L +LCP L H+ L
Sbjct  436  KLKVISFANCLGIKDLNSGLPPLSPCESLRSLSIHNCPGFGDASLFALGKLCPQLQHVEL  495

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL+G+TD G+L  ++SC+AGL+KVNLSGC+N++DK +  I+ LHG TLELLNL+GC  +
Sbjct  496  CGLHGITDAGVLLLLESCEAGLLKVNLSGCVNLSDKVVQTISNLHGWTLELLNLDGCK-I  554

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIA+ C +L DLDISK
Sbjct  555  SDASLVAIAENCQLLTDLDISK  576


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 91/204 (45%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S+GCP+++ L L   + + D G+         +E L L  C  I+   +  +      
Sbjct  192  AISRGCPSLRVLSLWNLSSVGDEGLCEIANGCHQLEKLDLCHCPSITDKSLLAV-AKGCP  250

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASL-VVLSRLCPNLVHLN  358
             L  L  E C  + +      A   C +L+S+SI +C   GD  +  +LS    +L  + 
Sbjct  251  NLTDLTIEGCANIGNEGLQAIAR-SCPNLKSVSIKDCPLVGDQGVASLLSSALYSLTKVK  309

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN +TD   L  +      +  ++L+   NVT+K    +   HG + L+   +  C 
Sbjct  310  LQALN-ITDVS-LAVIGHYGKAVTDLSLTSLPNVTEKGFWVMGNGHGLQKLKSFTVTSCR  367

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
              TD+ L A+   C  L+ L +SK
Sbjct  368  GATDSGLEAVGKGCPNLKQLCLSK  391


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 54/252 (21%), Positives = 103/252 (41%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+KGCPN+  L +  C  + + G+ +  ++  +++S+ +++C  +   GV  +L  +  
Sbjct  244  AVAKGCPNLTDLTIEGCANIGNEGLQAIARSCPNLKSVSIKDCPLVGDQGVASLLSSALY  303

Query  182  -----KLKALAFENC-------FGMKDLAFGVPALPPC--------------NSLRSLSI  283
                 KL+AL   +        +G       + +LP                  L+S ++
Sbjct  304  SLTKVKLQALNITDVSLAVIGHYGKAVTDLSLTSLPNVTEKGFWVMGNGHGLQKLKSFTV  363

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D+ L  + + CPNL  L LS    ++D GL    ++                 
Sbjct  364  TSCRGATDSGLEAVGKGCPNLKQLCLSKCPFLSDKGLASLAKAAGSLECLQLEECHRISQ  423

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C A L  ++ + C+ + D           E+L  L+++ C    DASL A+
Sbjct  424  FGFFCSLINCGAKLKVISFANCLGIKDLNSGLPPLSPCESLRSLSIHNCPGFGDASLFAL  483

Query  566  ADYCSVLRDLDI  601
               C  L+ +++
Sbjct  484  GKLCPQLQHVEL  495



>gb|KJB65823.1| hypothetical protein B456_010G114900 [Gossypium raimondii]
Length=672

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 154/202 (76%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQLCL KC  LSD G+ S  KAA S+E LQLEECHRISQ G F  L++   
Sbjct  376  AVGKGCPNLKQLCLSKCPFLSDKGLASLAKAAGSLECLQLEECHRISQFGFFCSLINCGA  435

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK ++F NC G+KDL  G+P L PC SLRSLSI NC GFGDASL  L +LCP L H+ L
Sbjct  436  KLKVISFANCLGIKDLNSGLPPLSPCESLRSLSIHNCPGFGDASLFALGKLCPQLQHVEL  495

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL+G+TD G+L  ++SC+AGL+KVNLSGC+N++DK +  I+ LHG TLELLNL+GC  +
Sbjct  496  CGLHGITDAGVLLLLESCEAGLLKVNLSGCVNLSDKVVQTISNLHGWTLELLNLDGCK-I  554

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIA+ C +L DLDISK
Sbjct  555  SDASLVAIAENCQLLTDLDISK  576


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 91/204 (45%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S+GCP+++ L L   + + D G+         +E L L  C  I+   +  +      
Sbjct  192  AISRGCPSLRVLSLWNLSSVGDEGLCEIANGCHQLEKLDLCHCPSITDKSLLAV-AKGCP  250

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASL-VVLSRLCPNLVHLN  358
             L  L  E C  + +      A   C +L+S+SI +C   GD  +  +LS    +L  + 
Sbjct  251  NLTDLTIEGCANIGNEGLQAIAR-SCPNLKSVSIKDCPLVGDQGVASLLSSALYSLTKVK  309

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN +TD   L  +      +  ++L+   NVT+K    +   HG + L+   +  C 
Sbjct  310  LQALN-ITDVS-LAVIGHYGKAVTDLSLTSLPNVTEKGFWVMGNGHGLQKLKSFTVTSCR  367

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
              TD+ L A+   C  L+ L +SK
Sbjct  368  GATDSGLEAVGKGCPNLKQLCLSK  391


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 54/252 (21%), Positives = 103/252 (41%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+KGCPN+  L +  C  + + G+ +  ++  +++S+ +++C  +   GV  +L  +  
Sbjct  244  AVAKGCPNLTDLTIEGCANIGNEGLQAIARSCPNLKSVSIKDCPLVGDQGVASLLSSALY  303

Query  182  -----KLKALAFENC-------FGMKDLAFGVPALPPC--------------NSLRSLSI  283
                 KL+AL   +        +G       + +LP                  L+S ++
Sbjct  304  SLTKVKLQALNITDVSLAVIGHYGKAVTDLSLTSLPNVTEKGFWVMGNGHGLQKLKSFTV  363

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D+ L  + + CPNL  L LS    ++D GL    ++                 
Sbjct  364  TSCRGATDSGLEAVGKGCPNLKQLCLSKCPFLSDKGLASLAKAAGSLECLQLEECHRISQ  423

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C A L  ++ + C+ + D           E+L  L+++ C    DASL A+
Sbjct  424  FGFFCSLINCGAKLKVISFANCLGIKDLNSGLPPLSPCESLRSLSIHNCPGFGDASLFAL  483

Query  566  ADYCSVLRDLDI  601
               C  L+ +++
Sbjct  484  GKLCPQLQHVEL  495



>ref|XP_010254418.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=673

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN++QL L+KC  LSDNG+++F + A S+ESLQLEEC+RI+Q+GV G L +   
Sbjct  397  AVGKGCPNLRQLILQKCLFLSDNGLIAFARNAASLESLQLEECNRITQSGVLGALSNCGA  456

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+   C G+KD+  G+P L PCNSLRS S+ +C GFG +SL ++ +LCP L +++L
Sbjct  457  KLKALSLVKCMGIKDVVLGLPQLSPCNSLRSFSVRHCPGFGSSSLAMVGKLCPQLQYVDL  516

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+LP +++ + GLVKVNLSGC+N+TD  ++ +A+LHGETL+LLNL+GC  +
Sbjct  517  SGLCGITDAGILPLIENSELGLVKVNLSGCMNLTDVVVTTMARLHGETLQLLNLDGCRKI  576

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA  C VLRDLDISK
Sbjct  577  TDASLMAIASNCLVLRDLDISK  598


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 90/228 (39%), Gaps = 54/228 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L   + + D G+         +E L L +   IS  G+  I      
Sbjct  213  AIARGCPSLKALSLWNVSSIGDAGLSEIASGCHMLEKLDLCQLPSISDKGLMAI------  266

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                   ENC                 +L SL+I +C+  G+ SL  + R CPNL  +++
Sbjct  267  ------AENC----------------PNLISLTIESCSKVGNESLQAIGRCCPNLQSISI  304

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVN-------------------------LSGCINVTD  466
                 V D G+   + S    L KV                          L+G  NV++
Sbjct  305  KDCPLVGDQGVASLLSSVSYVLTKVKLQGLNISDVSLAVVGHYGKAVTELVLTGLQNVSE  364

Query  467  KTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            +    +   HG + L+ + +  C  VTD  L A+   C  LR L + K
Sbjct  365  RGFWVMGNTHGLQKLKSITITSCRGVTDLGLEAVGKGCPNLRQLILQK  412


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 90/186 (48%), Gaps = 2/186 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++   +R C     + +    K    ++ + L     I+ AG+  ++ +S   L  +
Sbjct  482  CNSLRSFSVRHCPGFGSSSLAMVGKLCPQLQYVDLSGLCGITDAGILPLIENSELGLVKV  541

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D+     A     +L+ L++  C    DASL+ ++  C  L  L++S    
Sbjct  542  NLSGCMNLTDVVVTTMARLHGETLQLLNLDGCRKITDASLMAIASNCLVLRDLDISKC-A  600

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD+G++    +    L  ++LSGC++V+DK++  +  + G+ L  LNL  C  ++ +++
Sbjct  601  ITDFGIVALSSTKQLDLQILSLSGCLHVSDKSMPFLKNM-GQNLVGLNLQRCNSISSSTI  659

Query  557  AAIADY  574
              + ++
Sbjct  660  EILVEH  665


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 80/187 (43%), Gaps = 3/187 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ + CPN++ + ++ C L+ D GV S + +   + +    +   IS      ++ H   
Sbjct  291  AIGRCCPNLQSISIKDCPLVGDQGVASLLSSVSYVLTKVKLQGLNISDVS-LAVVGHYGK  349

Query  182  KLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  L       + +  F V         L+S++I +C G  D  L  + + CPNL  L 
Sbjct  350  AVTELVLTGLQNVSERGFWVMGNTHGLQKLKSITITSCRGVTDLGLEAVGKGCPNLRQLI  409

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            L     ++D GL+ F ++  A L  + L  C  +T   +       G  L+ L+L  C  
Sbjct  410  LQKCLFLSDNGLIAFARNA-ASLESLQLEECNRITQSGVLGALSNCGAKLKALSLVKCMG  468

Query  539  VTDASLA  559
            + D  L 
Sbjct  469  IKDVVLG  475



>gb|KDP32417.1| hypothetical protein JCGZ_13342 [Jatropha curcas]
Length=651

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KGC N+KQ+CLRKC  +SDNG++SF +AA S+ESLQLEEC+R++Q+G+ G + +S  
Sbjct  375  AIAKGCTNLKQMCLRKCCFVSDNGLISFARAAGSLESLQLEECNRVTQSGIVGAISNSGT  434

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL    C G++D   G+P L PC+SLRSLSI NC GFG ASL ++ +LCP L H++L
Sbjct  435  KLKALNLVKCMGIRDGTSGMPLLSPCSSLRSLSIRNCPGFGSASLALVGKLCPQLQHVDL  494

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD GLLP ++SC+AGLVKVNLSGC+++TD+ +S +A+LHG TLELLNL+GC  +
Sbjct  495  SGLCAITDSGLLPLLESCEAGLVKVNLSGCMSLTDEVVSVLARLHGGTLELLNLDGCRKI  554

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD+S+AAIA  C  L DLD+SK
Sbjct  555  TDSSVAAIARGCLFLSDLDLSK  576


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 96/205 (47%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G+    K    +E L L  C  IS  G+  I   +  
Sbjct  191  AIAHGCPSLRALSLWDVPSVGDEGLFKIAKECHLLEKLDLCNCRSISNKGLIAI-AENCP  249

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHL  355
             L AL  E+C  + +   G+ A+   C +L+SLSI +C   GD     +LS     L  +
Sbjct  250  NLIALNIESCPKIGN--EGLQAIGKFCTNLQSLSIKDCPLVGDHGVSSLLSSASGGLTKV  307

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  L  +      +  + LS    V++K    +    G + L  L ++ C
Sbjct  308  KLQALN-ITDFS-LAVIGHYGKAVTSLVLSSLQQVSEKGFWVMGNAQGLQKLMSLTISSC  365

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              +T+ S+ AIA  C+ L+ + + K
Sbjct  366  RGITNVSIEAIAKGCTNLKQMCLRK  390



>ref|XP_010048202.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80383.1| hypothetical protein EUGRSUZ_C01744 [Eucalyptus grandis]
Length=643

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ KGCPN+KQLC+R    LSD G+VSF+K+A S+ESLQLEECHRI+ +G++G++V    
Sbjct  367  SLGKGCPNLKQLCIRSSAFLSDGGLVSFMKSARSLESLQLEECHRITLSGLYGLVVGCGD  426

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LA  NC+G KD  FG P + PC SLRS ++ NC GFGDA LV L ++CP+L  + L
Sbjct  427  KLKSLALTNCWGFKDFDFGSPQVSPCKSLRSFAVRNCPGFGDACLVALGKICPHLQQVEL  486

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLL  ++ C+AGLVKVNLSGCIN+TD+ +SA+AKLHG TLE+L L+GC  V
Sbjct  487  SGLTGITDEGLLRLLECCEAGLVKVNLSGCINLTDQVVSAMAKLHGRTLEVLILDGCTKV  546

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +D  L AIA+ C +L DLD+SK
Sbjct  547  SDLGLLAIAENCQLLSDLDVSK  568


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 94/206 (46%), Gaps = 8/206 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++ CP++K L L     + D G++        +E L L +C  I+   +  +   +  
Sbjct  183  AIARSCPSLKALSLWHLPSVGDEGLLEVANGCHQLEKLDLCQCPNITNKFLVAV-ARNCP  241

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  ++ E+C  + +   G+ A+   C +L+S+SI NC   GD  +V ++SR    L   
Sbjct  242  NLTDISIESCSSIGN--EGLAAVGQFCQNLKSISIKNCPSVGDQGIVGLISRAGSALTKF  299

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD  L        A +  + L+   NVT++    +   HG + L  L +  C
Sbjct  300  KLQALN-ITDVSLAVIGHYATA-VTDLTLASLHNVTERGFWVMGNGHGLQRLRSLIVTAC  357

Query  533  GCVTDASLAAIADYCSVLRDLDISKS  610
               TD  L ++   C  L+ L I  S
Sbjct  358  RGATDLGLESLGKGCPNLKQLCIRSS  383


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 67/150 (45%), Gaps = 3/150 (2%)
 Frame = +2

Query  155  FGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRL  334
             G +  S   LKAL+  +   + D    +     C+ L  L +C C    +  LV ++R 
Sbjct  181  LGAIARSCPSLKALSLWHLPSVGDEGL-LEVANGCHQLEKLDLCQCPNITNKFLVAVARN  239

Query  335  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL  514
            CPNL  +++   + + + GL    Q C   L  +++  C +V D+ I  +    G  L  
Sbjct  240  CPNLTDISIESCSSIGNEGLAAVGQFCQ-NLKSISIKNCPSVGDQGIVGLISRAGSALTK  298

Query  515  LNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
              L     +TD SLA I  Y + + DL ++
Sbjct  299  FKLQALN-ITDVSLAVIGHYATAVTDLTLA  327


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 45/208 (22%), Positives = 86/208 (41%), Gaps = 27/208 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILV----  169
            AV++ CPN+  + +  C+ + + G+ +  +  ++++S+ ++ C  +   G+ G++     
Sbjct  235  AVARNCPNLTDISIESCSSIGNEGLAAVGQFCQNLKSISIKNCPSVGDQGIVGLISRAGS  294

Query  170  ---------------------HSAGKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSI  283
                                 H A  +  L   +   + +  F V         LRSL +
Sbjct  295  ALTKFKLQALNITDVSLAVIGHYATAVTDLTLASLHNVTERGFWVMGNGHGLQRLRSLIV  354

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
              C G  D  L  L + CPNL  L +     ++D GL+ F++S  + L  + L  C  +T
Sbjct  355  TACRGATDLGLESLGKGCPNLKQLCIRSSAFLSDGGLVSFMKSARS-LESLQLEECHRIT  413

Query  464  DKTISAIAKLHGETLELLNLNGCGCVTD  547
               +  +    G+ L+ L L  C    D
Sbjct  414  LSGLYGLVVGCGDKLKSLALTNCWGFKD  441



>ref|XP_010102671.1| EIN3-binding F-box protein 1 [Morus notabilis]
 gb|EXC46038.1| EIN3-binding F-box protein 1 [Morus notabilis]
Length=697

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KG PN++Q CLRK + +SDNG+V+F +AA S+ESLQLEECHRI+Q G FG L +   
Sbjct  421  AVGKGSPNLRQFCLRKSSFVSDNGLVAFARAAGSLESLQLEECHRITQFGFFGALANCGT  480

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+   C G+KDL  G+P L PC SL+SL I NC GFG+ASL VL +LCP L H++ 
Sbjct  481  KLKALSLVCCLGIKDLNVGLPQLSPCESLKSLCIRNCPGFGNASLNVLGKLCPQLQHVDF  540

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD GLL F++SC+AGL KVNLSGC+N+TDK +SA+A+ HG TLE+LNL GC  +
Sbjct  541  SGLEGVTDSGLLSFLESCEAGLAKVNLSGCVNLTDKVVSAMAESHGWTLEMLNLEGCVKI  600

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +D  L AIAD C +L +LD+S+
Sbjct  601  SDVGLVAIADDCPLLSELDVSR  622


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 84/180 (47%), Gaps = 2/180 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C ++K LC+R C    +  +    K    ++ +       ++ +G+   L      L  +
Sbjct  506  CESLKSLCIRNCPGFGNASLNVLGKLCPQLQHVDFSGLEGVTDSGLLSFLESCEAGLAKV  565

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D      A     +L  L++  C    D  LV ++  CP L  L++S    
Sbjct  566  NLSGCVNLTDKVVSAMAESHGWTLEMLNLEGCVKISDVGLVAIADDCPLLSELDVSRC-A  624

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD+GL    ++    L  ++LSGC  +TDK+++A+ K  G+TL  LNL  C  ++++++
Sbjct  625  ITDFGLAALARANHLNLQILSLSGCSLITDKSMAALGK-TGQTLVGLNLQHCKAISNSTV  683


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/228 (23%), Positives = 93/228 (41%), Gaps = 28/228 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV + CPN+K + ++ C+L+ D G+   V +   + S    +   I+   +  ++ H   
Sbjct  315  AVGRSCPNLKSVSIKNCSLVGDQGIAGLVSSTSFVLSKVKLQALNITDVSL-AVIGHYGK  373

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  LA  +   + +  F V    P    L+SL+I +C G  D  L  + +  PNL    
Sbjct  374  SITDLALTSLPAVSERGFWVMGNGPGLQKLKSLTITSCQGVTDVGLEAVGKGSPNLRQFC  433

Query  359  LSGLNGVTDYGLLPFVQS--------------------------CDAGLVKVNLSGCINV  460
            L   + V+D GL+ F ++                          C   L  ++L  C+ +
Sbjct  434  LRKSSFVSDNGLVAFARAAGSLESLQLEECHRITQFGFFGALANCGTKLKALSLVCCLGI  493

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             D  +        E+L+ L +  C    +ASL  +   C  L+ +D S
Sbjct  494  KDLNVGLPQLSPCESLKSLCIRNCPGFGNASLNVLGKLCPQLQHVDFS  541


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 81/190 (43%), Gaps = 30/190 (16%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L   T + D  +         +E L L +C  IS   +F I  +   
Sbjct  237  AIAHGCPSLRVLSLWNMTSVGDEVLCEIADGCHLLEKLDLCQCPAISDKALFAIAKN---  293

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L  L+I +C+  G+A L  + R CPNL  +++
Sbjct  294  -------------------------CPNLTELTIESCSNIGNAGLQAVGRSCPNLKSVSI  328

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
               + V D G+   V S    L KV L   +N+TD +++ I   +G+++  L L     V
Sbjct  329  KNCSLVGDQGIAGLVSSTSFVLSKVKLQA-LNITDVSLAVIGH-YGKSITDLALTSLPAV  386

Query  542  TDASLAAIAD  571
            ++     + +
Sbjct  387  SERGFWVMGN  396



>ref|XP_002285249.2| PREDICTED: EIN3-binding F-box protein 1-like [Vitis vinifera]
Length=663

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 153/189 (81%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+KQ+CLRKC  +SDNG+++F KAA S+E LQLEEC+R++Q GV G L +   
Sbjct  387  AMGKGCPNLKQMCLRKCCFVSDNGLIAFAKAAGSLEGLQLEECNRVTQLGVIGSLSNCGS  446

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+KD+A G P L PC+SLRSLSI NC GFG ASL ++ +LCP L H++L
Sbjct  447  KLKSLSLVKCMGIKDIAVGTPMLSPCHSLRSLSIRNCPGFGSASLAMVGKLCPQLHHVDL  506

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL+G+TD GLLP ++SC+AGL KVNLSGC+N+TD+ + A+A+LHGETLELLNL+GC  +
Sbjct  507  SGLDGMTDAGLLPLLESCEAGLAKVNLSGCLNLTDEVVLAMARLHGETLELLNLDGCRKI  566

Query  542  TDASLAAIA  568
            TDASL AIA
Sbjct  567  TDASLVAIA  575


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 8/204 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP+++ L L   + + D G+         +E L L +C  IS  G+  I   +   
Sbjct  204  IAHGCPSLRVLSLWNVSAVGDEGLFEIGNGCHMLEKLDLCQCPLISDKGLIAI-AKNCPN  262

Query  185  LKALAFENCFGMKDLAF-GVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
            L AL  E+C  + + +   + +L  C  L+S+SI +C   GD  +  +LS     L  + 
Sbjct  263  LTALTIESCANIGNESLQAIGSL--CPKLQSISIKDCPLVGDQGVAGLLSSATSILSRVK  320

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN +TD+  L  V      +  + LSG  NV++K    +    G +TL  L +  C 
Sbjct  321  LQSLN-ITDFS-LAVVGHYGKAITSLTLSGLQNVSEKGFWVMGNAMGLQTLISLTITSCR  378

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             +TD SL A+   C  L+ + + K
Sbjct  379  GITDVSLEAMGKGCPNLKQMCLRK  402


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 101/259 (39%), Gaps = 64/259 (25%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL-----  166
            A++K CPN+  L +  C  + +  + +       ++S+ +++C  +   GV G+L     
Sbjct  255  AIAKNCPNLTALTIESCANIGNESLQAIGSLCPKLQSISIKDCPLVGDQGVAGLLSSATS  314

Query  167  VHSAGKLKALAF---------------------------ENCFGMKDLAFGVPALPPCNS  265
            + S  KL++L                             E  F +   A G+       +
Sbjct  315  ILSRVKLQSLNITDFSLAVVGHYGKAITSLTLSGLQNVSEKGFWVMGNAMGL------QT  368

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHL---------------------NLSGL----  370
            L SL+I +C G  D SL  + + CPNL  +                     +L GL    
Sbjct  369  LISLTITSCRGITDVSLEAMGKGCPNLKQMCLRKCCFVSDNGLIAFAKAAGSLEGLQLEE  428

Query  371  -NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
             N VT  G++  + +C + L  ++L  C+ + D  +         +L  L++  C     
Sbjct  429  CNRVTQLGVIGSLSNCGSKLKSLSLVKCMGIKDIAVGTPMLSPCHSLRSLSIRNCPGFGS  488

Query  548  ASLAAIADYCSVLRDLDIS  604
            ASLA +   C  L  +D+S
Sbjct  489  ASLAMVGKLCPQLHHVDLS  507



>ref|NP_001234864.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ABC24972.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
 gb|ACS44349.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
Length=665

 Score =   248 bits (632),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+K  CLRKCT+LSDNG+V+F K + ++E+LQLEECHRI+QAG  G+L+    
Sbjct  389  ALGKGCPNLKLFCLRKCTILSDNGLVAFAKGSVALENLQLEECHRITQAGFVGVLLSCGE  448

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L+   CFG+K+LA   P++ PCNSL+SLSI NC G G+A+L ++ RLCP L HL L
Sbjct  449  KLKVLSMVKCFGVKELACRFPSVLPCNSLQSLSIRNCPGVGNATLAIMGRLCPKLTHLEL  508

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GL P VQSC+AGLVKVNLSGC+NVTD+++S I +LHG +LE LN++ C  V
Sbjct  509  SGLLQVTDEGLFPLVQSCEAGLVKVNLSGCVNVTDRSVSFITELHGGSLESLNVDECRYV  568

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD +L AI++ C +L++LD+SK
Sbjct  569  TDMTLLAISNNCWLLKELDVSK  590


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 83/178 (47%), Gaps = 2/178 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C  + +  +    +    +  L+L    +++  G+F ++      L  +
Sbjct  474  CNSLQSLSIRNCPGVGNATLAIMGRLCPKLTHLELSGLLQVTDEGLFPLVQSCEAGLVKV  533

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D +          SL SL++  C    D +L+ +S  C  L  L++S   G
Sbjct  534  NLSGCVNVTDRSVSFITELHGGSLESLNVDECRYVTDMTLLAISNNCWLLKELDVSKC-G  592

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA  550
            +TD G+     +    L  ++LSGC  ++DK++  + KL G+TL  LN+  C  V+ +
Sbjct  593  ITDSGVASLASTVRLNLQILSLSGCSMLSDKSVPFLQKL-GQTLMGLNIQHCNGVSSS  649


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 79/179 (44%), Gaps = 5/179 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV-FGILVHSA  178
            AV + CP +K + L+ C L+ D G+ S   +A  +  L   + H ++ + +   ++ H  
Sbjct  283  AVGRFCPKLKFVSLKNCPLIGDQGIASLFSSAGHV--LTKVKLHALNISDIALAVIGHYG  340

Query  179  GKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
              +  +A      + +  F V         LRSL+I  C G  D  L  L + CPNL   
Sbjct  341  IAITDIALIGLQNINERGFWVMGNGQGLQKLRSLAITACHGVTDLGLEALGKGCPNLKLF  400

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC  532
             L     ++D GL+ F +   A L  + L  C  +T      +    GE L++L++  C
Sbjct  401  CLRKCTILSDNGLVAFAKGSVA-LENLQLEECHRITQAGFVGVLLSCGEKLKVLSMVKC  458



>ref|XP_011069870.1| PREDICTED: EIN3-binding F-box protein 1 [Sesamum indicum]
Length=666

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCP++K   LRKC  +SD G+VSF KAA S+ESL+LEECHRISQ GVFGIL    G
Sbjct  390  AVGKGCPDLKLFALRKCPHVSDPGLVSFTKAAGSLESLKLEECHRISQCGVFGILSSCGG  449

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKALA ENC G++D  F  PA   C+SLRSLSI NC GFGDA L + +R CP L  L+ 
Sbjct  450  KLKALAIENCLGIRDSEFAFPATSFCHSLRSLSIRNCPGFGDACLGMFARFCPKLTQLDF  509

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+LP VQ+ DAGLVKVNLSG   +TD  + AI++LHGETLE+L+L+GC  +
Sbjct  510  SGLQGITDAGILPLVQNSDAGLVKVNLSGSAKLTDNVVMAISELHGETLEVLHLDGCQYI  569

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD S+ AIA  CSVL +LD+S+
Sbjct  570  TDLSMLAIARNCSVLSELDVSQ  591


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 54/229 (24%), Positives = 90/229 (39%), Gaps = 30/229 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVS-FVKAAESIESLQLEECHRISQAGVFGILVHSA  178
            A+ + CPN++ + ++ C L+ D G+   F  A   +E  +L+  + IS   +  ++ H  
Sbjct  284  ALGRYCPNLRCVTVKNCPLVGDQGIAGLFSSAGHILEKAKLQALN-ISDVSL-AVIGHYG  341

Query  179  GKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
              +  LA      + +  F V         L+SLS+  C G  D  L  + + CP+L   
Sbjct  342  SAMTDLALVGLQNVNERGFWVMGKGQGLQKLKSLSLTACPGVSDLGLEAVGKGCPDLKLF  401

Query  356  NLSGLNGVTDYGLLPFVQ--------------------------SCDAGLVKVNLSGCIN  457
             L     V+D GL+ F +                          SC   L  + +  C+ 
Sbjct  402  ALRKCPHVSDPGLVSFTKAAGSLESLKLEECHRISQCGVFGILSSCGGKLKALAIENCLG  461

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + D   +  A     +L  L++  C    DA L   A +C  L  LD S
Sbjct  462  IRDSEFAFPATSFCHSLRSLSIRNCPGFGDACLGMFARFCPKLTQLDFS  510


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 54/228 (24%), Positives = 89/228 (39%), Gaps = 54/228 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S+GCP++K L L   + + D G+      +  +E L L  C  I+  G+  I ++   
Sbjct  206  AISRGCPSLKVLSLWNLSSIGDEGLCEIASGSRFLEKLDLCHCPAITDKGLIAIALN---  262

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L S+++ +C+  G+ SL  L R CPNL  + +
Sbjct  263  -------------------------CPNLISVTVESCSNIGNESLKALGRYCPNLRCVTV  297

Query  362  SGLNGVTDYGLLPFVQSC-----DAGLVKVNLS--------------------GCINVTD  466
                 V D G+     S       A L  +N+S                    G  NV +
Sbjct  298  KNCPLVGDQGIAGLFSSAGHILEKAKLQALNISDVSLAVIGHYGSAMTDLALVGLQNVNE  357

Query  467  KTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            +    + K  G + L+ L+L  C  V+D  L A+   C  L+   + K
Sbjct  358  RGFWVMGKGQGLQKLKSLSLTACPGVSDLGLEAVGKGCPDLKLFALRK  405



>gb|KDO80236.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=631

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLRKC  +SDNG+V+F KAA S+E LQLEEC+R+SQ+G+ G++ +SA 
Sbjct  355  AMGKGCLNLKQMCLRKCCFVSDNGLVAFSKAAGSLEILQLEECNRVSQSGILGVVSNSAS  414

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L    C G+KD+A  +P L P  SLRSLSI NC GFG+ASL +L +LCP L H++L
Sbjct  415  KLKSLTLVKCMGIKDMATEMPMLSPNCSLRSLSIRNCPGFGNASLAMLGKLCPQLQHVDL  474

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+ P ++SC AGLVKVNLSGC+N+TD+ + A+A+LH ETLELLNL+GC  +
Sbjct  475  SGLYGITDVGIFPLLESCKAGLVKVNLSGCLNLTDEVVLALARLHSETLELLNLDGCRKI  534

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AI + C  L  LD+SK
Sbjct  535  TDASLVAIGNNCMFLSYLDVSK  556


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 95/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L     + D G++   K    +E L+L  C  IS   +  I   +  
Sbjct  171  AIARGCPSLKSLSLWNVPSVGDEGLLEIAKECHLLEKLELCHCPSISNESLIAI-AENCP  229

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASL-VVLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C +L+ LSI +C    D  +  +LS     L  +
Sbjct  230  NLTSLNIESCSKIGN--DGLQAIGKFCRNLQCLSIKDCPLVRDQGISSLLSSASSVLTRV  287

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  L  +      L  + LS   NV++K    +    G + L  L +   
Sbjct  288  KLQALN-ITDFS-LAVIGHYGKALTNLVLSDLPNVSEKGFWVMGNAQGLQKLVSLTIASG  345

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
            G VTD SL A+   C  L+ + + K
Sbjct  346  GGVTDVSLEAMGKGCLNLKQMCLRK  370



>ref|XP_006450916.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|ESR64156.1| hypothetical protein CICLE_v10007739mg [Citrus clementina]
 gb|KDO80237.1| hypothetical protein CISIN_1g006749mg [Citrus sinensis]
Length=632

 Score =   246 bits (629),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLRKC  +SDNG+V+F KAA S+E LQLEEC+R+SQ+G+ G++ +SA 
Sbjct  356  AMGKGCLNLKQMCLRKCCFVSDNGLVAFSKAAGSLEILQLEECNRVSQSGILGVVSNSAS  415

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L    C G+KD+A  +P L P  SLRSLSI NC GFG+ASL +L +LCP L H++L
Sbjct  416  KLKSLTLVKCMGIKDMATEMPMLSPNCSLRSLSIRNCPGFGNASLAMLGKLCPQLQHVDL  475

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+ P ++SC AGLVKVNLSGC+N+TD+ + A+A+LH ETLELLNL+GC  +
Sbjct  476  SGLYGITDVGIFPLLESCKAGLVKVNLSGCLNLTDEVVLALARLHSETLELLNLDGCRKI  535

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AI + C  L  LD+SK
Sbjct  536  TDASLVAIGNNCMFLSYLDVSK  557


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 95/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L     + D G++   K    +E L+L  C  IS   +  I   +  
Sbjct  172  AIARGCPSLKSLSLWNVPSVGDEGLLEIAKECHLLEKLELCHCPSISNESLIAI-AENCP  230

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASL-VVLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C +L+ LSI +C    D  +  +LS     L  +
Sbjct  231  NLTSLNIESCSKIGN--DGLQAIGKFCRNLQCLSIKDCPLVRDQGISSLLSSASSVLTRV  288

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  L  +      L  + LS   NV++K    +    G + L  L +   
Sbjct  289  KLQALN-ITDFS-LAVIGHYGKALTNLVLSDLPNVSEKGFWVMGNAQGLQKLVSLTIASG  346

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
            G VTD SL A+   C  L+ + + K
Sbjct  347  GGVTDVSLEAMGKGCLNLKQMCLRK  371



>ref|XP_004498740.1| PREDICTED: EIN3-binding F-box protein 1-like [Cicer arietinum]
Length=641

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 155/201 (77%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+K + L KC  LS+NG++SF KAA S+ESLQLEECHRI+Q G FG+L +   
Sbjct  365  AIGKGCPNLKSVQLLKCAFLSNNGLISFTKAASSLESLQLEECHRITQFGFFGVLFNCGA  424

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA++  +C+G+KDL   +  + PC SLRSLSI NC GFG+A+L V+ +LCP L  + L
Sbjct  425  KLKAISLASCYGIKDLDLELSPVSPCESLRSLSIRNCPGFGNATLSVMGKLCPQLQQVEL  484

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL GV D GLLP ++S +AGL+KVNLSGC+N+TDK +S++  LHG TLELLNL GC  +
Sbjct  485  TGLKGVNDAGLLPLLESSEAGLIKVNLSGCVNLTDKVVSSLVNLHGWTLELLNLEGCKNI  544

Query  542  TDASLAAIADYCSVLRDLDIS  604
            ++ASL AIA++C +L DLD+S
Sbjct  545  SNASLVAIAEHCQLLSDLDVS  565


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 107/253 (42%), Gaps = 52/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI-----L  166
            AV+K CPN+ +L L  C+ + + G+ +  K   +++S+ +++C  +   G+ G+     L
Sbjct  233  AVAKNCPNLTELSLESCSNIHNEGLQAIGKCCPNLKSMSIKDCAGVGDQGIAGLFSSTSL  292

Query  167  VHSAGKLKALAFENC-------FGMKDLAFGVPALPPC--------------NSLRSLSI  283
              +  KL+AL   +        +G       +  LP                + L+SL+I
Sbjct  293  ALTKVKLQALTISDLSLAVIGHYGKTVTDLVLNFLPNVSERGFWVMGNGNGLHKLKSLTI  352

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNL--------SGL------------------NGVTD  385
             +C G  D  L  + + CPNL  + L        +GL                  + +T 
Sbjct  353  ASCRGVTDVGLEAIGKGCPNLKSVQLLKCAFLSNNGLISFTKAASSLESLQLEECHRITQ  412

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G    + +C A L  ++L+ C  + D  +        E+L  L++  C    +A+L+ +
Sbjct  413  FGFFGVLFNCGAKLKAISLASCYGIKDLDLELSPVSPCESLRSLSIRNCPGFGNATLSVM  472

Query  566  ADYCSVLRDLDIS  604
               C  L+ ++++
Sbjct  473  GKLCPQLQQVELT  485


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 95/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP++K L L   + + D G++      + +E L L +C  IS   +  +   +  
Sbjct  181  AVASGCPSLKALSLWNVSSVGDEGLIEIASGCQQLEKLDLCKCPAISDKALIAV-AKNCP  239

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  L+ E+C  + +   G+ A+   C +L+S+SI +C G GD  +  + S     L  +
Sbjct  240  NLTELSLESCSNIHN--EGLQAIGKCCPNLKSMSIKDCAGVGDQGIAGLFSSTSLALTKV  297

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  ++D   L  +      +  + L+   NV+++    +   +G   L+ L +  C
Sbjct  298  KLQALT-ISDLS-LAVIGHYGKTVTDLVLNFLPNVSERGFWVMGNGNGLHKLKSLTIASC  355

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L AI   C  L+ + + K
Sbjct  356  RGVTDVGLEAIGKGCPNLKSVQLLK  380


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 86/185 (46%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    +  +    K    ++ ++L     ++ AG+  +L  S   L  +
Sbjct  450  CESLRSLSIRNCPGFGNATLSVMGKLCPQLQQVELTGLKGVNDAGLLPLLESSEAGLIKV  509

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D            +L  L++  C    +ASLV ++  C  L  L++S +  
Sbjct  510  NLSGCVNLTDKVVSSLVNLHGWTLELLNLEGCKNISNASLVAIAEHCQLLSDLDVS-MCA  568

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            ++D G+     +    L  ++LSGC  VTD+++ A+ KL G TL  LN+  C  ++ +++
Sbjct  569  ISDAGIASLAHAKQLNLQVLSLSGCTLVTDRSLPALRKL-GHTLLGLNIQHCNSISSSAV  627

Query  557  AAIAD  571
              + +
Sbjct  628  EMLVE  632



>emb|CAN82790.1| hypothetical protein VITISV_030601 [Vitis vinifera]
Length=718

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGC N+KQ CLRKC  LSDNG+VS  K A S+ESLQLEEC  I+Q GVFG LV   G
Sbjct  491  AVGKGCXNLKQFCLRKCAFLSDNGLVSLAKVAASLESLQLEECXHITQYGVFGALVSCGG  550

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LA  NCFG+KD   G+P + PC SL SLSI NC GFG+ASL ++ +LCP L  L+L
Sbjct  551  KLKSLALVNCFGIKDTVEGLPLMTPCKSLSSLSIRNCPGFGNASLCMVGKLCPQLQRLDL  610

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SG   +T+ G LP ++SC+A L+KVNLSGC+N+TD  +SA+AK+HG TLE LNL+GC  +
Sbjct  611  SGALRITNAGFLPLLESCEASLIKVNLSGCMNLTDNVVSALAKVHGGTLEQLNLDGCQKI  670

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDAS+ AIA+ C++L DLD+SK+
Sbjct  671  TDASMFAIAENCALLSDLDVSKT  693


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 97/205 (47%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + ++D G++        +E L L  C  IS   +  I   +  
Sbjct  307  AIARGCPSLRVLSLWNVSSIADEGLIEIANGCHQLEKLDLCGCPTISDKALVAI-AKNCH  365

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L AL  E+C  + +   G+ A+   C +L+S+SI NC   GD  +  +LS     L  +
Sbjct  366  NLTALTIESCPRIGNA--GLQAVGQFCPNLKSISIKNCPLVGDQGVASLLSSASYALTKV  423

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD   L  +      +  ++L+G  NV ++    +   HG + L+ L +  C
Sbjct  424  KLHALN-ITDVS-LAVIGHYGKAITDLDLTGLQNVGERGFWVMGSGHGLQKLKSLTVTSC  481

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD  L A+   C  L+   + K
Sbjct  482  QGVTDMGLEAVGKGCXNLKQFCLRK  506


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 56/108 (52%), Gaps = 5/108 (5%)
 Frame = +2

Query  278  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
            S C  T  G   L  ++R CP+L  L+L  ++ + D GL+     C   L K++L GC  
Sbjct  296  SSCRVTNLG---LGAIARGCPSLRVLSLWNVSSIADEGLIEIANGCHQ-LEKLDLCGCPT  351

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            ++DK + AIAK +   L  L +  C  + +A L A+  +C  L+ + I
Sbjct  352  ISDKALVAIAK-NCHNLTALTIESCPRIGNAGLQAVGQFCPNLKSISI  398



>emb|CAN83761.1| hypothetical protein VITISV_043743 [Vitis vinifera]
Length=669

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 152/189 (80%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+KQ+CLRKC  +SDNG+++F KAA S+E LQLEEC+R++Q GV G L +   
Sbjct  362  AMGKGCPNLKQMCLRKCCFVSDNGLIAFAKAAGSLEGLQLEECNRVTQLGVIGSLSNCGS  421

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+KD+A G P L PC+SLRSLSI NC GFG ASL ++ +LCP L H++L
Sbjct  422  KLKSLSLVKCMGIKDIAVGTPMLSPCHSLRSLSIRNCPGFGSASLAMVGKLCPQLHHVDL  481

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL+G+TD GLLP ++SC+AGL KVNLSGC+N+TD+ + A+A+LHG TLELLNL+GC  +
Sbjct  482  SGLDGMTDAGLLPLLESCEAGLAKVNLSGCLNLTDEVVLAMARLHGXTLELLNLDGCRKI  541

Query  542  TDASLAAIA  568
            TDASL AIA
Sbjct  542  TDASLVAIA  550


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 96/204 (47%), Gaps = 8/204 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP+++ L L   + + D G+         +E L L +C  IS  G+  I   +   
Sbjct  179  IAHGCPSLRVLSLWNVSAVGDEGLFEIGNGCHMLEKLDLCQCPXISDKGLIAI-AKNCPN  237

Query  185  LKALAFENCFGMKDLAF-GVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
            L AL  E+C  + + +   + +L  C  L+S+SI +C   GD  +  +LS     L  + 
Sbjct  238  LTALTIESCANIGNESLQAIGSL--CPKLQSISIKDCPLVGDQGVAGLLSSATSILSRVK  295

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN +TD+  L  V      +  + LSG  NV++K    +    G +TL  L +  C 
Sbjct  296  LQSLN-ITDFS-LAVVGHYGKAITSLTLSGLQNVSEKGFWVMGNAMGLQTLISLTITSCR  353

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             +TD SL A+   C  L+ + + K
Sbjct  354  GITDVSLEAMGKGCPNLKQMCLRK  377


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 101/259 (39%), Gaps = 64/259 (25%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL-----  166
            A++K CPN+  L +  C  + +  + +       ++S+ +++C  +   GV G+L     
Sbjct  230  AIAKNCPNLTALTIESCANIGNESLQAIGSLCPKLQSISIKDCPLVGDQGVAGLLSSATS  289

Query  167  VHSAGKLKALAF---------------------------ENCFGMKDLAFGVPALPPCNS  265
            + S  KL++L                             E  F +   A G+       +
Sbjct  290  ILSRVKLQSLNITDFSLAVVGHYGKAITSLTLSGLQNVSEKGFWVMGNAMGL------QT  343

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHL---------------------NLSGL----  370
            L SL+I +C G  D SL  + + CPNL  +                     +L GL    
Sbjct  344  LISLTITSCRGITDVSLEAMGKGCPNLKQMCLRKCCFVSDNGLIAFAKAAGSLEGLQLEE  403

Query  371  -NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
             N VT  G++  + +C + L  ++L  C+ + D  +         +L  L++  C     
Sbjct  404  CNRVTQLGVIGSLSNCGSKLKSLSLVKCMGIKDIAVGTPMLSPCHSLRSLSIRNCPGFGS  463

Query  548  ASLAAIADYCSVLRDLDIS  604
            ASLA +   C  L  +D+S
Sbjct  464  ASLAMVGKLCPQLHHVDLS  482



>ref|XP_004508488.1| PREDICTED: EIN3-binding F-box protein 2-like [Cicer arietinum]
Length=639

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+SKGC N+K +CLRKC  +SD+G+V+F KAA S+E+LQLEEC+R +Q+G+ G L +   
Sbjct  363  AISKGCINLKHMCLRKCCFVSDSGLVAFAKAAVSLENLQLEECNRFTQSGIIGALSNIKT  422

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L    C G+KD+   V    PC SLR+L+I NC GFG ASL ++ +LCP L H++L
Sbjct  423  KLKSLTLVKCMGVKDIDVEVSTFSPCESLRTLTIQNCPGFGSASLAMIGKLCPQLQHVDL  482

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD GLLP +++C+AGLVKVNL+GC N+TD  +SA+A+LHG TLELLNL+GC  +
Sbjct  483  TGLYGITDAGLLPLLENCEAGLVKVNLTGCWNLTDHIVSALARLHGGTLELLNLDGCWNI  542

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASLAAIAD C +L DLD+S+
Sbjct  543  TDASLAAIADNCLLLNDLDVSR  564


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 94/204 (46%), Gaps = 7/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP+++ L L   + + D G+    K    +E + L  C  I+  G+  I      
Sbjct  180  AVAHGCPSLRSLSLWNVSSIGDKGLSEIAKGCHMLEKIDLCLCPSITNKGLIAI-AEGCP  238

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             L  L  E+C  + +   G+ A+   C  L+S+SI +C   GD  +  L  L  NL  + 
Sbjct  239  NLTTLNIESCSKIGN--EGLQAIAKLCPKLQSISIKDCCLVGDHGVSSLLSLASNLSRVK  296

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN +TD+  L  +      +  + LS   NV+++    +    G + L  L +  C 
Sbjct  297  LQALN-ITDFS-LAVIGHYGKAITNLVLSSLRNVSERGFWVMGVAQGLQKLVSLTVTSCR  354

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTD S+ AI+  C  L+ + + K
Sbjct  355  GVTDVSIEAISKGCINLKHMCLRK  378


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/252 (21%), Positives = 99/252 (39%), Gaps = 51/252 (20%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++GCPN+  L +  C+ + + G+ +  K    ++S+ +++C  +   GV         
Sbjct  232  AIAEGCPNLTTLNIESCSKIGNEGLQAIAKLCPKLQSISIKDCCLVGDHGVSSLLSLASN  291

Query  155  ---------------FGILVHSAGKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSIC  286
                             ++ H    +  L   +   + +  F V  +      L SL++ 
Sbjct  292  LSRVKLQALNITDFSLAVIGHYGKAITNLVLSSLRNVSERGFWVMGVAQGLQKLVSLTVT  351

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSC---------------DA  421
            +C G  D S+  +S+ C NL H+ L     V+D GL+ F ++                 +
Sbjct  352  SCRGVTDVSIEAISKGCINLKHMCLRKCCFVSDSGLVAFAKAAVSLENLQLEECNRFTQS  411

Query  422  GLV-----------KVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIA  568
            G++            + L  C+ V D  +        E+L  L +  C     ASLA I 
Sbjct  412  GIIGALSNIKTKLKSLTLVKCMGVKDIDVEVSTFSPCESLRTLTIQNCPGFGSASLAMIG  471

Query  569  DYCSVLRDLDIS  604
              C  L+ +D++
Sbjct  472  KLCPQLQHVDLT  483



>ref|XP_006475854.1| PREDICTED: EIN3-binding F-box protein 2-like [Citrus sinensis]
Length=729

 Score =   246 bits (628),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLRKC  +SDNG+V+F KAA S+E LQLEEC+R+SQ+G+ G++ +SA 
Sbjct  453  AMGKGCLNLKQMCLRKCCFVSDNGLVAFSKAAGSLEILQLEECNRVSQSGILGVVSNSAS  512

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L    C G+KD+A  +P L P  SLRSLSI NC GFG+ASL +L +LCP L H++L
Sbjct  513  KLKSLTLVKCMGIKDMATEMPMLSPNCSLRSLSIRNCPGFGNASLAMLGKLCPQLQHVDL  572

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+ P ++SC AGLVKVNLSGC+N+TD+ + A+A+LH ETLELLNL+GC  +
Sbjct  573  SGLYGITDVGIFPLLESCKAGLVKVNLSGCLNLTDEVVLALARLHSETLELLNLDGCRKI  632

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AI + C  L  LD+SK
Sbjct  633  TDASLVAIGNNCMFLSYLDVSK  654


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 95/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L     + D G++   K    +E L+L  C  IS   +  I   +  
Sbjct  269  AIARGCPSLKSLSLWNVPSVGDEGLLEIAKECHLLEKLELCHCPSISNESLIAI-AENCP  327

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASL-VVLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C +L+ LSI +C    D  +  +LS     L  +
Sbjct  328  NLTSLNIESCSKIGN--DGLQAIGKFCRNLQCLSIKDCPLVRDQGISSLLSSASSVLTRV  385

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  L  +      L  + LS   NV++K    +    G + L  L +   
Sbjct  386  KLQALN-ITDFS-LAVIGHYGKALTNLVLSDLPNVSEKGFWVMGNAQGLQKLVSLTIASG  443

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
            G VTD SL A+   C  L+ + + K
Sbjct  444  GGVTDVSLEAMGKGCLNLKQMCLRK  468



>gb|KCW81401.1| hypothetical protein EUGRSUZ_C02778 [Eucalyptus grandis]
Length=635

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 151/201 (75%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+KQLC+  C  LSD G+ SF KAA S+E LQLEECHRI+Q G+F +L +   
Sbjct  359  ALGKGCPNLKQLCVHNCAFLSDRGLDSFAKAALSLERLQLEECHRITQYGLFTVLANCGD  418

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L   +C GMKDL  G P L  C SLRSLS+ +C GFGD SLV+L++LCPNL H++L
Sbjct  419  KLKSLTLVHCLGMKDLNMGSPMLSSCKSLRSLSVRHCPGFGDVSLVMLAKLCPNLQHVDL  478

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD   +P +++CD GLVK+N+SGC N+TDK ISA+A++HG TLE+LNL GC  V
Sbjct  479  SGLQAVTDASFIPLLENCDGGLVKINVSGCSNLTDKAISAVAEMHGWTLEVLNLEGCRKV  538

Query  542  TDASLAAIADYCSVLRDLDIS  604
             + SL AIA+ C +L DLD+S
Sbjct  539  GNTSLVAIAENCPLLNDLDVS  559


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 87/180 (48%), Gaps = 2/180 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    D  +V   K   +++ + L     ++ A    +L +  G L  +
Sbjct  444  CKSLRSLSVRHCPGFGDVSLVMLAKLCPNLQHVDLSGLQAVTDASFIPLLENCDGGLVKI  503

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A    A     +L  L++  C   G+ SLV ++  CP L  L++S L  
Sbjct  504  NVSGCSNLTDKAISAVAEMHGWTLEVLNLEGCRKVGNTSLVAIAENCPLLNDLDVS-LCA  562

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            VTD+G+    ++    L  ++LSGC  +++K + A+ KL G+ L  LNL  C  ++  S+
Sbjct  563  VTDFGVAALARADQLNLQILSLSGCTEISEKCLPALRKL-GQLLVGLNLQHCSGISKKSV  621


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/229 (23%), Positives = 91/229 (40%), Gaps = 30/229 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESI-ESLQLEECHRISQAGVFGILVHSA  178
            A+ + CPN+K + +  C  + D G+ S +     +   ++L+  H    +    ++ H  
Sbjct  253  AIGQNCPNLKSISINNCPHVGDQGIASLLSNTSCVLTKVKLQALHVTDLS--LAVIGHYG  310

Query  179  GKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNL---  346
              +  L   N   + +  F V         LRS ++ +C G  D  L  L + CPNL   
Sbjct  311  KAVTDLILANLQNVSERGFWVMGSGHGLQKLRSFAVTSCQGMTDMGLEALGKGCPNLKQL  370

Query  347  -VH----------------------LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
             VH                      L L   + +T YGL   + +C   L  + L  C+ 
Sbjct  371  CVHNCAFLSDRGLDSFAKAALSLERLQLEECHRITQYGLFTVLANCGDKLKSLTLVHCLG  430

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + D  + +      ++L  L++  C    D SL  +A  C  L+ +D+S
Sbjct  431  MKDLNMGSPMLSSCKSLRSLSVRHCPGFGDVSLVMLAKLCPNLQHVDLS  479


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 85/200 (43%), Gaps = 24/200 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
             V++GCP++K L +   + + D G++        +E L+L  C+ +S   +  +      
Sbjct  193  TVARGCPSLKVLSIWNVSSVGDEGLIEIANGCRQLEKLELRHCNAVSDKALISL------  246

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
                   +NC      A G      C +L+S+SI NC   GD  +  +LS     L  + 
Sbjct  247  ------AKNCLQ----AIG----QNCPNLKSISINNCPHVGDQGIASLLSNTSCVLTKVK  292

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  L+ VTD   L  +      +  + L+   NV+++    +   HG + L    +  C 
Sbjct  293  LQALH-VTDLS-LAVIGHYGKAVTDLILANLQNVSERGFWVMGSGHGLQKLRSFAVTSCQ  350

Query  536  CVTDASLAAIADYCSVLRDL  595
             +TD  L A+   C  L+ L
Sbjct  351  GMTDMGLEALGKGCPNLKQL  370



>ref|XP_010048972.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Eucalyptus grandis]
Length=653

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 151/201 (75%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+KQLC+  C  LSD G+ SF KAA S+E LQLEECHRI+Q G+F +L +   
Sbjct  377  ALGKGCPNLKQLCVHNCAFLSDRGLDSFAKAALSLERLQLEECHRITQYGLFTVLANCGD  436

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L   +C GMKDL  G P L  C SLRSLS+ +C GFGD SLV+L++LCPNL H++L
Sbjct  437  KLKSLTLVHCLGMKDLNMGSPMLSSCKSLRSLSVRHCPGFGDVSLVMLAKLCPNLQHVDL  496

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD   +P +++CD GLVK+N+SGC N+TDK ISA+A++HG TLE+LNL GC  V
Sbjct  497  SGLQAVTDASFIPLLENCDGGLVKINVSGCSNLTDKAISAVAEMHGWTLEVLNLEGCRKV  556

Query  542  TDASLAAIADYCSVLRDLDIS  604
             + SL AIA+ C +L DLD+S
Sbjct  557  GNTSLVAIAENCPLLNDLDVS  577


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 87/180 (48%), Gaps = 2/180 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    D  +V   K   +++ + L     ++ A    +L +  G L  +
Sbjct  462  CKSLRSLSVRHCPGFGDVSLVMLAKLCPNLQHVDLSGLQAVTDASFIPLLENCDGGLVKI  521

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A    A     +L  L++  C   G+ SLV ++  CP L  L++S L  
Sbjct  522  NVSGCSNLTDKAISAVAEMHGWTLEVLNLEGCRKVGNTSLVAIAENCPLLNDLDVS-LCA  580

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            VTD+G+    ++    L  ++LSGC  +++K + A+ KL G+ L  LNL  C  ++  S+
Sbjct  581  VTDFGVAALARADQLNLQILSLSGCTEISEKCLPALRKL-GQLLVGLNLQHCSGISKKSV  639


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/201 (25%), Positives = 94/201 (47%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
             V++GCP++K L +   + + D G++        +E L+L  C+ +S   +   L  +  
Sbjct  193  TVARGCPSLKVLSIWNVSSVGDEGLIEIANGCRQLEKLELRHCNAVSDKALIS-LAKNCP  251

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  ++ ++C  +++   G+ A+   C +L+S+SI NC   GD  +  +LS     L  +
Sbjct  252  NLTDISIDSCSTIRN--EGLQAIGQNCPNLKSISINNCPHVGDQGIASLLSNTSCVLTKV  309

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L+ VTD   L  +      +  + L+   NV+++    +   HG + L    +  C
Sbjct  310  KLQALH-VTDLS-LAVIGHYGKAVTDLILANLQNVSERGFWVMGSGHGLQKLRSFAVTSC  367

Query  533  GCVTDASLAAIADYCSVLRDL  595
              +TD  L A+   C  L+ L
Sbjct  368  QGMTDMGLEALGKGCPNLKQL  388



>gb|EYU20264.1| hypothetical protein MIMGU_mgv1a002548mg [Erythranthe guttata]
Length=660

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +GCP++K   LRKC L+SDNGVVSFV+AA S+ESL L+E HRI+Q G++G+L +  G
Sbjct  384  AIGRGCPDLKVFRLRKCPLVSDNGVVSFVRAAASLESLHLDESHRITQCGIYGVLTNCGG  443

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL   NC G++D+ F  P    CNSLRSL+I +C G G++ L ++ RLCP L H++L
Sbjct  444  KLKALDLANCLGIRDVDFVFPLTSFCNSLRSLTIRDCPGLGNSGLGMVGRLCPKLTHVDL  503

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+LPFVQ  DAGLVK+NLSGC N+TD  +  IAK+HGETLE+LNL+GC  V
Sbjct  504  SGLKGITDAGVLPFVQRADAGLVKLNLSGCANLTDNVVVEIAKVHGETLEVLNLDGCRFV  563

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD SL AIA  C  + +LD+S+
Sbjct  564  TDVSLMAIAKNCLFMSELDVSQ  585


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 90/202 (45%), Gaps = 4/202 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+   CPN+K + L+ C L+ D G+ S   +A  + +    +   IS   +  ++ H   
Sbjct  278  ALGSNCPNLKCVTLKNCPLVGDQGIASLFTSAGHVLAKANLQTLNISDVSL-AVIGHYGT  336

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  L       + +  F V        +++SL+I +C G  DA L  + R CP+L    
Sbjct  337  AMTDLVLGGLHNVNERGFWVMGKGQGLQNMKSLTITSCQGVSDAGLDAIGRGCPDLKVFR  396

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            L     V+D G++ FV++  A L  ++L     +T   I  +    G  L+ L+L  C  
Sbjct  397  LRKCPLVSDNGVVSFVRAA-ASLESLHLDESHRITQCGIYGVLTNCGGKLKALDLANCLG  455

Query  539  VTDASLA-AIADYCSVLRDLDI  601
            + D      +  +C+ LR L I
Sbjct  456  IRDVDFVFPLTSFCNSLRSLTI  477


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 93/204 (46%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++S+GCP++K L L   + + D G+    K   S+E L L  C  ++  G+  I ++   
Sbjct  200  SISRGCPSLKVLSLWNLSSVGDEGLSEIAKGCRSLEKLDLSHCPAVTDKGLIAIAMNCP-  258

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPN-LVHLN  358
             L ++  E+C  + + +        C +L+ +++ NC   GD  +  L     + L   N
Sbjct  259  NLTSVTLESCSNIGNESLKALG-SNCPNLKCVTLKNCPLVGDQGIASLFTSAGHVLAKAN  317

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN ++D   L  +      +  + L G  NV ++    + K  G + ++ L +  C 
Sbjct  318  LQTLN-ISDVS-LAVIGHYGTAMTDLVLGGLHNVNERGFWVMGKGQGLQNMKSLTITSCQ  375

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             V+DA L AI   C  L+   + K
Sbjct  376  GVSDAGLDAIGRGCPDLKVFRLRK  399


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 82/172 (48%), Gaps = 2/172 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C  L ++G+    +    +  + L     I+ AGV   +  +   L  L
Sbjct  469  CNSLRSLTIRDCPGLGNSGLGMVGRLCPKLTHVDLSGLKGITDAGVLPFVQRADAGLVKL  528

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D      A     +L  L++  C    D SL+ +++ C  +  L++S   G
Sbjct  529  NLSGCANLTDNVVVEIAKVHGETLEVLNLDGCRFVTDVSLMAIAKNCLFMSELDVSQC-G  587

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC  532
            +TDYG+    ++    L   +++GC  V+DK++S++  L G++L  LN+  C
Sbjct  588  ITDYGIAVLARAEQLSLQIFSIAGCSLVSDKSLSSLGML-GKSLLGLNIQHC  638



>ref|XP_007204219.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
 gb|EMJ05418.1| hypothetical protein PRUPE_ppa003009mg [Prunus persica]
Length=612

 Score =   240 bits (613),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 156/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLRKC  +SDNG+V F KAA S+ESLQLEEC+R++QAG+   L +   
Sbjct  336  AIGKGCTNLKQMCLRKCCFVSDNGLVGFAKAAGSLESLQLEECNRVTQAGIISALSNCGA  395

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL++L    C G+KD+   VP L  C SLRSLS+ NC GFG ASL ++ RLCP L +++L
Sbjct  396  KLRSLTLVKCMGIKDIGSAVPMLSSCISLRSLSVRNCPGFGSASLALVGRLCPQLQNVDL  455

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+L  ++S + GLVKVNL+GC+N+TD+ + A+A+LHGETLE+L+L+GC  +
Sbjct  456  SGLYGMTDAGILSLLESLEEGLVKVNLNGCLNLTDEVVVALARLHGETLEVLSLDGCRKI  515

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASLAAIAD C  LR+LD+SK
Sbjct  516  TDASLAAIADNCLFLRELDVSK  537



>ref|XP_002524506.1| grr1, plant, putative [Ricinus communis]
 gb|EEF37946.1| grr1, plant, putative [Ricinus communis]
Length=648

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KGC N+KQ+CLRKC  +SDNG+VSF +AA S+ESLQLEEC+R++Q+G+ G + +   
Sbjct  372  AIAKGCTNLKQMCLRKCCFVSDNGLVSFARAAGSLESLQLEECNRVTQSGIVGAISNCGT  431

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL+   C G++D+A  +    PC+SLRSLSI NC GFG ASL ++ +LCP L H++L
Sbjct  432  KLKALSLVKCMGIRDVASQMVVSSPCSSLRSLSIRNCPGFGSASLALVGKLCPQLQHVDL  491

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD GLLP ++S +AGLVKVNLSGC+N+TD+ ISA+A++HG +LELLNL+GC  +
Sbjct  492  SGLCAITDSGLLPLLESSEAGLVKVNLSGCMNLTDEVISALARIHGGSLELLNLDGCRKI  551

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AI   C  L DLD+SK
Sbjct  552  TDASLKAITHNCLFLSDLDVSK  573


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 99/205 (48%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L     ++D G+    K    +E L L  C  I+  G+  I   +  
Sbjct  188  AIARGCPSLRSLSLWDVPSVADEGLFEVAKECHLLEKLDLCNCPSITNKGLIAI-AENCS  246

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPN-LVHL  355
             L +L  E+C  + +   G+ A+   CN L+S+SI +C   GD  +  L     N L  +
Sbjct  247  NLISLNIESCPKIGN--EGIQAIGKFCNKLQSISIKDCRLVGDHGVSSLLSSATNVLSKV  304

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN VTD+  L  +      +  + LS   +V++K    +    G + L  L ++ C
Sbjct  305  KLQALN-VTDFS-LAVIGHYGKVVTNLVLSNLQHVSEKGFWVMGNAQGLQKLMSLTISSC  362

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              +TD S+ AIA  C+ L+ + + K
Sbjct  363  RGITDVSIEAIAKGCTNLKQMCLRK  387


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 91/202 (45%), Gaps = 4/202 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ K C  ++ + ++ C L+ D+GV S + +A ++ S    +   ++      ++ H   
Sbjct  266  AIGKFCNKLQSISIKDCRLVGDHGVSSLLSSATNVLSKVKLQALNVTDFS-LAVIGHYGK  324

Query  182  KLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  L   N   + +  F V         L SL+I +C G  D S+  +++ C NL  + 
Sbjct  325  VVTNLVLSNLQHVSEKGFWVMGNAQGLQKLMSLTISSCRGITDVSIEAIAKGCTNLKQMC  384

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            L     V+D GL+ F ++  + L  + L  C  VT   I       G  L+ L+L  C  
Sbjct  385  LRKCCFVSDNGLVSFARAAGS-LESLQLEECNRVTQSGIVGAISNCGTKLKALSLVKCMG  443

Query  539  VTD-ASLAAIADYCSVLRDLDI  601
            + D AS   ++  CS LR L I
Sbjct  444  IRDVASQMVVSSPCSSLRSLSI  465


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 82/189 (43%), Gaps = 2/189 (1%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            VS  C +++ L +R C       +    K    ++ + L     I+ +G+  +L  S   
Sbjct  453  VSSPCSSLRSLSIRNCPGFGSASLALVGKLCPQLQHVDLSGLCAITDSGLLPLLESSEAG  512

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L  +    C  + D      A     SL  L++  C    DASL  ++  C  L  L++S
Sbjct  513  LVKVNLSGCMNLTDEVISALARIHGGSLELLNLDGCRKITDASLKAITHNCLFLSDLDVS  572

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
                VTD G+     +    L  ++LSGC  V++K+   + KL G TL  LNL  C  ++
Sbjct  573  KC-AVTDSGIATLSSADRLNLQVLSLSGCSEVSNKSFPFLKKL-GRTLMGLNLQNCSSIS  630

Query  545  DASLAAIAD  571
              ++  + +
Sbjct  631  SNTVELLVE  639



>ref|XP_011081561.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=669

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+  GCPN+K   L+KC L+SDNGVVSF KAA S++SL+LE+CHRI+Q GV GIL +  G
Sbjct  393  ALGNGCPNLKVFGLQKCPLVSDNGVVSFAKAAGSLQSLRLEDCHRITQFGVLGILANCGG  452

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA A  NC G++D+ F  P    C SLRSL+I NC G GD  L +L RLCP L H++L
Sbjct  453  KLKAFALTNCLGIRDIDFEFPLTTSCWSLRSLTIRNCPGLGDVGLGMLGRLCPGLTHVDL  512

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD G+LP VQ     LVKVNLSGC+N+TD  ++ I KLHG TLE+LNL+GC C+
Sbjct  513  TGLQGITDSGILPLVQRSGVDLVKVNLSGCVNLTDNLVAEITKLHGGTLEILNLDGCRCI  572

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD SL AIA  CS+L +LD+S+
Sbjct  573  TDVSLKAIARNCSLLSELDVSQ  594


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 87/203 (43%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVS-FVKAAESIESLQLEECHRISQAGVFGILVHSA  178
            A+ + CPN+K + ++ C L+ D G+ S F  A  +I     +  + IS   +  ++ H  
Sbjct  287  ALGRTCPNLKCITIKNCPLVGDQGIASLFSSAGHTITKANFQALN-ISDVSL-AVIGHYG  344

Query  179  GKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
              +  LA     G+ +  F V       + L+SLSI +C G  D  L  L   CPNL   
Sbjct  345  SAMVDLALGGLHGVNERGFWVMGKGQGLHKLKSLSIASCRGVSDVGLEALGNGCPNLKVF  404

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             L     V+D G++ F ++  + L  + L  C  +T   +  I    G  L+   L  C 
Sbjct  405  GLQKCPLVSDNGVVSFAKAAGS-LQSLRLEDCHRITQFGVLGILANCGGKLKAFALTNCL  463

Query  536  CVTDASLA-AIADYCSVLRDLDI  601
             + D      +   C  LR L I
Sbjct  464  GIRDIDFEFPLTTSCWSLRSLTI  486


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 90/229 (39%), Gaps = 56/229 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S+GCP++  L L   + + D G+ +      S+E L L  C  I+  G+  I ++   
Sbjct  209  AISRGCPSLGVLSLWNLSSVGDEGLSAIATGCHSLEKLDLCHCPAITDKGLIAIAMN---  265

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L S++I +C   G+ SL  L R CPNL  + +
Sbjct  266  -------------------------CPNLTSVTIESCLNIGNGSLQALGRTCPNLKCITI  300

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTIS------------AIAKLHG--  499
                 V D G+     S    + K N    +N++D +++            A+  LHG  
Sbjct  301  KNCPLVGDQGIASLFSSAGHTITKANFQA-LNISDVSLAVIGHYGSAMVDLALGGLHGVN  359

Query  500  -------------ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                           L+ L++  C  V+D  L A+ + C  L+   + K
Sbjct  360  ERGFWVMGKGQGLHKLKSLSIASCRGVSDVGLEALGNGCPNLKVFGLQK  408



>ref|XP_011078374.1| PREDICTED: EIN3-binding F-box protein 1-like [Sesamum indicum]
Length=647

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV +GCPN+K +CLRKC  +SDNG+V+F KAA S+ESLQLEE +RI+Q G+   L     
Sbjct  371  AVGRGCPNLKHMCLRKCCFVSDNGLVAFAKAAGSLESLQLEEVNRITQLGILTALSSCIS  430

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+++   C G+KDL+   P L PC SLR LSI +C GFG  SL ++ +LCP L HL+L
Sbjct  431  KLKSVSLVKCMGIKDLSTEFPMLSPCESLRCLSIRSCPGFGSTSLAMVGKLCPQLHHLDL  490

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC+ GL KVNLS C N+TD+ + A+A+LHGETLELLNL+GC  +
Sbjct  491  SGLCGITDAGLLPLLESCETGLAKVNLSDCSNLTDEVVLALARLHGETLELLNLDGCQKI  550

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASLAA+A+ C +L DLD+SK
Sbjct  551  TDASLAALAESCPLLNDLDVSK  572


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 96/204 (47%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L     + D G+    +   S+E L L +C  IS +G+  I   S  
Sbjct  187  AIARGCPSLRVLSLWNVPSIGDEGIFEIARECHSLEKLDLCQCPSISNSGLAAI-AESCP  245

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L +L  E+C  + + +    A   C  L+S++I +C   GD  +  +LS     L  L 
Sbjct  246  NLTSLTIESCPNIGNESLQAIA-KFCPKLQSITIKDCALVGDQGIASLLSSASTVLTKLK  304

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN +TDY  +  +      +  + L G  NV+ K    +    G +TL  L +  C 
Sbjct  305  LQALN-ITDYS-VAVIGHYGMSITNLVLCGLQNVSQKGFWVMGNAKGLQTLSSLTITSCK  362

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTD SL A+   C  L+ + + K
Sbjct  363  GVTDLSLEAVGRGCPNLKHMCLRK  386


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/228 (25%), Positives = 94/228 (41%), Gaps = 28/228 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++K CP ++ + ++ C L+ D G+ S + +A ++ +    +   I+   V  ++ H   
Sbjct  265  AIAKFCPKLQSITIKDCALVGDQGIASLLSSASTVLTKLKLQALNITDYSV-AVIGHYGM  323

Query  182  KLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH--  352
             +  L       +    F V        +L SL+I +C G  D SL  + R CPNL H  
Sbjct  324  SITNLVLCGLQNVSQKGFWVMGNAKGLQTLSSLTITSCKGVTDLSLEAVGRGCPNLKHMC  383

Query  353  ------------------------LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV  460
                                    L L  +N +T  G+L  + SC + L  V+L  C+ +
Sbjct  384  LRKCCFVSDNGLVAFAKAAGSLESLQLEEVNRITQLGILTALSSCISKLKSVSLVKCMGI  443

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             D +         E+L  L++  C      SLA +   C  L  LD+S
Sbjct  444  KDLSTEFPMLSPCESLRCLSIRSCPGFGSTSLAMVGKLCPQLHHLDLS  491



>gb|KJB27084.1| hypothetical protein B456_004G276800 [Gossypium raimondii]
Length=636

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 159/203 (78%), Gaps = 3/203 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N++Q+CLR+C  +SD+G+V+F K+A S+ESLQLEEC+RI+Q+G  G+L + + 
Sbjct  363  AMGKGCANLRQMCLRRCCFISDDGLVAFAKSAGSLESLQLEECNRITQSGTIGVLSNCS-  421

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G+KD++  VP L  CNSL+SLS+ NC GFG A L V+ RLCP L H++L
Sbjct  422  -LKSLTVVKCMGIKDISSEVP-LSCCNSLKSLSVRNCPGFGTAGLAVVGRLCPQLQHVDL  479

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC+AGLVKVNLSGC+N+TDK + A+ +LHG TLELLNL+GC  +
Sbjct  480  SGLCGITDAGLLPLLESCEAGLVKVNLSGCLNITDKVVLALTRLHGGTLELLNLDGCRRI  539

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDASL AIA+ C  L DLD+S+S
Sbjct  540  TDASLMAIAESCVFLSDLDVSRS  562


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 95/201 (47%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L     + D G+    K    +E L L +C   S  G+  I   +  
Sbjct  179  AIARGCPSLKALSLWNVPRVGDEGLSEIAKECHLLEKLDLCQCPSFSNKGLIAI-AENCP  237

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHL  355
             L +L+ E+C  + +   G+ A+   C  L+S+SI +C   GD     +LS     L  +
Sbjct  238  NLTSLSIESCPKIGN--EGLQAIGKLCPKLQSVSIKDCLLVGDHGVSSLLSSTSSVLSKV  295

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
               GLN +TD+  L  +      +  + LSG  NV++K    +    G + L  L +  C
Sbjct  296  KFQGLN-ITDFS-LAVIGHYGKSVTNLMLSGLENVSEKGFWVMGNAQGLQKLVSLTIISC  353

Query  533  GCVTDASLAAIADYCSVLRDL  595
              VTD SL A+   C+ LR +
Sbjct  354  RGVTDVSLEAMGKGCANLRQM  374



>ref|XP_008219497.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like 
[Prunus mume]
Length=630

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 146/189 (77%), Gaps = 1/189 (1%)
 Frame = +2

Query  41   LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM  220
            +RKC  +SD+G+VSF KAA S+ESL LEECHRI+Q G FG L   A KLKA+AF  C G+
Sbjct  368  VRKCLFISDSGLVSFCKAAGSLESLHLEECHRITQYGFFGALSTGA-KLKAVAFVYCLGL  426

Query  221  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP  400
            KDL  G+P + PC SLRSLSI NC GFG+A L +L RLCP L H++ SGL G+TD G LP
Sbjct  427  KDLNLGLPEVSPCQSLRSLSIRNCPGFGNAGLALLGRLCPQLQHVDFSGLEGITDAGFLP  486

Query  401  FVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCS  580
             +++C+AGLVKVNLSGC+NVTDK +S++AKLHG TLE++NL GC  ++DA L AIA  C 
Sbjct  487  LLENCEAGLVKVNLSGCVNVTDKMVSSMAKLHGWTLEMVNLEGCKMISDAGLVAIAGNCP  546

Query  581  VLRDLDISK  607
            +L DLD+S+
Sbjct  547  LLSDLDVSR  555


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 85/186 (46%), Gaps = 8/186 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S GCP+++ L L   + + D G+         +E L L +C  IS  G+  I      
Sbjct  187  AISHGCPSLRVLSLWNVSSIGDEGLCEIANRCHMLEKLDLSQCPAISDKGLVAI-AKKCP  245

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  L+ E+C  + +   G+ A+   C +L+S+SI NC   GD  +  +LS +   L  +
Sbjct  246  NLTDLSLESCSNIGN--EGLQAIGQCCPNLKSISIKNCPLVGDQGIASLLSSVSYVLTKV  303

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L  +TD   L  +      +  + L+   NVT+K    +   HG + L+   +  C
Sbjct  304  KLQSLT-ITDVS-LAVIGHYGKAITDLVLTSVPNVTEKGFWVMGNGHGLQKLKSFTVTSC  361

Query  533  GCVTDA  550
              VTD 
Sbjct  362  QGVTDT  367



>ref|XP_003522614.1| PREDICTED: EIN3-binding F-box protein 1-like isoform 1 [Glycine 
max]
 gb|KHN08132.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=636

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +GCPNV+   LRKC  LSD G+VSF +AA S+ESLQL+ECHRI+Q G+FG+  +   
Sbjct  360  AIGRGCPNVQNFKLRKCAFLSDKGLVSFARAAPSVESLQLQECHRITQIGLFGVFFNCGA  419

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L   +C+G+KDL   +PA+ P  S+ SL+I +C GFGDA+L +L +LCP + H+ L
Sbjct  420  KLKVLTLISCYGIKDLNMELPAISPSESIWSLTIRDCPGFGDANLALLGKLCPRIQHVEL  479

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD G LP ++S +AGLVKVNLSGC+N+TD+ + ++   HG TLE+L+L+GC  V
Sbjct  480  SGLQGVTDAGFLPLLESSEAGLVKVNLSGCVNLTDRVVLSMVNSHGWTLEVLSLDGCKRV  539

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIA  C VL DLD+S+
Sbjct  540  SDASLMAIAGSCPVLADLDVSR  561


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 97/204 (48%), Gaps = 7/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP++K   L     + D G++        +E L L +C  IS   +  +   +  
Sbjct  177  AIAHGCPSLKVCSLWDVATVDDEGLIEIASGCHRLEKLDLCKCPNISDKTLIAV-AKNCP  235

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
            KL  L+ E+C  + +   G+ A+  C +LRS+SI +C+G GD  +  VLS     L  + 
Sbjct  236  KLAELSIESCPNIGN--EGLQAIGKCPNLRSISIKDCSGVGDQGVAGVLSSASFALTKVK  293

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN V+D   L  +      +  + LS   NV++K    +   HG + L  + ++ C 
Sbjct  294  LESLN-VSDLS-LAVIGHYGIAVTDLVLSCLPNVSEKGFWVMGNGHGLQKLTSITIDCCR  351

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTD  L AI   C  +++  + K
Sbjct  352  GVTDVGLEAIGRGCPNVQNFKLRK  375



>gb|EYU32346.1| hypothetical protein MIMGU_mgv1a002758mg [Erythranthe guttata]
Length=640

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ KGCP++K L LRKC  +SDNGVVSF +AAES+ESL+LEECH I+Q GVFGIL +   
Sbjct  364  SLGKGCPDIKTLALRKCPRVSDNGVVSFARAAESLESLRLEECHVITQRGVFGILANCGK  423

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA+   NC G +DL F  P    C SLRSL+I NC GFGDA L  L ++CPNL H++L
Sbjct  424  KLKAIVLVNCLGNRDLGFRFPLTSRCRSLRSLTIRNCPGFGDAGLGGLGKICPNLTHVDL  483

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SG   +TD  +LP V+S + GLV+V LSGC  +TD T++ IAKLHG+TL+LL L+GC CV
Sbjct  484  SGNKEITDACILPLVESSEDGLVEVKLSGCDKLTDNTVTVIAKLHGDTLDLLKLDGCRCV  543

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL  IA  C VL +LD+S+
Sbjct  544  TDASLIEIASNCMVLSELDVSR  565


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 94/204 (46%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S+GCP+++ L L   + + D G+     A  S+E +Q   C  I+  G+  I   +  
Sbjct  180  AISRGCPSLRALSLWDVSPVGDEGLCEIASACHSLEDIQFFHCPNITDKGLVAI-AKNCP  238

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVL-SRLCPNLVHLN  358
             L ++A E+C  + + +        C  L+ +SI NC   GD  +  L S +   L    
Sbjct  239  NLTSVAVESCLNIGNESLQALG-NYCPDLKFVSIKNCPLVGDKGIASLFSSVGHVLTRAK  297

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN ++D   L  +      ++ + L G  NV++K    + K HG   L+ L +  C 
Sbjct  298  LQTLN-ISDVS-LAVIGHYGTAMIDLTLVGLQNVSEKGFWLMGKGHGLRKLKSLTVTSCP  355

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             V+D  L ++   C  ++ L + K
Sbjct  356  GVSDLGLESLGKGCPDIKTLALRK  379


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 88/185 (48%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    D G+    K   ++  + L     I+ A +  ++  S   L  +
Sbjct  449  CRSLRSLTIRNCPGFGDAGLGGLGKICPNLTHVDLSGNKEITDACILPLVESSEDGLVEV  508

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D    V A    ++L  L +  C    DASL+ ++  C  L  L++S   G
Sbjct  509  KLSGCDKLTDNTVTVIAKLHGDTLDLLKLDGCRCVTDASLIEIASNCMVLSELDVSRC-G  567

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD G+    ++    L+  +++GC  V+D+++  + +L G+T+  LN+  CG +T  ++
Sbjct  568  ITDSGIKVLAEAVQMSLLTFSIAGCSLVSDESLPFLVEL-GKTMVGLNVQYCGGITSGAV  626

Query  557  AAIAD  571
              + D
Sbjct  627  DLLVD  631



>ref|XP_010696236.1| PREDICTED: EIN3-binding F-box protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 148/204 (73%), Gaps = 2/204 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+KQ  L+KC  +SDNG++SF KAA S+ESLQ+EECHRI+Q G FG+L++   
Sbjct  363  AVGKGCPNLKQFVLKKCAFMSDNGLMSFAKAARSLESLQIEECHRITQIGFFGLLLNCGP  422

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKAL   +CFG KD+  G P       LRS+++ NC G GD +L +L++LCP L  +N 
Sbjct  423  KLKALTMSSCFGFKDMILGFPLPNKSAPLRSVTVSNCPGLGDMTLAMLAKLCPQLQCVNF  482

Query  362  SGLNGVTDYGLLPFVQSCD--AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             GL  +TD GLL  ++SCD  AGLVKV LSGC+NVTD  + A+AK HG TLE+LNL GCG
Sbjct  483  HGLPYITDAGLLSLIESCDAGAGLVKVGLSGCVNVTDNVVIALAKYHGGTLEVLNLEGCG  542

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTDA L AIAD C VL +LD+SK
Sbjct  543  KVTDAGLVAIADDCLVLNELDVSK  566


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 94/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++ CP++K + L   + + D G+V        +E L L  C  I+   +F I   +  
Sbjct  179  AVARCCPSLKSVSLWNVSSVGDEGLVEIANGCHRLEKLDLCNCPSITNKALFAI-AKNCP  237

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L +L+ E C  + +   GV A+   C +L+S++I +C   GD  +  ++S     L  L
Sbjct  238  TLTSLSIEGCQYIGN--EGVQAIGQFCPNLKSVTIKDCPLVGDQGVASLMSSASFVLTKL  295

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L GLN VTD   L  +      +  + L+   NV +K    +    G + L    ++ C
Sbjct  296  KLQGLN-VTDLS-LAVIGHYGKTVTDLVLANLQNVNEKGFWVMGNAQGLQHLRSFTISSC  353

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD ++ A+   C  L+   + K
Sbjct  354  RGVTDVAVEAVGKGCPNLKQFVLKK  378


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 90/204 (44%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESI-ESLQLEECHRISQAGVFGILVHSA  178
            A+ + CPN+K + ++ C L+ D GV S + +A  +   L+L+  +    +    ++ H  
Sbjct  257  AIGQFCPNLKSVTIKDCPLVGDQGVASLMSSASFVLTKLKLQGLNVTDLS--LAVIGHYG  314

Query  179  GKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
              +  L   N   + +  F V         LRS +I +C G  D ++  + + CPNL   
Sbjct  315  KTVTDLVLANLQNVNEKGFWVMGNAQGLQHLRSFTISSCRGVTDVAVEAVGKGCPNLKQF  374

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             L     ++D GL+ F ++  + L  + +  C  +T      +    G  L+ L ++ C 
Sbjct  375  VLKKCAFMSDNGLMSFAKAARS-LESLQIEECHRITQIGFFGLLLNCGPKLKALTMSSCF  433

Query  536  CVTDASLA-AIADYCSVLRDLDIS  604
               D  L   + +  + LR + +S
Sbjct  434  GFKDMILGFPLPNKSAPLRSVTVS  457


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (55%), Gaps = 2/102 (2%)
 Frame = +2

Query  296  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI  475
            G  D  L  ++R CP+L  ++L  ++ V D GL+     C   L K++L  C ++T+K +
Sbjct  171  GVTDLGLKAVARCCPSLKSVSLWNVSSVGDEGLVEIANGCHR-LEKLDLCNCPSITNKAL  229

Query  476  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
             AIAK +  TL  L++ GC  + +  + AI  +C  L+ + I
Sbjct  230  FAIAK-NCPTLTSLSIEGCQYIGNEGVQAIGQFCPNLKSVTI  270



>ref|XP_003542675.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN47145.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+K LCLR+C  +SDNG+V+F KAA S+ESLQLEEC+R +Q+G+   L     
Sbjct  363  AIGKGCINLKHLCLRRCCFVSDNGLVAFAKAAISLESLQLEECNRFTQSGIIVALADIKT  422

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+LA   C G+KD+   V  L PC SL+SL+I  C GFG ASL  + +LCP L HLNL
Sbjct  423  KLKSLALVKCMGVKDIDMEVSMLSPCESLQSLAIQKCPGFGSASLATIGKLCPQLQHLNL  482

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD GLLP +++C+AGLV VNL+GC N+TD  +SA+A+LHG TLE+LNL+GC  +
Sbjct  483  TGLYGITDAGLLPLLENCEAGLVNVNLTGCWNLTDNIVSALARLHGGTLEVLNLDGCWKI  542

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+   VL DLD+SK
Sbjct  543  TDASLVAIANNFLVLNDLDVSK  564


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 88/199 (44%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP+++ L L   + + D G+    K    +E L L  C  IS  G+  I      
Sbjct  180  AVAHGCPSLRSLSLWNVSTIGDEGLSQVAKGCHMLEKLDLCHCSSISNKGLIAI-AEGCP  238

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L  L  E+C  + +      A   C  L+S+SI +C   GD  +  L     NL  + L
Sbjct  239  NLTTLTIESCPNIGNEGLQATA-RLCPKLQSISIKDCPLVGDHGVSSLLASASNLSRVKL  297

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGC  538
              LN +TD+ L        A +  + LSG  NVT++    +    G + L  L +  C  
Sbjct  298  QTLN-ITDFSLAVICHYGKA-ITNLVLSGLKNVTERGFWVMGAAQGLQKLLSLTVTACRG  355

Query  539  VTDASLAAIADYCSVLRDL  595
            VTD S+ AI   C  L+ L
Sbjct  356  VTDTSIEAIGKGCINLKHL  374


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 96/228 (42%), Gaps = 29/228 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A ++ CP ++ + ++ C L+ D+GV S + +A ++  ++L+  +    +    ++ H   
Sbjct  258  ATARLCPKLQSISIKDCPLVGDHGVSSLLASASNLSRVKLQTLNITDFS--LAVICHYGK  315

Query  182  KLKALAFENCFGMKDLAFGV-PALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  L       + +  F V  A      L SL++  C G  D S+  + + C NL HL 
Sbjct  316  AITNLVLSGLKNVTERGFWVMGAAQGLQKLLSLTVTACRGVTDTSIEAIGKGCINLKHLC  375

Query  359  LSGLNGVTDYGLLPFVQSC---------------DAGLV-----------KVNLSGCINV  460
            L     V+D GL+ F ++                 +G++            + L  C+ V
Sbjct  376  LRRCCFVSDNGLVAFAKAAISLESLQLEECNRFTQSGIIVALADIKTKLKSLALVKCMGV  435

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             D  +        E+L+ L +  C     ASLA I   C  L+ L+++
Sbjct  436  KDIDMEVSMLSPCESLQSLAIQKCPGFGSASLATIGKLCPQLQHLNLT  483



>ref|XP_003549759.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN15084.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=639

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQLCL +C  +SD+G+V+F KAA S+ESLQLEEC+R +Q+G+   L +   
Sbjct  363  AIGKGCINLKQLCLHRCCFVSDSGLVAFAKAAVSLESLQLEECNRFTQSGIIVALANIKT  422

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+KD+   V  L PC SLRSL I  C GFG ASL ++ +LCP L HLNL
Sbjct  423  KLKSLSLVKCMGVKDIDMEVCMLSPCESLRSLVIQKCPGFGSASLAMIGKLCPRLQHLNL  482

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD GLLP +++C+AGLV VNL+GC N+TDK +SA+A+LHG TLE+LNL+GC  +
Sbjct  483  TGLYGITDAGLLPLLENCEAGLVNVNLTGCWNLTDKVVSALARLHGGTLEVLNLDGCWKI  542

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+   VL DLD+SK
Sbjct  543  TDASLVAIANNFLVLNDLDVSK  564


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 90/200 (45%), Gaps = 7/200 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP+++ L L   + + D GV    K    +E L L  C  IS  G+  I      
Sbjct  180  AVAHGCPSLRSLSLWNVSTIGDEGVSQIAKGCHILEKLDLCHCSSISNKGLIAI-AEGCP  238

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             L  L  E+C  + +   G+ A+   C  L+S+S+ +C   GD  +  L     NL  + 
Sbjct  239  NLTTLTIESCPNIGN--EGLQAIARLCTKLQSISLKDCPLVGDHGVSSLLASASNLSRVK  296

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  L  +TD+ L        A +  + LSG  NVT++    +    G + L  L +  C 
Sbjct  297  LQTLK-ITDFSLAVICHYGKA-ITNLVLSGLKNVTERGFWVMGAAQGLQKLVSLTVTSCR  354

Query  536  CVTDASLAAIADYCSVLRDL  595
             +TD S+ AI   C  L+ L
Sbjct  355  GITDTSIEAIGKGCINLKQL  374


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 90/205 (44%), Gaps = 35/205 (17%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCPN+  L +  C  + + G+ +  +    ++S+ L++C  +   GV  +L  SA 
Sbjct  232  AIAEGCPNLTTLTIESCPNIGNEGLQAIARLCTKLQSISLKDCPLVGDHGVSSLLA-SAS  290

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L  +                       L++L I       D SL V+      + +L L
Sbjct  291  NLSRV----------------------KLQTLKIT------DFSLAVICHYGKAITNLVL  322

Query  362  SGLNGVTDYGLLPFVQSCDAG---LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC  532
            SGL  VT+ G   +V     G   LV + ++ C  +TD +I AI K     L+ L L+ C
Sbjct  323  SGLKNVTERGF--WVMGAAQGLQKLVSLTVTSCRGITDTSIEAIGK-GCINLKQLCLHRC  379

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              V+D+ L A A     L  L + +
Sbjct  380  CFVSDSGLVAFAKAAVSLESLQLEE  404



>ref|XP_007013466.1| Ein3-binding f-box protein 4 [Theobroma cacao]
 gb|EOY31085.1| Ein3-binding f-box protein 4 [Theobroma cacao]
Length=692

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 156/202 (77%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLR+C  LSD+G+V+F K+A S+E LQLEEC+R++Q+G+  +L +   
Sbjct  418  AMGKGCTNLKQMCLRRCCFLSDDGLVAFAKSAGSLECLQLEECNRVTQSGIIRVLSNCG-  476

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G+KD++ G P    CNSL+SLS+ NC GFG ASL ++ +LCP L H++L
Sbjct  477  -LKSLTLVKCLGIKDMSLGAPLSSTCNSLKSLSVRNCPGFGTASLAMVGKLCPQLQHVDL  535

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC+AGLVKVNLSGC+N+TD+ + A+ +LHG TLELLNL+GC  +
Sbjct  536  SGLYGITDAGLLPLLESCEAGLVKVNLSGCLNLTDEVVLALTRLHGGTLELLNLDGCRRI  595

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL A+AD C  L DLD+S+
Sbjct  596  TDASLVAVADNCVFLSDLDVSR  617


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 88/226 (39%), Gaps = 58/226 (26%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L L     + D G+    K    +E L L +C  +S  G+  I      
Sbjct  234  AIARGCPSLKALSLWNIPCVGDEGLSEIAKECHLLEKLDLCQCPLVSNKGLIAIA-----  288

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNL-----  346
                   ENC                 +L SLSI +C   G+  L  + +LCP L     
Sbjct  289  -------ENC----------------PNLTSLSIESCPKIGNEGLQAIGKLCPKLQSISI  325

Query  347  ----------------------VHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV  460
                                    + L GLN +TD+  L  +      +  + LSG  NV
Sbjct  326  KDCPLVGDHGVSSLLASASSVLSKVKLQGLN-ITDFS-LAVIGHYGKSVTNLMLSGLQNV  383

Query  461  TDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDL  595
            ++K    +    G + L  L +  C  VTD SL A+   C+ L+ +
Sbjct  384  SEKGFWVMGNAQGLQKLASLMITSCWGVTDVSLEAMGKGCTNLKQM  429



>ref|XP_009791397.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana sylvestris]
Length=637

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 153/201 (76%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGC N+K +C+RKC  +SD G+V+F KAA S+ES+ LEEC+RI+Q G+  + V +  
Sbjct  363  AVGKGCLNLKHMCIRKCCFISDGGLVAFAKAAGSLESVHLEECNRITQTGILNV-VSNCR  421

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+KDLA     L PC SLRSLSI +C GFG  SL ++ +LCP L  L+L
Sbjct  422  KLKSLSLVKCMGIKDLALQTSLLSPCESLRSLSIRSCPGFGSTSLAMVGKLCPKLHQLDL  481

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC+AGLVKVNLS C+N+TD+ + ++A+LHGETLELLNL+GC  V
Sbjct  482  SGLCGITDAGLLPLLESCEAGLVKVNLSDCLNLTDRVVLSLARLHGETLELLNLDGCRKV  541

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL AIAD C +L DLD+S
Sbjct  542  TDASLVAIADNCPLLNDLDVS  562


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 97/205 (47%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G+ +  +   S+E L L +C  IS  G+  I   +  
Sbjct  179  AIAHGCPSLRVLSLWNVPSIGDEGLFAIARECNSLEKLDLSQCPSISNKGLVAI-AENCP  237

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C  L+SL+I +C   GD  +  +LS     L  +
Sbjct  238  SLTSLTIESCANIGN--EGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGATMLTKV  295

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L GLN +TD+  L  +      +  +NLS   NV+ K    +    G ++L  L +  C
Sbjct  296  KLHGLN-ITDFS-LAVIGHYGKMIANLNLSSLRNVSQKGFWVMGNAQGLQSLVSLTITLC  353

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD  L A+   C  L+ + I K
Sbjct  354  RGATDVGLEAVGKGCLNLKHMCIRK  378



>gb|KJB54023.1| hypothetical protein B456_009G017100 [Gossypium raimondii]
Length=645

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 155/202 (77%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLR+C  +S +G+V+F K+A S+E LQLEEC+R++Q+GV G+L +   
Sbjct  371  AIGKGCANLKQMCLRRCCFVSGDGLVAFAKSAGSLECLQLEECNRVTQSGVIGVLSNCG-  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G+KD++   P    CNSL+SLSI NC GFG ASL ++ RLCP L H++L
Sbjct  430  -LKSLTLVKCMGIKDISLEAPLSSSCNSLKSLSIRNCPGFGTASLAMVGRLCPQLQHVDL  488

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP +++C+AGLVKVNLSGC+N+TD+ +  + KLHG TLELLNLNGC  +
Sbjct  489  SGLCGITDAGLLPLLENCEAGLVKVNLSGCLNLTDEVVLHLTKLHGATLELLNLNGCRRI  548

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASLAA+A+ C  L DLD+S+
Sbjct  549  TDASLAAVAENCVFLSDLDVSR  570


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 85/224 (38%), Gaps = 54/224 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP++K L L     + D G+    K    +E L L +C  +S  G+  I  +   
Sbjct  187  AVARGCPSLKVLSLWNVPRVGDEGLCEIAKECHLLEKLDLCQCPHLSNKGLIAIAAN---  243

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L +LSI +C   G+  L  + +LCP L  +++
Sbjct  244  -------------------------CPNLTALSIQSCPKIGNEGLQAIGKLCPKLQSISI  278

Query  362  SGLNGVTDYGL-------------------------LPFVQSCDAGLVKVNLSGCINVTD  466
                 V D+G+                         L  +      +  + LSG  NV++
Sbjct  279  KDCPLVGDHGVSSLLSSASSVLSKVKLQGLSITDFSLAVIGHYGKSVTNLMLSGLQNVSE  338

Query  467  KTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDL  595
            K    +    G + L    +  C  VTD SL AI   C+ L+ +
Sbjct  339  KGFWVMGNAQGLQKLVSFTIASCWGVTDVSLEAIGKGCANLKQM  382



>ref|XP_010086585.1| hypothetical protein L484_002248 [Morus notabilis]
 gb|EXB21298.1| hypothetical protein L484_002248 [Morus notabilis]
Length=642

 Score =   233 bits (595),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +GC N+KQ+CLRKC L+SDNG+V+  K A S+E LQLEEC+R++QAG+ G L +   
Sbjct  366  AMGRGCANLKQMCLRKCCLVSDNGLVALAKTAASLEGLQLEECNRVTQAGIVGALSNCGE  425

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L    C G+K +A GVP L PC SLRSLSI NC GFG  SL ++  LCP L H++L
Sbjct  426  KLKSLTLVKCLGIKGIACGVPMLSPCRSLRSLSIRNCPGFGSLSLAMVGSLCPQLQHVDL  485

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+LP ++  + GLV VNLSGC+N+TD+ + A+AKLHGETLE+LNL+GC  +
Sbjct  486  SGLYGITDAGILPLLERPEEGLVSVNLSGCLNLTDEVVVALAKLHGETLEMLNLDGCRKI  545

Query  542  TDASLAAIADYC  577
            TDASLAAIA+ C
Sbjct  546  TDASLAAIAENC  557


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 61/205 (30%), Positives = 97/205 (47%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S+GCP++K L L     + D G+    K    +E L L  C  IS  G+  I   S  
Sbjct  182  AISRGCPSLKALSLWNVPFVGDEGLFEIAKGCPLLEKLDLCHCPSISNKGLIAI-AESCP  240

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHL  355
             L AL+ E+C  + +   G+ A+   C+ L+S+SI +C   GD     +LS     L  +
Sbjct  241  NLTALSVESCSKIGN--EGLQAIGKLCSKLQSVSIRDCPLVGDHGVSSLLSSASSVLTKV  298

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  +  +      +  + LSG  NV++K    +    G + L  L +  C
Sbjct  299  KLQALN-ITDFS-IAVIGHYGKNITNLTLSGLQNVSEKGFWVMGNAQGLQKLVSLTITSC  356

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD SL A+   C+ L+ + + K
Sbjct  357  RGATDLSLEAMGRGCANLKQMCLRK  381



>ref|XP_010526214.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=641

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KG PN+K+L L KC LLSDNG+VSF K++ S+ESLQLEECHR++Q G FG L++   
Sbjct  365  AVGKGSPNLKKLFLSKCPLLSDNGLVSFAKSSSSVESLQLEECHRVTQFGFFGSLLYCGA  424

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL+A +  NC G++DL  G+P   PCN+LRSLSI NC GFGDA+L  L +LCP L  +  
Sbjct  425  KLRAFSLANCLGIRDLTTGLPVSSPCNTLRSLSIRNCPGFGDANLAALGKLCPRLQDVVF  484

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GLNG+TD GLL  VQ+    LVKVNLSGC N+TD+ +SAI+     TLE LNL GC  +
Sbjct  485  CGLNGITDSGLLQLVQTSQLSLVKVNLSGCSNLTDRVVSAISVQSDWTLEALNLEGCTKI  544

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL +IA+ C +L DLD+S
Sbjct  545  TDASLISIAENCQILSDLDVS  565


 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 89/184 (48%), Gaps = 2/184 (1%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            VS  C  ++ L +R C    D  + +  K    ++ +     + I+ +G+  ++  S   
Sbjct  446  VSSPCNTLRSLSIRNCPGFGDANLAALGKLCPRLQDVVFCGLNGITDSGLLQLVQTSQLS  505

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L  +    C  + D      ++    +L +L++  CT   DASL+ ++  C  L  L++S
Sbjct  506  LVKVNLSGCSNLTDRVVSAISVQSDWTLEALNLEGCTKITDASLISIAENCQILSDLDVS  565

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
                VTD+G+     S    L  ++LSGC  VTDK++ A+ KL G TL  LN+  C  ++
Sbjct  566  NC-AVTDFGVQGLASSNKLSLQILSLSGCSMVTDKSMPALGKL-GRTLLGLNVQNCQSIS  623

Query  545  DASL  556
             A++
Sbjct  624  TANV  627


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 63/229 (28%), Positives = 99/229 (43%), Gaps = 36/229 (16%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFV-KAAESIESLQLEECH----RISQAGVFGIL  166
            AV++ CP +K + ++ C L+ D G+VS + KA  S+  L+L+        ++  G +GI 
Sbjct  259  AVAQFCPKLKSVSIKNCPLVRDQGIVSLLSKATYSLMKLKLQMLKITDVSLAVVGHYGIS  318

Query  167  VHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNL  346
            V     L  L   +  G   +  GV        L SL++ +C G  D SL  + +  PNL
Sbjct  319  VADL-VLSGLPNVSEKGFWVMGNGVGL----QKLNSLTVTSCPGLTDMSLEAVGKGSPNL  373

Query  347  VHLNLSGLNGVTDYGLLPFVQS--------------------------CDAGLVKVNLSG  448
              L LS    ++D GL+ F +S                          C A L   +L+ 
Sbjct  374  KKLFLSKCPLLSDNGLVSFAKSSSSVESLQLEECHRVTQFGFFGSLLYCGAKLRAFSLAN  433

Query  449  CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL  595
            C+ + D T          TL  L++  C    DA+LAA+   C  L+D+
Sbjct  434  CLGIRDLTTGLPVSSPCNTLRSLSIRNCPGFGDANLAALGKLCPRLQDV  482


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 95/204 (47%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +GCP+++ L L   + +SDNG++   K    +E L L  C  ++   +  I      
Sbjct  181  AIGRGCPSLRVLSLWNLSTISDNGLLEIAKGCSQLEKLDLCRCPTVTDKALVAI-AKCCP  239

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             +  L+ E+C  + +      A   C  L+S+SI NC    D  +V +LS+   +L+ L 
Sbjct  240  NMSELSIESCSSIGNECLQAVA-QFCPKLKSVSIKNCPLVRDQGIVSLLSKATYSLMKLK  298

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  L  +TD   L  V      +  + LSG  NV++K    +    G + L  L +  C 
Sbjct  299  LQMLK-ITDVS-LAVVGHYGISVADLVLSGLPNVSEKGFWVMGNGVGLQKLNSLTVTSCP  356

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             +TD SL A+      L+ L +SK
Sbjct  357  GLTDMSLEAVGKGSPNLKKLFLSK  380


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 61/115 (53%), Gaps = 5/115 (4%)
 Frame = +2

Query  266  LRSLSIC---NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV  436
            L  LSIC   + +   D  L  + R CP+L  L+L  L+ ++D GLL   + C + L K+
Sbjct  160  LGKLSICGNNSASRVSDLGLRAIGRGCPSLRVLSLWNLSTISDNGLLEIAKGC-SQLEKL  218

Query  437  NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            +L  C  VTDK + AIAK      E L++  C  + +  L A+A +C  L+ + I
Sbjct  219  DLCRCPTVTDKALVAIAKCCPNMSE-LSIESCSSIGNECLQAVAQFCPKLKSVSI  272



>ref|XP_007137020.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
 gb|ESW09014.1| hypothetical protein PHAVU_009G093200g [Phaseolus vulgaris]
Length=643

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPNVK   LRKC  LSD G+VSF +AA SIESLQL+ECHRI+Q G+FG+  H A 
Sbjct  367  AIGKGCPNVKNFQLRKCAFLSDKGLVSFTRAALSIESLQLQECHRITQIGLFGVFFHCAA  426

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L   +C+G+KDL   +PA+ PC S  SL++ +C  FGDA+L +L +LCP L H+ L
Sbjct  427  KLKVLTLISCYGIKDLNADLPAMSPCESFWSLTVRDCPEFGDANLALLGKLCPQLRHVEL  486

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD G LP ++  + GL  VNL GCINVTD+ +  I   HG TL++L L+GC  V
Sbjct  487  SGLQRVTDAGFLPLLECSETGLTTVNLRGCINVTDRVVLPIVNSHGWTLQVLCLDGCKRV  546

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDAS+ AIA  C +L DLD+SK
Sbjct  547  TDASMMAIAGNCPMLSDLDVSK  568


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/190 (26%), Positives = 89/190 (47%), Gaps = 10/190 (5%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +   L +R C    D  +    K    +  ++L    R++ AG   +L  S   L  +
Sbjct  452  CESFWSLTVRDCPEFGDANLALLGKLCPQLRHVELSGLQRVTDAGFLPLLECSETGLTTV  511

Query  197  AFENCFGMKDLAFGVPALPPCNS----LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
                C  + D       LP  NS    L+ L +  C    DAS++ ++  CP L  L++S
Sbjct  512  NLRGCINVTDRV----VLPIVNSHGWTLQVLCLDGCKRVTDASMMAIAGNCPMLSDLDVS  567

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
                +TD G+    +     L  ++L+GCI+V+DK++ A+ KL G++L  LN+  C  ++
Sbjct  568  KC-AITDTGIAALARGNQISLEILSLAGCISVSDKSMPALKKL-GQSLAGLNIKRCSAIS  625

Query  545  DASLAAIADY  574
               ++ + ++
Sbjct  626  SRGVSKLQEH  635


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 84/228 (37%), Gaps = 54/228 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP++K   +     + D G++        +E L L +C  IS   +  +      
Sbjct  183  AIAHGCPSLKVFSVFDVATIDDEGLIEIASGCHKLEKLDLCKCPNISDKTLIAVS-----  237

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L  LSI +C   G+  L  + +LCP L  +++
Sbjct  238  -----------------------KKCPNLAELSIESCPNIGNIGLQAIGKLCPKLRSISI  274

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI-------------------------NVTD  466
             G +GV D G+   + S    L KV L   +                         NVT+
Sbjct  275  KGCSGVGDQGVCGLLSSTSYVLSKVKLESLMVSDLSLATIGHYGFQVTDLVLSCLPNVTE  334

Query  467  KTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            K    +    G + L  + + GC  +TD  + AI   C  +++  + K
Sbjct  335  KGFWVMGNSRGLQKLNSITIEGCQGLTDTGIEAIGKGCPNVKNFQLRK  382


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 95/253 (38%), Gaps = 52/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AVSK CPN+ +L +  C  + + G+ +  K    + S+ ++ C  +   GV G+L  ++ 
Sbjct  235  AVSKKCPNLAELSIESCPNIGNIGLQAIGKLCPKLRSISIKGCSGVGDQGVCGLLSSTSY  294

Query  182  KLKALAFENC------------FGMKDLAFGVPALPPC--------------NSLRSLSI  283
             L  +  E+             +G +     +  LP                  L S++I
Sbjct  295  VLSKVKLESLMVSDLSLATIGHYGFQVTDLVLSCLPNVTEKGFWVMGNSRGLQKLNSITI  354

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
              C G  D  +  + + CPN+ +  L     ++D GL+ F ++                 
Sbjct  355  EGCQGLTDTGIEAIGKGCPNVKNFQLRKCAFLSDKGLVSFTRAALSIESLQLQECHRITQ  414

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C A L  + L  C  + D      A    E+   L +  C    DA+LA +
Sbjct  415  IGLFGVFFHCAAKLKVLTLISCYGIKDLNADLPAMSPCESFWSLTVRDCPEFGDANLALL  474

Query  566  ADYCSVLRDLDIS  604
               C  LR +++S
Sbjct  475  GKLCPQLRHVELS  487



>gb|EYU23011.1| hypothetical protein MIMGU_mgv1a002803mg [Erythranthe guttata]
Length=636

 Score =   230 bits (587),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 148/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ KGCPN+K +CLRKC  +SD G+V+F K   S+ESLQLEEC+RI+Q G+   L     
Sbjct  360  SLGKGCPNLKHVCLRKCYFVSDKGLVAFAKGVTSLESLQLEECNRITQIGILNALSSCVS  419

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+++   C G+KDLA  +P+L PC SLRSLSI NC GFG  SL ++ +LCPNL HL+L
Sbjct  420  KLKSVSLVKCMGIKDLATEIPSLSPCESLRSLSIKNCPGFGSTSLAMVGKLCPNLHHLDL  479

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC  GL +VNLS C N+T++ + A+A+ HG TLELLNL  C  +
Sbjct  480  SGLCGITDGGLLPLLESCQTGLARVNLSHCSNLTEEVVFALARCHGGTLELLNLENCQKI  539

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD SL A+AD C +L DLD+++
Sbjct  540  TDESLTALADSCPLLNDLDLAR  561


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 96/204 (47%), Gaps = 8/204 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GCP+++ L L     + D G+    +   S+E L L +C  I+  G+  I   +   
Sbjct  177  IARGCPSLRALSLWNVPSVGDEGLFEIARECHSLEKLDLCQCPLITNKGLSAI-AENCPN  235

Query  185  LKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
            L +L  E+C  + +   G+ ++   C  L S++I +C   GD  +  +LS     L  + 
Sbjct  236  LTSLTIESCINIGN--EGIQSIAKFCPKLNSIAIKDCPFIGDKGIASLLSSTSDALTKVK  293

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN +TDY  +  +      +  + LSG  NV+ K    + +  G + L  L +  C 
Sbjct  294  LQNLN-ITDYS-VAVIGHYGKSVTNLILSGLQNVSQKGFWVMGQAKGLKMLSSLTITSCK  351

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             +TD S+ ++   C  L+ + + K
Sbjct  352  GITDLSIESLGKGCPNLKHVCLRK  375


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 57/253 (23%), Positives = 100/253 (40%), Gaps = 52/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++ CPN+  L +  C  + + G+ S  K    + S+ +++C  I   G+  +L  ++ 
Sbjct  228  AIAENCPNLTSLTIESCINIGNEGIQSIAKFCPKLNSIAIKDCPFIGDKGIASLLSSTSD  287

Query  182  KLKALAFEN----------------------CFGMKDLAF-GVPALPPCNSLR---SLSI  283
             L  +  +N                        G+++++  G   +     L+   SL+I
Sbjct  288  ALTKVKLQNLNITDYSVAVIGHYGKSVTNLILSGLQNVSQKGFWVMGQAKGLKMLSSLTI  347

Query  284  CNCTGFGDASLVVLSRLCPNLVH--------------------------LNLSGLNGVTD  385
             +C G  D S+  L + CPNL H                          L L   N +T 
Sbjct  348  TSCKGITDLSIESLGKGCPNLKHVCLRKCYFVSDKGLVAFAKGVTSLESLQLEECNRITQ  407

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
             G+L  + SC + L  V+L  C+ + D      +    E+L  L++  C      SLA +
Sbjct  408  IGILNALSSCVSKLKSVSLVKCMGIKDLATEIPSLSPCESLRSLSIKNCPGFGSTSLAMV  467

Query  566  ADYCSVLRDLDIS  604
               C  L  LD+S
Sbjct  468  GKLCPNLHHLDLS  480



>ref|NP_001234858.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABB89717.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ABC24971.1| EIN3-binding F-box protein 1 [Solanum lycopersicum]
 gb|ACS44350.1| EIN3-binding F-box protein 2 [Solanum lycopersicum]
Length=637

 Score =   230 bits (587),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 153/203 (75%), Gaps = 2/203 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+K +C+RKC  +SD G+V+F K A S+ESL LEEC+RI+Q G+    V +  
Sbjct  364  AVGKGCPNLKYMCIRKCCFVSDGGLVAFAKEAGSLESLILEECNRITQVGILNA-VSNCR  422

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+KDLA     L PC SLRSLSI +C GFG +SL ++ +LCP L  L+L
Sbjct  423  KLKSLSLVKCMGIKDLALQTSMLSPCESLRSLSIRSCPGFGSSSLAMVGKLCPKLHQLDL  482

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP +++C+ GLVKVNLS C+N+TD+ + ++A  HGETLELLNL+GC  V
Sbjct  483  SGLCGITDAGLLPLLENCE-GLVKVNLSDCLNLTDQVVLSLAMRHGETLELLNLDGCRKV  541

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDASL AIADYC +L DLD+SKS
Sbjct  542  TDASLVAIADYCPLLIDLDVSKS  564


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 95/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP+++ L L     + D G++   +   S+E L L  C  IS  G+  I   +  
Sbjct  180  AVAHGCPSLRVLSLWNVPSIGDEGLLEVARECHSLEKLDLSHCRSISNKGLVAI-AENCP  238

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C  L+SL+I +C   GD  +  +LS     L  +
Sbjct  239  SLTSLTIESCPNIGN--EGLQAVGKYCTKLQSLTIKDCPLVGDQGVASLLSSGASMLTKV  296

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L GLN +TD+  L  +      +  +NL    NV+ K    +    G ++L  L +  C
Sbjct  297  KLHGLN-ITDFS-LAVIGHYGKLITSLNLCSLRNVSQKGFWVMGNAQGLQSLVSLTITLC  354

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD  L A+   C  L+ + I K
Sbjct  355  QGATDVGLEAVGKGCPNLKYMCIRK  379


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 76/158 (48%), Gaps = 2/158 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C     + +    K    +  L L     I+ AG+  +L +  G +K +
Sbjct  448  CESLRSLSIRSCPGFGSSSLAMVGKLCPKLHQLDLSGLCGITDAGLLPLLENCEGLVK-V  506

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
               +C  + D      A+    +L  L++  C    DASLV ++  CP L+ L++S  + 
Sbjct  507  NLSDCLNLTDQVVLSLAMRHGETLELLNLDGCRKVTDASLVAIADYCPLLIDLDVSK-SA  565

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK  490
            +TD G+    +     L  ++LSGC  V++K++ ++ K
Sbjct  566  ITDSGVAALSRGVQVNLQVLSLSGCSMVSNKSVLSLKK  603



>ref|XP_007155011.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
 gb|ESW27005.1| hypothetical protein PHAVU_003G165500g [Phaseolus vulgaris]
Length=639

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+ LR+C  ++D+G+V+F KAA S+ESLQLEEC+R +Q+G+   L +   
Sbjct  363  AIGKGCINLKQMYLRRCCFVTDSGLVAFAKAAVSLESLQLEECNRFTQSGIIVALSNIKT  422

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL++L    C G+KD+   V  L PC SLRSL+I  C GFG +SL ++ +LCP L HLNL
Sbjct  423  KLRSLTLVKCTGVKDIDMEVSMLSPCQSLRSLAIQKCPGFGSSSLAMIGKLCPQLRHLNL  482

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD GLLP +++C+AGLV VNL+GC N+TD  +SA+A+LHG TLE+LNL+GC  +
Sbjct  483  TGLYGITDAGLLPLLENCEAGLVNVNLAGCWNLTDNIVSALARLHGGTLEVLNLDGCMKI  542

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL  IA+ C VL DLD+SK
Sbjct  543  TDASLVTIANNCLVLNDLDVSK  564


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 94/206 (46%), Gaps = 11/206 (5%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP+++ L L   + + D G+    K    +E L L  C  I+  G+  I      
Sbjct  180  AVAHGCPSLRSLSLWNVSSIGDEGLSHIAKGCHILEKLDLSHCSSITNKGLIAI-AEGCP  238

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  L  E+C  + +   G+ AL   C  L+S+SI +C   GD  +  L  L  NL  + 
Sbjct  239  NMTTLNMESCPNIGN--EGLQALARLCPKLQSISIKDCPLVGDHGVSNLLSLASNLSRVK  296

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVN--LSGCINVTDKTISAIAKLHG-ETLELLNLNG  529
            L  LN +TD+ L      C  G    N  LSG  NVT++    +    G + L  L +  
Sbjct  297  LQNLN-ITDFSLAVI---CHYGRAITNLVLSGLKNVTERGFWVMGAAQGLQKLVSLTVTS  352

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            C  VTD S+ AI   C  L+ + + +
Sbjct  353  CRGVTDKSIEAIGKGCINLKQMYLRR  378


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 87/204 (43%), Gaps = 5/204 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++ CP ++ + ++ C L+ D+GV + +  A ++  ++L+  +    +    ++ H   
Sbjct  258  ALARLCPKLQSISIKDCPLVGDHGVSNLLSLASNLSRVKLQNLNITDFS--LAVICHYGR  315

Query  182  KLKALAFENCFGMKDLAFGV-PALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  L       + +  F V  A      L SL++ +C G  D S+  + + C NL  + 
Sbjct  316  AITNLVLSGLKNVTERGFWVMGAAQGLQKLVSLTVTSCRGVTDKSIEAIGKGCINLKQMY  375

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            L     VTD GL+ F ++    L  + L  C   T   I          L  L L  C  
Sbjct  376  LRRCCFVTDSGLVAFAKAA-VSLESLQLEECNRFTQSGIIVALSNIKTKLRSLTLVKCTG  434

Query  539  VTDASL-AAIADYCSVLRDLDISK  607
            V D  +  ++   C  LR L I K
Sbjct  435  VKDIDMEVSMLSPCQSLRSLAIQK  458


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 76/170 (45%), Gaps = 34/170 (20%)
 Frame = +2

Query  179  GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            GKL      +  G+ +L     A   C SLRSLS+ N +  GD  L  +++ C  L  L+
Sbjct  160  GKLSIRGSNSVRGVTNLGLSAVA-HGCPSLRSLSLWNVSSIGDEGLSHIAKGCHILEKLD  218

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL---------------  493
            LS  + +T+ GL+   + C   +  +N+  C N+ ++ + A+A+L               
Sbjct  219  LSHCSSITNKGLIAIAEGC-PNMTTLNMESCPNIGNEGLQALARLCPKLQSISIKDCPLV  277

Query  494  --HG-----------ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
              HG             ++L NLN    +TD SLA I  Y   + +L +S
Sbjct  278  GDHGVSNLLSLASNLSRVKLQNLN----ITDFSLAVICHYGRAITNLVLS  323



>ref|XP_006345227.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=637

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+K +C+RKC  +SD G+V+F K A S+ESL LEEC+RI+Q G+    V +  
Sbjct  364  AVGKGCPNLKHMCIRKCCFVSDGGLVAFAKEAGSLESLILEECNRITQVGILNA-VSNCR  422

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+KDLA     L PC SLRSLSI +C GFG  SL ++ +LCP L  L+L
Sbjct  423  KLKSLSLVKCMGIKDLALQTSMLSPCESLRSLSIRSCPGFGSTSLAMVGKLCPKLHQLDL  482

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP +++C+ GLVKVNLS C+N+TD+ + ++A  HGETLELLNL+GC  V
Sbjct  483  SGLCGITDAGLLPLLENCE-GLVKVNLSDCLNLTDQVVLSLATRHGETLELLNLDGCRKV  541

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIADYC +L DLD+SK
Sbjct  542  TDASLVAIADYCPLLNDLDVSK  563


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 95/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G++   +   S+E L L  C  IS  G+  I   +  
Sbjct  180  AIAHGCPSLRVLSLWNVPSIGDEGLLEVARECRSLEKLDLSHCRSISNKGLVAI-AENCP  238

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C  L+SL+I +C   GD  +  +LS     L  +
Sbjct  239  SLTSLTIESCPKIGN--EGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGASMLSKV  296

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L GLN +TD+  L  +      +  +NL    NV+ K    +    G ++L  L +  C
Sbjct  297  KLHGLN-ITDFS-LAVIGHYGKLITNLNLCSLRNVSQKGFWVMGNAQGLQSLVSLTITLC  354

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD  L A+   C  L+ + I K
Sbjct  355  QGATDVGLEAVGKGCPNLKHMCIRK  379



>ref|XP_009607234.1| PREDICTED: EIN3-binding F-box protein 2-like [Nicotiana tomentosiformis]
Length=637

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 149/201 (74%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCPN+K +C+RKC  +SD G+V+F KA+ S ESL LEEC+RI+Q G+    V +  
Sbjct  363  AVGNGCPNLKHMCIRKCCFVSDGGLVAFAKASGSFESLHLEECNRITQTGILNT-VSNCR  421

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+KDLA       PC SLRSLSI +C GFG  SL ++ +LCP L  L+L
Sbjct  422  KLKSLSLVKCMGIKDLALQTSLRLPCESLRSLSIRSCPGFGSTSLAMVGKLCPKLHQLDL  481

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC+AGLVKVNLS C+N+TD+ + ++A+LHGETLELLNL+GC  V
Sbjct  482  SGLCGITDAGLLPLLESCEAGLVKVNLSDCLNLTDQVVLSLARLHGETLELLNLDGCRKV  541

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD SL AIAD C +L DLD+S
Sbjct  542  TDESLMAIADNCPLLNDLDVS  562


 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 97/205 (47%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G+    +   S+E L L +C  IS  G+  I   +  
Sbjct  179  AIAHGCPSLRVLSLWNVPSIGDEGLFEIARECNSLEKLDLSQCPSISNKGLVAI-AENCL  237

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C  L+SL+I +C   GD  +  +LS     L  +
Sbjct  238  SLTSLTIESCASIGN--EGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGATMLTKV  295

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L GLN +TD+  L  +      +  +NLS   NV+ K    +    G ++L  L +  C
Sbjct  296  KLHGLN-ITDFS-LAVIGHYGKMIANLNLSSLRNVSQKGFWVMGNAKGLQSLVSLTITLC  353

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD  L A+ + C  L+ + I K
Sbjct  354  KGATDVGLEAVGNGCPNLKHMCIRK  378


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 92/229 (40%), Gaps = 31/229 (14%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ + C  ++ L ++ C L+ D GV S + +  ++  L   + H ++       ++   G
Sbjct  257  AIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGATM--LTKVKLHGLNITDFSLAVIGHYG  314

Query  182  KLKA-LAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH-  352
            K+ A L   +   +    F V        SL SL+I  C G  D  L  +   CPNL H 
Sbjct  315  KMIANLNLSSLRNVSQKGFWVMGNAKGLQSLVSLTITLCKGATDVGLEAVGNGCPNLKHM  374

Query  353  -------------------------LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
                                     L+L   N +T  G+L  V +C   L  ++L  C+ 
Sbjct  375  CIRKCCFVSDGGLVAFAKASGSFESLHLEECNRITQTGILNTVSNCRK-LKSLSLVKCMG  433

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + D  +    +L  E+L  L++  C      SLA +   C  L  LD+S
Sbjct  434  IKDLALQTSLRLPCESLRSLSIRSCPGFGSTSLAMVGKLCPKLHQLDLS  482



>ref|XP_004287307.1| PREDICTED: EIN3-binding F-box protein 1-like [Fragaria vesca 
subsp. vesca]
Length=640

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 150/203 (74%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLRKC  +SDNG+++F KA  S+ESLQLEEC+R++Q+G+   L +   
Sbjct  364  AIGKGCTNLKQMCLRKCCFVSDNGLLAFSKAVGSLESLQLEECNRVTQSGIIAALSNCGA  423

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL++L    C G+KD+  G P   PC SLRSLSI NC GFG ASL V+ +LCP L  ++L
Sbjct  424  KLRSLTLVKCMGIKDIVAGEPMSSPCTSLRSLSIRNCPGFGSASLAVVGKLCPQLRTVDL  483

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD G+L  ++S + GLVK+NLSGC+N+TD+   A A+LH ETLE+LNL+GC  +
Sbjct  484  SGLYAMTDAGILSLLESLEDGLVKLNLSGCVNLTDEVAVAAARLHRETLEVLNLDGCRKI  543

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDASL AIA  C  LR+LD+SKS
Sbjct  544  TDASLEAIAANCLFLRELDVSKS  566


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 100/205 (49%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP++K L L   + + D G++   K    +E L L +C  IS  G+  I   +  
Sbjct  180  AVARGCPSLKALSLWNVSSIGDEGLIEIAKGCPLLEKLDLCQCPSISSKGLIAI-AENCP  238

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASL-VVLSRLCPNLVHL  355
             L AL  E+C  + +   G+ A+   C+ L+S+SI +C   GD  +  +LS     L  +
Sbjct  239  NLTALNIESCPQIGN--EGLQAIGKSCSKLQSISIKDCVLVGDHGVSSLLSSASSALTKV  296

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  L  +      +  + LSG  NV+++    +      ++L  L +  C
Sbjct  297  KLQALN-ITDFS-LAVIGHYGKAVTSLVLSGLQNVSERGFWVMGNAQALKSLISLTITSC  354

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD SL AI   C+ L+ + + K
Sbjct  355  RGTTDVSLEAIGKGCTNLKQMCLRK  379


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 87/184 (47%), Gaps = 2/184 (1%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +S  C +++ L +R C       +    K    + ++ L   + ++ AG+  +L      
Sbjct  445  MSSPCTSLRSLSIRNCPGFGSASLAVVGKLCPQLRTVDLSGLYAMTDAGILSLLESLEDG  504

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L  L    C  + D      A     +L  L++  C    DASL  ++  C  L  L++S
Sbjct  505  LVKLNLSGCVNLTDEVAVAAARLHRETLEVLNLDGCRKITDASLEAIAANCLFLRELDVS  564

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
              +G+TD GL     +    L  +++SGC  V++K++S++ ++ G++L  LNL  C  ++
Sbjct  565  K-SGITDSGLAVLSCTEQVALQVLSISGCSEVSNKSLSSLKRM-GQSLLGLNLQHCTAIS  622

Query  545  DASL  556
            + S+
Sbjct  623  NRSV  626


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/253 (21%), Positives = 93/253 (37%), Gaps = 52/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++ CPN+  L +  C  + + G+ +  K+   ++S+ +++C  +   GV         
Sbjct  232  AIAENCPNLTALNIESCPQIGNEGLQAIGKSCSKLQSISIKDCVLVGDHGVSSLLSSASS  291

Query  155  ----------------FGILVHSAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSI  283
                              ++ H    + +L       + +  F V        SL SL+I
Sbjct  292  ALTKVKLQALNITDFSLAVIGHYGKAVTSLVLSGLQNVSERGFWVMGNAQALKSLISLTI  351

Query  284  CNCTGFGDASLVVLSRLCPNLVH--------------------------LNLSGLNGVTD  385
             +C G  D SL  + + C NL                            L L   N VT 
Sbjct  352  TSCRGTTDVSLEAIGKGCTNLKQMCLRKCCFVSDNGLLAFSKAVGSLESLQLEECNRVTQ  411

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
             G++  + +C A L  + L  C+ + D            +L  L++  C     ASLA +
Sbjct  412  SGIIAALSNCGAKLRSLTLVKCMGIKDIVAGEPMSSPCTSLRSLSIRNCPGFGSASLAVV  471

Query  566  ADYCSVLRDLDIS  604
               C  LR +D+S
Sbjct  472  GKLCPQLRTVDLS  484



>ref|XP_007136869.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
 gb|ESW08863.1| hypothetical protein PHAVU_009G080700g [Phaseolus vulgaris]
Length=601

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPNVK   LRKC  LSD G+VSF +A+ SIESLQL+ECHRI+Q G+FG+  H A 
Sbjct  368  AIGKGCPNVKNFQLRKCAFLSDKGLVSFTRASLSIESLQLQECHRITQIGLFGVFFHCAA  427

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L   +C+G+KDL   +PA+ PC S  SL+I +C GFGDA+L +L +LCP L H+ L
Sbjct  428  KLKVLTLISCYGIKDLNADLPAMSPCESFWSLTIRDCPGFGDANLALLGKLCPQLRHVEL  487

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD G LP ++  + GL  VNL GCINVTDK +  I   HG T ++L L+GC  V
Sbjct  488  SGLQRVTDAGFLPLLECSETGLTTVNLRGCINVTDKVVLPIVNSHGCTRQVLCLDGCTRV  547

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDAS  AIA  C +L DLD+SK
Sbjct  548  TDASTMAIAGNCPMLSDLDVSK  569


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 97/253 (38%), Gaps = 52/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AVSK CPN+ +L +  C  + + G+ +  K   ++ S+ ++ C  +   GV G+L  ++ 
Sbjct  236  AVSKKCPNLGELSIESCPNIGNIGLQAIGKLGPNLRSISIKGCSGVGDQGVCGLLTSTSY  295

Query  182  KLKALAFENC------------FGMKDLAFGVPALPPCNS--------------LRSLSI  283
             L  +  E+             +G +     +  LP  +               L S++I
Sbjct  296  VLSKMKLESLMVSDLSLATIGHYGFQVTDLVLSCLPNVSEKGFWVMGNSRGLQKLNSITI  355

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
              C G  D  +  + + CPN+ +  L     ++D GL+ F ++                 
Sbjct  356  EGCQGLTDTGIEAIGKGCPNVKNFQLRKCAFLSDKGLVSFTRASLSIESLQLQECHRITQ  415

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C A L  + L  C  + D      A    E+   L +  C    DA+LA +
Sbjct  416  IGLFGVFFHCAAKLKVLTLISCYGIKDLNADLPAMSPCESFWSLTIRDCPGFGDANLALL  475

Query  566  ADYCSVLRDLDIS  604
               C  LR +++S
Sbjct  476  GKLCPQLRHVELS  488


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 91/212 (43%), Gaps = 22/212 (10%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP++K   +     + D G++        +E L L +C  IS   +  +      
Sbjct  184  AIAHGCPSLKVFSVFDVATIDDEGLIEIASGCRKLEKLDLCKCPNISDKTLIAV-SKKCP  242

Query  182  KLKALAFENCFGMKDLAF-GVPALPPCNSLRSLSICNCTGFGDASL--------VVLSRL  334
             L  L+ E+C  + ++    +  L P  +LRS+SI  C+G GD  +         VLS++
Sbjct  243  NLGELSIESCPNIGNIGLQAIGKLGP--NLRSISIKGCSGVGDQGVCGLLTSTSYVLSKM  300

Query  335  CPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLE  511
                + ++   L  +  YG           +  + LS   NV++K    +    G + L 
Sbjct  301  KLESLMVSDLSLATIGHYGFQ---------VTDLVLSCLPNVSEKGFWVMGNSRGLQKLN  351

Query  512  LLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
             + + GC  +TD  + AI   C  +++  + K
Sbjct  352  SITIEGCQGLTDTGIEAIGKGCPNVKNFQLRK  383



>ref|XP_010525963.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=640

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 145/201 (72%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+K+L L KC LLSDNG+VSF KA+ S+ESLQLEECHR++  G FG L++   
Sbjct  364  AVGKGCPNLKKLLLSKCPLLSDNGLVSFAKASLSVESLQLEECHRVTHLGFFGSLLNCGA  423

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL+A +  NCFG++DL   +P   PCN++RSLSI NC GFGDA+L  L +LCP + +L L
Sbjct  424  KLRAFSLVNCFGIRDLTTCLPPSSPCNTIRSLSIRNCPGFGDANLSALGQLCPQIENLEL  483

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GLNG+TD G L  + S    LVKVNL+GC N+TDK +S I+   G TLE LNL GC  +
Sbjct  484  CGLNGITDSGFLQLLHSTQLSLVKVNLAGCSNLTDKVVSVISAQSGWTLEALNLEGCTKI  543

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDA+L +IA  C +L DLD+S
Sbjct  544  TDATLVSIAGSCQILSDLDVS  564


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 94/189 (50%), Gaps = 2/189 (1%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            S  C  ++ L +R C    D  + +  +    IE+L+L   + I+ +G   +L  +   L
Sbjct  446  SSPCNTIRSLSIRNCPGFGDANLSALGQLCPQIENLELCGLNGITDSGFLQLLHSTQLSL  505

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
              +    C  + D    V +     +L +L++  CT   DA+LV ++  C  L  L++S 
Sbjct  506  VKVNLAGCSNLTDKVVSVISAQSGWTLEALNLEGCTKITDATLVSIAGSCQILSDLDVSN  565

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
             + +TD+G+     S    L  ++L+GC  VTDK++ A+ KL G TL  LN+  C  ++ 
Sbjct  566  CS-ITDFGVQALASSNQLTLQILSLAGCPLVTDKSVPALRKL-GRTLLGLNVQQCRSISS  623

Query  548  ASLAAIADY  574
            A++  + ++
Sbjct  624  ATIDLLIEH  632


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 94/204 (46%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +GCP+++ L L   + +SD G++   K    +E L L  C  I+   +  I     G
Sbjct  180  AIGRGCPSLRVLSLWDLSTISDTGLLEIAKGCSQLEKLDLSRCPTITDKALIAIAKSCLG  239

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L  L  E+C  + + +    A   C  L+S+ I NC    D  +  +LS+   +L+ L 
Sbjct  240  -LSELTIESCSRIGNASLQAVA-RFCPKLKSVCIKNCPLVRDQGIASLLSKSTCSLMKLK  297

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN +TD   L  V      +  + +SG   V++K    +    G + L  L++  C 
Sbjct  298  LQMLN-ITDVS-LAVVGHYGLSITDLLISGLPTVSEKGFWVMGNGVGLQKLNSLSITSCP  355

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTD  L A+   C  L+ L +SK
Sbjct  356  GVTDMGLEAVGKGCPNLKKLLLSK  379


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 5/116 (4%)
 Frame = +2

Query  257  CNSLRSLSIC---NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGL  427
            C  L  LSIC   +     D  L  + R CP+L  L+L  L+ ++D GLL   + C + L
Sbjct  156  CGGLGKLSICGNNSACRVSDLGLRAIGRGCPSLRVLSLWDLSTISDTGLLEIAKGC-SQL  214

Query  428  VKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL  595
             K++LS C  +TDK + AIAK     L  L +  C  + +ASL A+A +C  L+ +
Sbjct  215  EKLDLSRCPTITDKALIAIAK-SCLGLSELTIESCSRIGNASLQAVARFCPKLKSV  269


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/231 (25%), Positives = 99/231 (43%), Gaps = 36/231 (16%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFV-KAAESIESLQLEECH----RISQAGVFGIL  166
            AV++ CP +K +C++ C L+ D G+ S + K+  S+  L+L+  +     ++  G +G+ 
Sbjct  258  AVARFCPKLKSVCIKNCPLVRDQGIASLLSKSTCSLMKLKLQMLNITDVSLAVVGHYGLS  317

Query  167  VHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNL  346
            +     +  L   +  G   +  GV        L SLSI +C G  D  L  + + CPNL
Sbjct  318  ITDL-LISGLPTVSEKGFWVMGNGVGL----QKLNSLSITSCPGVTDMGLEAVGKGCPNL  372

Query  347  VHLNLSGLNGVTDYGLLPFVQS--------------------------CDAGLVKVNLSG  448
              L LS    ++D GL+ F ++                          C A L   +L  
Sbjct  373  KKLLLSKCPLLSDNGLVSFAKASLSVESLQLEECHRVTHLGFFGSLLNCGAKLRAFSLVN  432

Query  449  CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            C  + D T          T+  L++  C    DA+L+A+   C  + +L++
Sbjct  433  CFGIRDLTTCLPPSSPCNTIRSLSIRNCPGFGDANLSALGQLCPQIENLEL  483



>gb|KHG14715.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=645

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 152/201 (76%), Gaps = 2/201 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLR+C  +S +G+V+F K+A S+E LQLEEC+R++Q+GV G+L +   
Sbjct  371  AIGKGCANLKQMCLRRCCFVSGDGLVAFAKSAGSLECLQLEECNRVTQSGVIGVLSNCG-  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G+KD++   P    CNSL+SLSI NC GFG ASL ++ RLCP L H++L
Sbjct  430  -LKSLTLVKCMGIKDISLEAPLSSSCNSLKSLSIRNCPGFGTASLAMVGRLCPQLQHVDL  488

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD GLLP +++C+AGLVKVNLSGC+N+TD+ +  + KLHG TLELLNLNGC  +
Sbjct  489  SGLCAITDAGLLPLLENCEAGLVKVNLSGCLNLTDEVVLHLTKLHGATLELLNLNGCRRI  548

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASLAA A+ C  L DLD+S
Sbjct  549  TDASLAAAAENCVFLSDLDVS  569


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/224 (23%), Positives = 85/224 (38%), Gaps = 54/224 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP++K L L     + D G+    K    +E L L +C  +S  G+  I  +   
Sbjct  187  AVARGCPSLKVLSLWNVPRVGDEGLCEIAKECHLLEKLDLCQCPHLSNKGLIAIAAN---  243

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L +LSI +C   G+  L  + +LCP L  +++
Sbjct  244  -------------------------CPNLTALSIQSCPKIGNEGLQAIGKLCPKLQSISI  278

Query  362  SGLNGVTDYGL-------------------------LPFVQSCDAGLVKVNLSGCINVTD  466
                 V D+G+                         L  +      +  + LSG  NV++
Sbjct  279  KDCPLVGDHGVSSLLSSASSVLSKVKLQGLSITDFSLAVIGHYGKSVTNLMLSGLQNVSE  338

Query  467  KTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDL  595
            K    +    G + L    +  C  V+D SL AI   C+ L+ +
Sbjct  339  KGFWVMGNAQGLQKLVSFTIASCWGVSDVSLEAIGKGCANLKQM  382



>gb|KHN07078.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=635

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 150/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +GCPNV+ L LRK   LSD G+VSF +AA S+ESLQL+ECHRI+Q G+FG+  +   
Sbjct  359  AIGRGCPNVQNLKLRKSAFLSDKGLVSFARAAPSVESLQLQECHRITQIGLFGVFFNCGA  418

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L   +C+G+KDL   +PA+ P  S+ SL+I +C GFG+A+L +L +LCP L H+ L
Sbjct  419  KLKVLTLISCYGIKDLNMDLPAISPSESIWSLTIHDCPGFGNANLALLGKLCPRLQHVEL  478

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD G LP ++S +AGLVKVNL+GC+N++D+ + ++   HG TLE+L+L+GC  V
Sbjct  479  SGLQGVTDAGFLPLLESSEAGLVKVNLNGCVNLSDRVVLSMVNSHGWTLEVLSLDGCKRV  538

Query  542  TDASLAAIADYCSVLRDLDISK  607
             DASL AIA  C +L DLD+S+
Sbjct  539  GDASLMAIAGSCPLLADLDVSR  560


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 97/205 (47%), Gaps = 7/205 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP++K   L     + D G++        +E L L +C  IS   +  +   +  
Sbjct  176  AIAHGCPSLKVCSLWDVATVGDVGLIEIASGCHQLEKLDLCKCPNISDKTLIAV-AKNCP  234

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L  L+ E+C  + +   G+ A+  C +LRS+SI NC+G GD  +  +LS     L  + 
Sbjct  235  NLAELSIESCPNIGN--EGLQAIGKCPNLRSISIKNCSGVGDQGVAGLLSSASFALTKVK  292

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  L  V+D  L   +      +  + LS   NV++K    +   HG + L  + +N C 
Sbjct  293  LESLT-VSDLSL-AVIGHYGVAVTDLVLSCLPNVSEKGFWVMGNGHGLQKLTSITINCCQ  350

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             VTD  L AI   C  +++L + KS
Sbjct  351  GVTDVGLEAIGRGCPNVQNLKLRKS  375



>gb|KHG24906.1| EIN3-binding F-box 1 -like protein [Gossypium arboreum]
Length=641

 Score =   228 bits (580),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 151/202 (75%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLR C  +SD+G+++F KA  S+E LQLEEC++++Q+G+ G L +   
Sbjct  367  AMGKGCANLKQMCLRSCRFVSDDGLLAFSKAQGSLECLQLEECNKVTQSGIIGFLSNCG-  425

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+LA   C G++D++   P   PCNSL+SLS+ NC GFG ASL ++  LCP L H++L
Sbjct  426  -LKSLALVKCMGIRDISLDTPLSSPCNSLKSLSVKNCPGFGTASLAMVGNLCPQLQHVDL  484

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC  GL KVNLSGC+N+TD+ + A+ +LHG T+ELLNL+GC  +
Sbjct  485  SGLYGITDAGLLPLLESCKEGLAKVNLSGCLNLTDEVVLALTRLHGGTVELLNLDGCRRI  544

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL A+AD C  L DLD+S+
Sbjct  545  TDASLVAVADNCVFLNDLDVSR  566


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 47/190 (25%), Positives = 85/190 (45%), Gaps = 30/190 (16%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++++GCP++K L L     + D G+    K    +E L L +C  +S  G+  I      
Sbjct  183  SIARGCPSLKSLSLWNVPHVGDVGLYEIAKECHLLEKLDLCQCPAVSSKGLIAIA-----  237

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                   ENC                 +L +L I +C   G+ SL  + +LCP L  +++
Sbjct  238  -------ENCL----------------NLTALRIESCPKIGNESLQAVGKLCPKLQSISI  274

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 V D+G+        + L KV L G + ++D ++S I   +G+++  L L+G G V
Sbjct  275  KDCPLVGDHGVSSLFSLASSVLSKVKLEG-LKISDFSLSVIG-YYGKSVTNLMLSGLGNV  332

Query  542  TDASLAAIAD  571
            ++     + +
Sbjct  333  SEKGFWVMGN  342


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/226 (25%), Positives = 94/226 (42%), Gaps = 26/226 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV K CP ++ + ++ C L+ D+GV S    A S+ S    E  +IS   +  ++ +   
Sbjct  261  AVGKLCPKLQSISIKDCPLVGDHGVSSLFSLASSVLSKVKLEGLKISDFSL-SVIGYYGK  319

Query  182  KLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  L       + +  F V         L SL I +C G  D SL  + + C NL  + 
Sbjct  320  SVTNLMLSGLGNVSEKGFWVMGNAQGLQKLVSLMITSCRGLTDVSLEAMGKGCANLKQMC  379

Query  359  LSGLNGVTDYGLLPF-----------VQSCDA-------------GLVKVNLSGCINVTD  466
            L     V+D GLL F           ++ C+              GL  + L  C+ + D
Sbjct  380  LRSCRFVSDDGLLAFSKAQGSLECLQLEECNKVTQSGIIGFLSNCGLKSLALVKCMGIRD  439

Query  467  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             ++         +L+ L++  C     ASLA + + C  L+ +D+S
Sbjct  440  ISLDTPLSSPCNSLKSLSVKNCPGFGTASLAMVGNLCPQLQHVDLS  485



>ref|XP_010429542.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=636

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + +  LLSDNG+VSF KA+ S+ES+QLEECHR++Q G FG L++   
Sbjct  360  SVGKGCPNMKKAIISRSPLLSDNGLVSFAKASLSLESVQLEECHRVTQFGFFGSLLNCGE  419

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DLA G+PA P C++LRSLSI NC GFGDA+L  L +LCP L  ++L
Sbjct  420  KLKAFSLVNCLGIRDLATGLPASPHCSALRSLSIRNCPGFGDANLAALGKLCPQLEEIDL  479

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  +Q+    LVKVN SGC N+TDK ISAI   +G TLE+LN++GC  +
Sbjct  480  CGLKGITESGFLHLIQNSLNSLVKVNFSGCSNLTDKVISAITARNGWTLEVLNIDGCSNI  539

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DAS+ +IA  C +L DLD+SK
Sbjct  540  SDASMVSIAANCQILSDLDLSK  561


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 89/169 (53%), Gaps = 15/169 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC  +++L L +C+ ++D G+V+  ++  ++  L LE C RI   G+  I   S  K
Sbjct  203  IAEGCTQLEKLDLNRCSTITDKGLVAIARSCPNLSELTLEACSRIGDEGLQAI-ARSCSK  261

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLR----SLSICNCTGFGDASLVVLSRLCPNLVH  352
            LK+++ +NC  ++D   G+ +L    +       L + N T   D SL V+     ++  
Sbjct  262  LKSVSIKNCPLVRDQ--GIASLLSNTTFSLAKLKLQMLNVT---DVSLAVVGHYGLSVTD  316

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            L LSGL+ V++ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  317  LVLSGLSHVSEKGF--WVMGNGVGLQKLNSLTITACQGVTDAGLESVGK  363


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 93/205 (45%), Gaps = 6/205 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ + CP++  L L   + ++DNG++   +    +E L L  C  I+  G+  I   S  
Sbjct  176  SIGRSCPSLGSLSLWNLSTVTDNGLLEIAEGCTQLEKLDLNRCSTITDKGLVAI-ARSCP  234

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L  L  E C  + D      A   C+ L+S+SI NC    D  +  +LS    +L  L 
Sbjct  235  NLSELTLEACSRIGDEGLQAIA-RSCSKLKSVSIKNCPLVRDQGIASLLSNTTFSLAKLK  293

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN VTD   L  V      +  + LSG  +V++K    +    G + L  L +  C 
Sbjct  294  LQMLN-VTDVS-LAVVGHYGLSVTDLVLSGLSHVSEKGFWVMGNGVGLQKLNSLTITACQ  351

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             VTDA L ++   C  ++   IS+S
Sbjct  352  GVTDAGLESVGKGCPNMKKAIISRS  376


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 88/183 (48%), Gaps = 2/183 (1%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            S  C  ++ L +R C    D  + +  K    +E + L     I+++G   ++ +S   L
Sbjct  442  SPHCSALRSLSIRNCPGFGDANLAALGKLCPQLEEIDLCGLKGITESGFLHLIQNSLNSL  501

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
              + F  C  + D            +L  L+I  C+   DAS+V ++  C  L  L+LS 
Sbjct  502  VKVNFSGCSNLTDKVISAITARNGWTLEVLNIDGCSNISDASMVSIAANCQILSDLDLSK  561

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
             + ++D G+     S    L  ++++GC  VTDK++ AI +L G TL  LNL  C  +++
Sbjct  562  CS-ISDSGIQALASSEKLKLQILSMAGCSMVTDKSLPAIVRL-GSTLLGLNLQQCRSISN  619

Query  548  ASL  556
            +++
Sbjct  620  STV  622


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 100/252 (40%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL---VH  172
            A+++ CPN+ +L L  C+ + D G+ +  ++   ++S+ ++ C  +   G+  +L     
Sbjct  228  AIARSCPNLSELTLEACSRIGDEGLQAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTF  287

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPCNS--------------LRSLSI  283
            S  KLK         +LA    +G+      +  L   +               L SL+I
Sbjct  288  SLAKLKLQMLNVTDVSLAVVGHYGLSVTDLVLSGLSHVSEKGFWVMGNGVGLQKLNSLTI  347

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
              C G  DA L  + + CPN+    +S    ++D GL+ F ++                 
Sbjct  348  TACQGVTDAGLESVGKGCPNMKKAIISRSPLLSDNGLVSFAKASLSLESVQLEECHRVTQ  407

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C   L   +L  C+ + D      A  H   L  L++  C    DA+LAA+
Sbjct  408  FGFFGSLLNCGEKLKAFSLVNCLGIRDLATGLPASPHCSALRSLSIRNCPGFGDANLAAL  467

Query  566  ADYCSVLRDLDI  601
               C  L ++D+
Sbjct  468  GKLCPQLEEIDL  479


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +2

Query  305  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI  484
            D  L  + R CP+L  L+L  L+ VTD GLL   + C   L K++L+ C  +TDK + AI
Sbjct  171  DIGLRSIGRSCPSLGSLSLWNLSTVTDNGLLEIAEGCTQ-LEKLDLNRCSTITDKGLVAI  229

Query  485  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            A+     L  L L  C  + D  L AIA  CS L+ + I
Sbjct  230  AR-SCPNLSELTLEACSRIGDEGLQAIARSCSKLKSVSI  267



>gb|AFU61111.1| F-box protein [Capsicum annuum]
Length=637

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 152/202 (75%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPN+K++C+RKC ++SD GVV+F K A S+E L LEEC+RI+Q G+    V +  
Sbjct  364  AVGKGCPNLKRMCIRKCCIVSDCGVVAFAKEAGSLECLNLEECNRITQIGILNA-VSNCR  422

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            +LK+L+   C G+KDLA     L PC SLRSLSI +C GFG  SL ++ +LCP L  L+L
Sbjct  423  RLKSLSLVKCMGIKDLALQTSLLYPCESLRSLSIRSCPGFGSTSLAMIGKLCPKLHKLDL  482

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC+ GLVKVNLS C+N+TD+ + ++A  HGETLELLNL+GC  V
Sbjct  483  SGLCGITDAGLLPLLESCE-GLVKVNLSDCLNLTDQVVLSLAARHGETLELLNLDGCRKV  541

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIAD CS+L DLD+SK
Sbjct  542  TDASLVAIADNCSLLNDLDVSK  563


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 95/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G++   +   S+E L L  C  IS  G+  I   +  
Sbjct  180  AIAHGCPSLRALSLWNVPCIGDEGLLEVARECRSLEKLDLSHCPSISNRGLVAI-AENCP  238

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   CN L+SL+I +C   GD  +  +LS     L  +
Sbjct  239  SLTSLTIESCPNIGN--EGLQAIGRCCNKLQSLTIKDCPLVGDQGIASILSSGASMLTKV  296

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  L  +      +  + LS   NV+ K    +    G ++L  L +  C
Sbjct  297  ELHCLN-ITDFS-LAVIGHYGKQITNLCLSSLRNVSQKGFWVMGNAKGLQSLVSLTITLC  354

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD  L A+   C  L+ + I K
Sbjct  355  WGATDVGLEAVGKGCPNLKRMCIRK  379


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/254 (22%), Positives = 95/254 (37%), Gaps = 55/254 (22%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++ CP++  L +  C  + + G+ +  +    ++SL +++C  +   G+  IL   A 
Sbjct  232  AIAENCPSLTSLTIESCPNIGNEGLQAIGRCCNKLQSLTIKDCPLVGDQGIASILSSGAS  291

Query  182  KLKALAFENCFGMKDLA------FGVPALPPC---------------------NSLRSLS  280
             L  +   +C  + D +      +G      C                      SL SL+
Sbjct  292  MLTKVEL-HCLNITDFSLAVIGHYGKQITNLCLSSLRNVSQKGFWVMGNAKGLQSLVSLT  350

Query  281  ICNCTGFGDASLVVLSRLCPNLVH--------------------------LNLSGLNGVT  382
            I  C G  D  L  + + CPNL                            LNL   N +T
Sbjct  351  ITLCWGATDVGLEAVGKGCPNLKRMCIRKCCIVSDCGVVAFAKEAGSLECLNLEECNRIT  410

Query  383  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
              G+L  V +C   L  ++L  C+ + D  +        E+L  L++  C      SLA 
Sbjct  411  QIGILNAVSNCRR-LKSLSLVKCMGIKDLALQTSLLYPCESLRSLSIRSCPGFGSTSLAM  469

Query  563  IADYCSVLRDLDIS  604
            I   C  L  LD+S
Sbjct  470  IGKLCPKLHKLDLS  483



>emb|CDP10419.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 148/202 (73%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN++Q+CLRKC  +SDNG+V+F KAA S+E LQLEEC+RI++ G+   L +   
Sbjct  376  ALGKGCPNLRQMCLRKCCFVSDNGLVAFAKAAGSLECLQLEECNRITETGILNALSNCNS  435

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+K +    PAL PC SLRSLSI +C  F   SL ++ +LCP L HL+L
Sbjct  436  KLKSLSIVKCMGIKSMPSETPALSPCESLRSLSIRSCPWFNSTSLALVGKLCPQLHHLDL  495

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD  LLP ++SC++ LVKVNLS C  +TDK I A+A+LHG TLELLNL GC  V
Sbjct  496  SGLCGITDAALLPLLESCES-LVKVNLSDCGILTDKVIIALAELHGATLELLNLEGCKKV  554

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIAD C  L DLD+SK
Sbjct  555  TDASLVAIADSCLFLNDLDVSK  576


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 91/204 (45%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G+    +   S+E L L +C  IS  G+  +   +  
Sbjct  192  AIAHGCPSLRALSLWNVPAIGDEGLFEIARECHSLEKLDLCQCPSISDKGLAAV-AKNCP  250

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L AL  E+C  + + +        C  L+S++I +C   GD  +  +LS     L  + 
Sbjct  251  NLSALTIESCSNIGNESLQAIG-SYCPKLQSITIKDCPLIGDQGVAGLLSSASVALTKVK  309

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
               LN ++D+  L  +      +  + L+G  NV+ K    +    G + L  L +  C 
Sbjct  310  FQVLN-ISDFS-LAVIGHYGKSITNLVLTGLQNVSQKGFWVMGNAQGLQMLSSLTITSCR  367

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
              +D SL A+   C  LR + + K
Sbjct  368  GTSDLSLEALGKGCPNLRQMCLRK  391


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/254 (22%), Positives = 96/254 (38%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+K CPN+  L +  C+ + +  + +       ++S+ +++C  I   GV G+L  ++ 
Sbjct  244  AVAKNCPNLSALTIESCSNIGNESLQAIGSYCPKLQSITIKDCPLIGDQGVAGLLSSASV  303

Query  182  KLKALAFENCFGMKDLAFGVPA---------------------------LPPCNSLRSLS  280
             L  + F+    + D +  V                                   L SL+
Sbjct  304  ALTKVKFQ-VLNISDFSLAVIGHYGKSITNLVLTGLQNVSQKGFWVMGNAQGLQMLSSLT  362

Query  281  ICNCTGFGDASLVVLSRLCPNLVH--------------------------LNLSGLNGVT  382
            I +C G  D SL  L + CPNL                            L L   N +T
Sbjct  363  ITSCRGTSDLSLEALGKGCPNLRQMCLRKCCFVSDNGLVAFAKAAGSLECLQLEECNRIT  422

Query  383  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
            + G+L  + +C++ L  +++  C+ +        A    E+L  L++  C      SLA 
Sbjct  423  ETGILNALSNCNSKLKSLSIVKCMGIKSMPSETPALSPCESLRSLSIRSCPWFNSTSLAL  482

Query  563  IADYCSVLRDLDIS  604
            +   C  L  LD+S
Sbjct  483  VGKLCPQLHHLDLS  496



>dbj|BAF01819.1| putative glucose regulated repressor protein [Arabidopsis thaliana]
Length=384

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + K  LLSDNG+VSF KA+ S+ESLQLEECHR++Q G FG L++   
Sbjct  111  SVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGE  170

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC  ++DL  G+PA   C++LRSLSI NC GFGDA+L  + +LCP L  ++L
Sbjct  171  KLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDL  230

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  +QS    LVK+N SGC N+TD+ ISAI   +G TLE+LN++GC  +
Sbjct  231  CGLKGITESGFLHLIQS---SLVKINFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNI  287

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL +IA  C +L DLDISK
Sbjct  288  TDASLVSIAANCQILSDLDISK  309


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 85/183 (46%), Gaps = 5/183 (3%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            S  C  ++ L +R C    D  + +  K    +E + L     I+++G   ++  S  K+
Sbjct  193  SSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDLCGLKGITESGFLHLIQSSLVKI  252

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
                F  C  + D            +L  L+I  C+   DASLV ++  C  L  L++S 
Sbjct  253  N---FSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISK  309

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
               ++D G+     S    L  ++++GC  VTDK++ AI  L G TL  LNL  C  +++
Sbjct  310  C-AISDSGIQALASSDKLKLQILSVAGCSMVTDKSLPAIVGL-GSTLLGLNLQQCRSISN  367

Query  548  ASL  556
            +++
Sbjct  368  STV  370


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 94/231 (41%), Gaps = 36/231 (16%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAE-SIESLQLEECH----RISQAGVFGIL  166
            A+++ C  +K + ++ C L+ D G+ S +     S+  L+L+  +     ++  G +G+ 
Sbjct  5    AIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLKLQMLNVTDVSLAVVGHYGLS  64

Query  167  VHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPN-  343
            +     L  L+  +  G   +  GV        L SL+I  C G  D  L  + + CPN 
Sbjct  65   ITDL-VLAGLSHVSEKGFWVMGNGVGL----QKLNSLTITACQGVTDMGLESVGKGCPNM  119

Query  344  -------------------------LVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSG  448
                                     L  L L   + VT +G    + +C   L   +L  
Sbjct  120  KKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGEKLKAFSLVN  179

Query  449  CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            C+++ D T    A  H   L  L++  C    DA+LAAI   C  L D+D+
Sbjct  180  CLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDL  230



>ref|XP_009625259.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana tomentosiformis]
Length=646

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 152/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAE-SIESLQLEECHRISQAGVFGILVHSA  178
            AV KGC N+K +CLRKC  +SD G+V+F +AA  S+ESL LEEC+RI+QAG+    V + 
Sbjct  369  AVGKGCSNLKHMCLRKCCFVSDGGLVAFARAATGSLESLLLEECNRITQAGILNA-VSNF  427

Query  179  GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            GKLK+L+   C G+KDL      L PC SLRSLSI +C GFG  SL ++  LCP L HL+
Sbjct  428  GKLKSLSLVKCMGVKDLPLQASLLSPCESLRSLSIRSCPGFGSTSLAMVGMLCPQLHHLD  487

Query  359  LSGLNGVTDYGLLPFVQ-SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
            LSGL G+TD GLLP ++ S  AGLVKVN++GC+N+TD+ + ++A+LH ETLE+LNL+GC 
Sbjct  488  LSGLTGITDAGLLPLLEMSSKAGLVKVNITGCLNLTDEVVLSLARLHSETLEVLNLDGCR  547

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTDASL AIAD C +L DLD+SK
Sbjct  548  KVTDASLVAIADNCPLLNDLDVSK  571


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 61/205 (30%), Positives = 100/205 (49%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP+++ L L     + D G+V   +   S+E L L +C  IS  G+  I   +  
Sbjct  185  AVAHGCPSLRVLSLWNVPYVGDEGLVEIARGCHSLEKLDLSQCPSISNKGLVAI-AENCP  243

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C  L+SL+I +C   GD  +  +LS     L  +
Sbjct  244  SLTSLTIESCRNIGN--EGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGATMLKKV  301

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L+ LN +TD+  L  +      +  +NL    NV+ K    +    G ++L  L++  C
Sbjct  302  KLNSLN-ITDFS-LAVIGHYGKVITDLNLGSLRNVSQKGFWVMGNARGLQSLASLSITLC  359

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VTD SL A+   CS L+ + + K
Sbjct  360  RGVTDVSLEAVGKGCSNLKHMCLRK  384


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 95/228 (42%), Gaps = 30/228 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++ CP++  L +  C  + + G+ +  +    ++SL +++C  +   GV  +L   A 
Sbjct  237  AIAENCPSLTSLTIESCRNIGNEGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGAT  296

Query  182  KLKALAFENCFGMKDLAFGV-----PALPPCN----------------------SLRSLS  280
             LK +   N   + D +  V       +   N                      SL SLS
Sbjct  297  MLKKVKL-NSLNITDFSLAVIGHYGKVITDLNLGSLRNVSQKGFWVMGNARGLQSLASLS  355

Query  281  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV  460
            I  C G  D SL  + + C NL H+ L     V+D GL+ F ++    L  + L  C  +
Sbjct  356  ITLCRGVTDVSLEAVGKGCSNLKHMCLRKCCFVSDGGLVAFARAATGSLESLLLEECNRI  415

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASL-AAIADYCSVLRDLDI  601
            T   I       G+ L+ L+L  C  V D  L A++   C  LR L I
Sbjct  416  TQAGILNAVSNFGK-LKSLSLVKCMGVKDLPLQASLLSPCESLRSLSI  462



>ref|XP_009758784.1| PREDICTED: EIN3-binding F-box protein 1-like [Nicotiana sylvestris]
Length=645

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 152/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAE-SIESLQLEECHRISQAGVFGILVHSA  178
            AV KGC N+K +CLRKC  +SD G+V+F +AA  S+ESL LEEC+RI+QAG+    V + 
Sbjct  368  AVGKGCSNLKHMCLRKCCFVSDGGLVAFARAATGSLESLLLEECNRITQAGILNA-VSNF  426

Query  179  GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            GKLK+L+   C G+KDL      L PC SLRSLSI +C GFG  SL ++  LCP L HL+
Sbjct  427  GKLKSLSLVKCMGVKDLPLQASLLSPCESLRSLSIRSCPGFGSTSLAMVGTLCPQLHHLD  486

Query  359  LSGLNGVTDYGLLPFVQ-SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
            LSGL G+TD GLLP ++ S  AGLVKVNL+ C+N+TD+ + ++A+LHGETLELLNL+GC 
Sbjct  487  LSGLTGITDAGLLPLLEMSSKAGLVKVNLTDCLNLTDEVVLSLARLHGETLELLNLDGCR  546

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTDASL AIA+ C +L DLD+SK
Sbjct  547  KVTDASLVAIANNCPLLNDLDVSK  570


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 101/205 (49%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G+V   +   S+E L L +C  IS  G+  I   +  
Sbjct  184  AIAHGCPSLRVLSLWNVPYVGDEGLVEIARGCHSLEKLDLSQCPSISNKGLVAI-AENCP  242

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L +LA E+C  + +   G+ A+   C  L+SL+I +C   GD  +  +LS     L  +
Sbjct  243  SLTSLAIESCRNIGN--EGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGATMLKKV  300

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L+ LN +TD+  L  +      +  +NLS   NV+ K    +    G ++L  L++  C
Sbjct  301  KLNSLN-ITDFS-LAVIGHYGKAITDLNLSSLRNVSQKGFWVMGNARGLQSLASLSITLC  358

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD S+ A+   CS L+ + + K
Sbjct  359  RGATDVSVEAVGKGCSNLKHMCLRK  383


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/228 (26%), Positives = 96/228 (42%), Gaps = 30/228 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++ CP++  L +  C  + + G+ +  +    ++SL +++C  +   GV  +L   A 
Sbjct  236  AIAENCPSLTSLAIESCRNIGNEGLQAIGRCCTKLQSLTIKDCPLVGDQGVASLLSSGAT  295

Query  182  KLKALAFENCFGMKDLAFGV-----PALPPCN----------------------SLRSLS  280
             LK +   N   + D +  V      A+   N                      SL SLS
Sbjct  296  MLKKVKL-NSLNITDFSLAVIGHYGKAITDLNLSSLRNVSQKGFWVMGNARGLQSLASLS  354

Query  281  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV  460
            I  C G  D S+  + + C NL H+ L     V+D GL+ F ++    L  + L  C  +
Sbjct  355  ITLCRGATDVSVEAVGKGCSNLKHMCLRKCCFVSDGGLVAFARAATGSLESLLLEECNRI  414

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASL-AAIADYCSVLRDLDI  601
            T   I       G+ L+ L+L  C  V D  L A++   C  LR L I
Sbjct  415  TQAGILNAVSNFGK-LKSLSLVKCMGVKDLPLQASLLSPCESLRSLSI  461



>ref|XP_008466405.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
 ref|XP_008466406.1| PREDICTED: EIN3-binding F-box protein 1 isoform X1 [Cucumis melo]
Length=640

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KG PN+K  CLRKC+ LSDNG+VSF KAA S+E LQLEECHRI+Q G FG++++ + 
Sbjct  364  SVGKGSPNLKHFCLRKCSFLSDNGLVSFAKAARSLECLQLEECHRITQFGFFGVVLNCSA  423

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LKAL+  +C G+KD+   +P      SLRSL+I NC GFG+ +L +L +LCP L +++ 
Sbjct  424  SLKALSLISCLGIKDINSELPIPASSGSLRSLTIRNCHGFGNRNLALLGKLCPQLQNVDF  483

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+ D G L ++Q+C +GLVK+NLSGC+N+TD+ IS+I + HG TL++LNL+ C  +
Sbjct  484  SGLVGIDDCGFLAWLQNCQSGLVKINLSGCVNLTDEVISSIIEHHGWTLKVLNLDSCKKI  543

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDAS+ +IA+ C +L DLD+SK
Sbjct  544  TDASMTSIANNCPLLSDLDVSK  565



>ref|XP_010541915.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=637

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ K C  +KQ+CLRKC  +SDNG+V+F KA  S+E+L+LEEC+ I Q+G+ G+L    G
Sbjct  360  ALGKCCITLKQVCLRKCGFISDNGLVAFSKAMGSLETLKLEECNGIGQSGICGVLSSCGG  419

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L+   C G++DLAF    L PCNSLRSLS+ +C GFG+  L  L +LCPNL HL+L
Sbjct  420  KLKFLSLLRCTGIRDLAFKSSDLYPCNSLRSLSVQSCPGFGNGGLANLGKLCPNLQHLDL  479

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G TD GLLP +++  AGLV VNL+ C N+TD  + ++AKL G TLE+LNLNGC  +
Sbjct  480  SGLYGTTDAGLLPLIENNRAGLVTVNLTSCFNLTDGVVYSLAKLQGGTLEVLNLNGCRRI  539

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD+SL+A+A+ C  LRDLD+SK
Sbjct  540  TDSSLSAMAENCMFLRDLDVSK  561


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/186 (24%), Positives = 93/186 (50%), Gaps = 3/186 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C    + G+ +  K   +++ L L   +  + AG+  ++ ++   L  +
Sbjct  445  CNSLRSLSVQSCPGFGNGGLANLGKLCPNLQHLDLSGLYGTTDAGLLPLIENNRAGLVTV  504

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
               +CF + D      A     +L  L++  C    D+SL  ++  C  L  L++S   G
Sbjct  505  NLTSCFNLTDGVVYSLAKLQGGTLEVLNLNGCRRITDSSLSAMAENCMFLRDLDVSKC-G  563

Query  377  VTDYGLLPFVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  553
            +TD G+    ++     L  +++SGC  V++K++ ++ KL G TL  LN+ GC  +T+ +
Sbjct  564  ITDSGIASLSRAEKRLNLQVLSVSGCSEVSNKSLVSLKKL-GRTLLGLNIRGCDSITNET  622

Query  554  LAAIAD  571
            +  + +
Sbjct  623  VQRLVE  628


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 98/210 (47%), Gaps = 20/210 (10%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V+K C  +++L L  C  ++  G++S  +   ++ +L+LE C RI    +  I  +   K
Sbjct  203  VAKECHLLEKLDLSHCPSVTSKGLISVAQNCPNLTTLKLESCPRIGNEALLAIGRYCP-K  261

Query  185  LKALAFENCFGMKD------LAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNL  346
            L+++  ++C  + D      ++   P L   N L  LSI       D SL V+     ++
Sbjct  262  LESITVKDCPLVGDHGISSLISSASPVLSKVN-LHGLSIT------DFSLAVIGHYGKSI  314

Query  347  VHLNLSGLNGVTDYGLLPFVQSCDAG---LVKVNLSGCINVTDKTISAIAKLHGETLELL  517
              L LS L  VT+ G   +V     G   LV + ++ C  VTD ++ A+ K    TL+ +
Sbjct  315  TSLMLSNLLNVTERGF--WVMGNARGLHKLVSLGVTSCRGVTDLSLEALGKCC-ITLKQV  371

Query  518  NLNGCGCVTDASLAAIADYCSVLRDLDISK  607
             L  CG ++D  L A +     L  L + +
Sbjct  372  CLRKCGFISDNGLVAFSKAMGSLETLKLEE  401



>ref|XP_008466407.1| PREDICTED: EIN3-binding F-box protein 1 isoform X2 [Cucumis melo]
Length=690

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KG PN+K  CLRKC+ LSDNG+VSF KAA S+E LQLEECHRI+Q G FG++++ + 
Sbjct  414  SVGKGSPNLKHFCLRKCSFLSDNGLVSFAKAARSLECLQLEECHRITQFGFFGVVLNCSA  473

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LKAL+  +C G+KD+   +P      SLRSL+I NC GFG+ +L +L +LCP L +++ 
Sbjct  474  SLKALSLISCLGIKDINSELPIPASSGSLRSLTIRNCHGFGNRNLALLGKLCPQLQNVDF  533

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+ D G L ++Q+C +GLVK+NLSGC+N+TD+ IS+I + HG TL++LNL+ C  +
Sbjct  534  SGLVGIDDCGFLAWLQNCQSGLVKINLSGCVNLTDEVISSIIEHHGWTLKVLNLDSCKKI  593

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDAS+ +IA+ C +L DLD+SK
Sbjct  594  TDASMTSIANNCPLLSDLDVSK  615



>ref|XP_003522913.1| PREDICTED: EIN3-binding F-box protein 1-like [Glycine max]
 gb|KHN36400.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=650

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+ LR+C  +SDNG+V+F K A S+ESL LEEC+ I+Q G+   L +   
Sbjct  374  AMGKGCVNLKQMFLRRCCFVSDNGLVAFSKVASSLESLHLEECNNINQFGIICALSNFKS  433

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G+KD+   V   PPC SLR LSI NC G G+ASL ++ +LCP L H++L
Sbjct  434  TLKSLTLLKCKGVKDIDLEVSMFPPCESLRHLSIHNCPGVGNASLAMVGKLCPQLQHVDL  493

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD GL+P +++C+AGLVKVNL GC N+TD  +S +A LHG TLELLNL+GC  +
Sbjct  494  TGLYGLTDAGLVPLLENCEAGLVKVNLVGCWNLTDNIVSVLATLHGGTLELLNLDGCRKI  553

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIAD C +L DLD+SK
Sbjct  554  TDASLVAIADNCLLLNDLDVSK  575


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 99/226 (44%), Gaps = 27/226 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL---VH  172
            A++KGCPN+  L +  C  + + G+ +  ++   ++ + +++C  +   GV  +L   +H
Sbjct  243  AIAKGCPNLTTLNIESCPKIGNEGLQAIARSCPKLQCISIKDCPLVGDHGVSSLLSSAIH  302

Query  173  -SAGKLK-------ALAFENCFG-------------MKDLAFGVPALPPC-NSLRSLSIC  286
             S  KL+       +LA    +G             + +  F V  +      L SL++ 
Sbjct  303  LSKVKLQDLNITDFSLAVIGHYGKAILNLVLCGLQNVTERGFWVMGVAQSLQKLMSLTVS  362

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
            +C G  DAS+  + + C NL  + L     V+D GL+ F +   + L  ++L  C N+  
Sbjct  363  SCRGITDASIEAMGKGCVNLKQMFLRRCCFVSDNGLVAFSKVASS-LESLHLEECNNINQ  421

Query  467  KTISAIAKLHGETLELLNLNGCGCVTDASL-AAIADYCSVLRDLDI  601
              I         TL+ L L  C  V D  L  ++   C  LR L I
Sbjct  422  FGIICALSNFKSTLKSLTLLKCKGVKDIDLEVSMFPPCESLRHLSI  467


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 94/202 (47%), Gaps = 5/202 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++KGC  +++L + + + +S+  +++  K   ++ +L +E C +I   G+  I   S  K
Sbjct  218  IAKGCHMLEKLDICQASFISNKSLIAIAKGCPNLTTLNIESCPKIGNEGLQAI-ARSCPK  276

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L+ ++ ++C  + D   GV +L       S          D SL V+      +++L L 
Sbjct  277  LQCISIKDCPLVGD--HGVSSLLSSAIHLSKVKLQDLNITDFSLAVIGHYGKAILNLVLC  334

Query  365  GLNGVTDYGLLPF-VQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            GL  VT+ G     V      L+ + +S C  +TD +I A+ K     L+ + L  C  V
Sbjct  335  GLQNVTERGFWVMGVAQSLQKLMSLTVSSCRGITDASIEAMGK-GCVNLKQMFLRRCCFV  393

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +D  L A +   S L  L + +
Sbjct  394  SDNGLVAFSKVASSLESLHLEE  415



>gb|KJB07737.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
 gb|KJB07738.1| hypothetical protein B456_001G042600 [Gossypium raimondii]
Length=641

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 150/202 (74%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLR C  +SD+G+++F K+  S+E LQLEEC++++Q+G+ G L +   
Sbjct  367  AMGKGCANLKQMCLRSCRFVSDDGLLAFSKSQGSLECLQLEECNKVTQSGIIGFLSNCG-  425

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+LA   C G++D++   P   PCNSL+SLS+ NC GFG ASL ++  LCP L H++L
Sbjct  426  -LKSLALVKCMGIRDVSLDTPLSSPCNSLKSLSVKNCPGFGTASLAMVGNLCPQLQHVDL  484

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD GLLP ++SC  GL KVNLSGC+N+TD+ + A+ +LHG TLELLNL+G   +
Sbjct  485  SGLYGITDAGLLPLLESCREGLAKVNLSGCLNLTDEIVLALTRLHGGTLELLNLDGRPRI  544

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL A+AD C  L DLD+S+
Sbjct  545  TDASLVAVADNCVFLSDLDVSR  566


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/190 (25%), Positives = 85/190 (45%), Gaps = 30/190 (16%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++++GCP++K L L     + D G+    K    +E L L +C  +S  G+  I      
Sbjct  183  SIARGCPSLKSLSLWNVPHVGDVGLYEIAKECHLLEKLDLCQCPAVSSKGLIAIA-----  237

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                   ENC                 +L +LSI +C   G+ SL  + +LCP L  +++
Sbjct  238  -------ENCL----------------NLTALSIESCPKIGNESLQAVGKLCPKLQSISI  274

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 V D+G+        + L KV L G + ++D ++S I   +G+++  L L+G   V
Sbjct  275  KDCPLVGDHGVSSLFSLASSVLSKVKLEG-LKISDFSLSVIG-YYGKSVTNLMLSGLRNV  332

Query  542  TDASLAAIAD  571
            ++     + +
Sbjct  333  SEKGFWVMGN  342


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 93/226 (41%), Gaps = 26/226 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV K CP ++ + ++ C L+ D+GV S    A S+ S    E  +IS   +  ++ +   
Sbjct  261  AVGKLCPKLQSISIKDCPLVGDHGVSSLFSLASSVLSKVKLEGLKISDFSL-SVIGYYGK  319

Query  182  KLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             +  L       + +  F V         L SL + +C G  D SL  + + C NL  + 
Sbjct  320  SVTNLMLSGLRNVSEKGFWVMGNAQGLQKLVSLMLTSCPGLTDVSLEAMGKGCANLKQMC  379

Query  359  LSGLNGVTDYGLLPFVQS------------------------CDAGLVKVNLSGCINVTD  466
            L     V+D GLL F +S                         + GL  + L  C+ + D
Sbjct  380  LRSCRFVSDDGLLAFSKSQGSLECLQLEECNKVTQSGIIGFLSNCGLKSLALVKCMGIRD  439

Query  467  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             ++         +L+ L++  C     ASLA + + C  L+ +D+S
Sbjct  440  VSLDTPLSSPCNSLKSLSVKNCPGFGTASLAMVGNLCPQLQHVDLS  485



>ref|XP_003603398.1| Ein3-binding f-box protein, partial [Medicago truncatula]
Length=627

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPNVK   LR+C+ LSDNG+VSF KAA SI SLQLEECHRI+Q GV G +++   
Sbjct  365  AVGKGCPNVKNFQLRRCSFLSDNGLVSFTKAAPSIVSLQLEECHRITQFGVAGAILNRGT  424

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L   +C+G+KDL   +PA+PPC ++ SLSI NC G G+ +L VL +LCP L  L L
Sbjct  425  KLKVLTLVSCYGIKDLNLNLPAVPPCQTISSLSIRNCPGVGNFTLNVLGKLCPTLQCLEL  484

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+TD G +  +Q   A L  VNLSGCIN+TD  + ++ KLH  TL +LNLNGC  V
Sbjct  485  IGLEGITDPGFISLLQRSKASLGNVNLSGCINLTDVGVLSMVKLHCSTLGVLNLNGCKKV  544

Query  542  TDASLAAIADYCSVLRDLDISK  607
             DASL AIAD C VL DLD+S+
Sbjct  545  GDASLTAIADNCIVLSDLDVSE  566


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/213 (24%), Positives = 92/213 (43%), Gaps = 31/213 (15%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+K CPN+ +L +  C  + + G+ +  K   ++ S+ ++ C  +   G+ G+L  ++ 
Sbjct  233  AVAKHCPNLTELSIESCPSIGNEGLHAIGKLCPNLRSVSIKNCPGVRDQGIAGLLCSASI  292

Query  182  KLKALAFENC--------------FGMKDLAFGVPALP--------------PCNSLRSL  277
             LK L  E+               F + DL      LP                  L SL
Sbjct  293  ILKKLTLESLAVSDYSLAVIGQYGFVVTDLVLNF--LPNVTEKGFWVMGNGHALQQLTSL  350

Query  278  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
            +I  C G  D  L  + + CPN+ +  L   + ++D GL+ F ++  + +V + L  C  
Sbjct  351  TIGLCPGVTDIGLHAVGKGCPNVKNFQLRRCSFLSDNGLVSFTKAAPS-IVSLQLEECHR  409

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +T   ++      G  L++L L  C  + D +L
Sbjct  410  ITQFGVAGAILNRGTKLKVLTLVSCYGIKDLNL  442


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 86/180 (48%), Gaps = 2/180 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C  +  L +R C  + +  +    K   +++ L+L     I+  G   +L  S   L  +
Sbjct  450  CQTISSLSIRNCPGVGNFTLNVLGKLCPTLQCLELIGLEGITDPGFISLLQRSKASLGNV  509

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D+         C++L  L++  C   GDASL  ++  C  L  L++S    
Sbjct  510  NLSGCINLTDVGVLSMVKLHCSTLGVLNLNGCKKVGDASLTAIADNCIVLSDLDVSEC-A  568

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD G+    +     L  ++L+GC  V++K++SA+ KL G++LE LN+  C  ++  ++
Sbjct  569  ITDAGISALTRGVLFNLDVLSLAGCSLVSNKSLSALKKL-GDSLEGLNIKNCKSISSRTV  627


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/228 (23%), Positives = 83/228 (36%), Gaps = 54/228 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP++K   L     +SD G++        IE+L L +   IS   +  +  H   
Sbjct  181  AVAHGCPSLKSFTLWDVATISDAGLIEIANGCHQIENLDLCKLPTISDKALIAVAKH---  237

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L  LSI +C   G+  L  + +LCPNL  +++
Sbjct  238  -------------------------CPNLTELSIESCPSIGNEGLHAIGKLCPNLRSVSI  272

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI-------------------------NVTD  466
                GV D G+   + S    L K+ L                             NVT+
Sbjct  273  KNCPGVRDQGIAGLLCSASIILKKLTLESLAVSDYSLAVIGQYGFVVTDLVLNFLPNVTE  332

Query  467  KTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            K    +   H  + L  L +  C  VTD  L A+   C  +++  + +
Sbjct  333  KGFWVMGNGHALQQLTSLTIGLCPGVTDIGLHAVGKGCPNVKNFQLRR  380



>ref|XP_004173614.1| PREDICTED: EIN3-binding F-box protein 1-like, partial [Cucumis 
sativus]
Length=631

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KG PN+K  CLRKC+ LSDNG+VSF KAA S+E LQLEECHRI+Q G FG++++ + 
Sbjct  355  SVGKGSPNLKHFCLRKCSFLSDNGLVSFAKAARSLECLQLEECHRITQFGFFGVVLNCSA  414

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LKAL+  +C G+KD+   +P      SLRSL+I NC GFG+ +L +L +LCP L +++ 
Sbjct  415  SLKALSLISCLGIKDINSELPIPASSVSLRSLTIRNCHGFGNRNLALLGKLCPQLQNVDF  474

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+ D G L ++Q+C  GLVK+NL+GC+N+TD+ +S+I + HG TL++LNL+ C  +
Sbjct  475  SGLVGIDDCGFLAWLQNCQLGLVKINLNGCVNLTDEVVSSIMEHHGSTLKMLNLDSCKKI  534

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDAS+ +IA+ C +L DLD+SK
Sbjct  535  TDASMTSIANNCPLLSDLDVSK  556



>gb|AES73649.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=641

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGCPNVK   LR+C+ LSDNG+VSF KAA SI SLQLEECHRI+Q GV G +++   
Sbjct  365  AVGKGCPNVKNFQLRRCSFLSDNGLVSFTKAAPSIVSLQLEECHRITQFGVAGAILNRGT  424

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L   +C+G+KDL   +PA+PPC ++ SLSI NC G G+ +L VL +LCP L  L L
Sbjct  425  KLKVLTLVSCYGIKDLNLNLPAVPPCQTISSLSIRNCPGVGNFTLNVLGKLCPTLQCLEL  484

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+TD G +  +Q   A L  VNLSGCIN+TD  + ++ KLH  TL +LNLNGC  V
Sbjct  485  IGLEGITDPGFISLLQRSKASLGNVNLSGCINLTDVGVLSMVKLHCSTLGVLNLNGCKKV  544

Query  542  TDASLAAIADYCSVLRDLDISK  607
             DASL AIAD C VL DLD+S+
Sbjct  545  GDASLTAIADNCIVLSDLDVSE  566


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 89/186 (48%), Gaps = 2/186 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C  +  L +R C  + +  +    K   +++ L+L     I+  G   +L  S   L  +
Sbjct  450  CQTISSLSIRNCPGVGNFTLNVLGKLCPTLQCLELIGLEGITDPGFISLLQRSKASLGNV  509

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D+         C++L  L++  C   GDASL  ++  C  L  L++S    
Sbjct  510  NLSGCINLTDVGVLSMVKLHCSTLGVLNLNGCKKVGDASLTAIADNCIVLSDLDVSEC-A  568

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD G+    +     L  ++L+GC  V++K++SA+ KL G++LE LN+  C  ++  ++
Sbjct  569  ITDAGISALTRGVLFNLDVLSLAGCSLVSNKSLSALKKL-GDSLEGLNIKNCKSISSRTV  627

Query  557  AAIADY  574
              + ++
Sbjct  628  NKLVEH  633


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 50/212 (24%), Positives = 92/212 (43%), Gaps = 29/212 (14%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+K CPN+ +L +  C  + + G+ +  K   ++ S+ ++ C  +   G+ G+L  ++ 
Sbjct  233  AVAKHCPNLTELSIESCPSIGNEGLHAIGKLCPNLRSVSIKNCPGVRDQGIAGLLCSASI  292

Query  182  KLKALAFENCFGMKDLAFGVPA-------------LP--------------PCNSLRSLS  280
             LK L  E+   + D +  V               LP                  L SL+
Sbjct  293  ILKKLTLES-LAVSDYSLAVIGQYGFVVTDLVLNFLPNVTEKGFWVMGNGHALQQLTSLT  351

Query  281  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV  460
            I  C G  D  L  + + CPN+ +  L   + ++D GL+ F ++  + +V + L  C  +
Sbjct  352  IGLCPGVTDIGLHAVGKGCPNVKNFQLRRCSFLSDNGLVSFTKAAPS-IVSLQLEECHRI  410

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            T   ++      G  L++L L  C  + D +L
Sbjct  411  TQFGVAGAILNRGTKLKVLTLVSCYGIKDLNL  442


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 52/228 (23%), Positives = 83/228 (36%), Gaps = 54/228 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP++K   L     +SD G++        IE+L L +   IS   +  +  H   
Sbjct  181  AVAHGCPSLKSFTLWDVATISDAGLIEIANGCHQIENLDLCKLPTISDKALIAVAKH---  237

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L  LSI +C   G+  L  + +LCPNL  +++
Sbjct  238  -------------------------CPNLTELSIESCPSIGNEGLHAIGKLCPNLRSVSI  272

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI-------------------------NVTD  466
                GV D G+   + S    L K+ L                             NVT+
Sbjct  273  KNCPGVRDQGIAGLLCSASIILKKLTLESLAVSDYSLAVIGQYGFVVTDLVLNFLPNVTE  332

Query  467  KTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            K    +   H  + L  L +  C  VTD  L A+   C  +++  + +
Sbjct  333  KGFWVMGNGHALQQLTSLTIGLCPGVTDIGLHAVGKGCPNVKNFQLRR  380



>ref|XP_007138419.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
 gb|ESW10413.1| hypothetical protein PHAVU_009G207300g [Phaseolus vulgaris]
Length=650

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC ++KQ+ +R+C L+SD G+V+F KAA S+ESLQLEEC+ I+Q G+ G L +   
Sbjct  374  AIGKGCIHLKQMLMRRCCLVSDKGLVAFGKAASSLESLQLEECNSITQFGIIGALSNFKT  433

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK L    C G+KD+   V  L PC SL+ LSI NC G G+ASL ++ +LCP L  ++L
Sbjct  434  TLKYLTLLKCKGVKDIDAEVSMLSPCESLQHLSIRNCPGVGNASLTMVGKLCPQLQCVDL  493

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL GVTD GLLP +++ +AGLVKVNL+GC N++D  +S +A+LHG TLELLNL+GC  +
Sbjct  494  TGLYGVTDAGLLPLLENSEAGLVKVNLAGCGNLSDNIVSELARLHGGTLELLNLDGCRKI  553

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIADYC +L+DLD+SK
Sbjct  554  TDASLVAIADYCHLLKDLDVSK  575


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 88/199 (44%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP+++   L   + + D G+    K    +E L + +   IS   +  I      
Sbjct  191  AVAHGCPSLRSFSLWNVSSVGDEGLSEIAKGCHMLEKLDICQASSISNKSLIAI-AKGCP  249

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L  L  E+C  + +      A   C  L+ +SI +C   GD  +  L     NL  L L
Sbjct  250  NLTTLNIESCPEIGNEGLQAIA-RSCPKLKCISIKDCPLVGDHGVSSLLSSANNLSRLKL  308

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGC  538
              LN +TD+  L  +      +V + L+   NVT++    +   HG + L  L ++ C  
Sbjct  309  QDLN-ITDFS-LAVIGHYGKAIVNLVLTSLQNVTERGFWVMGVAHGLQKLMSLTVSSCRG  366

Query  539  VTDASLAAIADYCSVLRDL  595
            VTDAS+ AI   C  L+ +
Sbjct  367  VTDASIEAIGKGCIHLKQM  385


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 101/207 (49%), Gaps = 15/207 (7%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++KGC  +++L + + + +S+  +++  K   ++ +L +E C  I   G+  I   S  K
Sbjct  218  IAKGCHMLEKLDICQASSISNKSLIAIAKGCPNLTTLNIESCPEIGNEGLQAI-ARSCPK  276

Query  185  LKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            LK ++ ++C  + D   GV + L   N+L  L + +     D SL V+      +V+L L
Sbjct  277  LKCISIKDCPLVGD--HGVSSLLSSANNLSRLKLQDLN-ITDFSLAVIGHYGKAIVNLVL  333

Query  362  SGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAK--LHGETLELLNLN  526
            + L  VT+ G   +V     GL K   + +S C  VTD +I AI K  +H   L+ + + 
Sbjct  334  TSLQNVTERGF--WVMGVAHGLQKLMSLTVSSCRGVTDASIEAIGKGCIH---LKQMLMR  388

Query  527  GCGCVTDASLAAIADYCSVLRDLDISK  607
             C  V+D  L A     S L  L + +
Sbjct  389  RCCLVSDKGLVAFGKAASSLESLQLEE  415



>gb|KEH32122.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=684

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +G PN+KQ+CLR+C ++SDNG+V+F K+A  + +LQLEEC+R +Q G+F  L     
Sbjct  323  AMGRGFPNLKQICLRRCCVVSDNGLVAFAKSAIFLGTLQLEECNRFTQCGIFYALSFIKT  382

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L    C G++D+   V  L PC  LRS++I NC GFG ASL V+ +LCP L  ++L
Sbjct  383  KLKSLTLVKCLGIQDIDVEVSMLSPCRYLRSVTIRNCPGFGSASLAVIGKLCPQLQDVDL  442

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD GLLP +++C+AGLVKVNL GC N+TD  +S +A+LHG TLE+LNL+GC  +
Sbjct  443  TGLCGITDAGLLPLLENCEAGLVKVNLKGCCNLTDNIVSELARLHGGTLEILNLDGCQNI  502

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL A+ D C +L DLD+SK
Sbjct  503  TDASLVAVEDNCLLLNDLDVSK  524



>gb|KEH32121.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=688

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +G PN+KQ+CLR+C ++SDNG+V+F K+A  + +LQLEEC+R +Q G+F  L     
Sbjct  327  AMGRGFPNLKQICLRRCCVVSDNGLVAFAKSAIFLGTLQLEECNRFTQCGIFYALSFIKT  386

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L    C G++D+   V  L PC  LRS++I NC GFG ASL V+ +LCP L  ++L
Sbjct  387  KLKSLTLVKCLGIQDIDVEVSMLSPCRYLRSVTIRNCPGFGSASLAVIGKLCPQLQDVDL  446

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD GLLP +++C+AGLVKVNL GC N+TD  +S +A+LHG TLE+LNL+GC  +
Sbjct  447  TGLCGITDAGLLPLLENCEAGLVKVNLKGCCNLTDNIVSELARLHGGTLEILNLDGCQNI  506

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL A+ D C +L DLD+SK
Sbjct  507  TDASLVAVEDNCLLLNDLDVSK  528



>ref|NP_001281254.1| EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|AHZ89385.1| EIN3-binding-Fbox protein 1 [Cucumis sativus]
 gb|KGN60100.1| Grr1 [Cucumis sativus]
Length=640

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 151/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KG PN+K  CLRKC+ LSDNG+VSF KAA S+E LQLEECHRI+Q G FG++++ + 
Sbjct  364  SVGKGSPNLKHFCLRKCSFLSDNGLVSFAKAARSLECLQLEECHRITQFGFFGVVLNCSA  423

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LKAL+  +C G+KD+   +P      SLRSL+I NC GFG+ +L +L +LCP L +++ 
Sbjct  424  SLKALSLISCLGIKDINSELPIPASSVSLRSLTIRNCHGFGNRNLALLGKLCPQLQNVDF  483

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+ D G L ++Q+C  GLVK+NL+GC+N+TD+ +S++ + HG TL++LNL+ C  +
Sbjct  484  SGLVGIEDCGFLAWLQNCQLGLVKINLNGCVNLTDEVVSSLMEHHGSTLKMLNLDSCKKI  543

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDAS+ +IA+ C +L DLD+SK
Sbjct  544  TDASMTSIANNCPLLSDLDVSK  565



>ref|XP_008792024.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=673

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 148/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++K CPN+KQLCLR+C  LSD G+ +F   A ++E+L +EEC+RIS  GV G L++   
Sbjct  397  AIAKSCPNLKQLCLRRCCYLSDAGLKAFAMTARALENLHVEECNRISLIGVLGCLLNCNE  456

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL+AL+   C G+KD++F    LP C SLRSL+I +C GF  ASL V+ ++CP L H++L
Sbjct  457  KLRALSLVKCLGVKDISFCTAPLPLCMSLRSLTIRDCPGFTGASLAVVGKICPQLQHVDL  516

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G TD GLLP ++S +AGLV VNLSGC+++TD  ++A+ K HG TL++LNL GC  V
Sbjct  517  SGLVGATDAGLLPLIESSEAGLVTVNLSGCVDLTDAVVTALVKAHGTTLQMLNLEGCKKV  576

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD SL  IAD CS+L DLD+S+
Sbjct  577  TDKSLLVIADSCSLLDDLDMSR  598


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 98/229 (43%), Gaps = 30/229 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAES--------------------------  103
            A+ + CP +K + ++ C L+ D GV S V AA S                          
Sbjct  291  AMGRCCPKLKSIVIKDCPLVGDQGVASLVSAASSFLARIRLENVNITDVSLAVIGHYGKA  350

Query  104  IESLQLEECHRISQAGVFGILVHSAG--KLKALAFENCFGMKDLAFGVPALPPCNSLRSL  277
            +  L L     +S+ G F ++ ++ G   +K++   +C G+ DL     A   C +L+ L
Sbjct  351  VADLALTGLQCVSERG-FWVMGNAFGLENMKSILINSCRGVTDLGLEAIA-KSCPNLKQL  408

Query  278  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
             +  C    DA L   +     L +L++   N ++  G+L  + +C+  L  ++L  C+ 
Sbjct  409  CLRRCCYLSDAGLKAFAMTARALENLHVEECNRISLIGVLGCLLNCNEKLRALSLVKCLG  468

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            V D +          +L  L +  C   T ASLA +   C  L+ +D+S
Sbjct  469  VKDISFCTAPLPLCMSLRSLTIRDCPGFTGASLAVVGKICPQLQHVDLS  517


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 78/190 (41%), Gaps = 30/190 (16%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP+++ L +     +SD G+         +E L L  C  IS  G+  +      
Sbjct  213  AVARGCPSLRVLSMWNVPFISDIGLSEIGSGCPMLEKLDLCRCPLISDEGLIAVAQK---  269

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                                     C +L SL I +C   G+  L  + R CP L  + +
Sbjct  270  -------------------------CPNLTSLMIESCLSIGNECLQAMGRCCPKLKSIVI  304

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 V D G+   V +  + L ++ L   +N+TD +++ I   +G+ +  L L G  CV
Sbjct  305  KDCPLVGDQGVASLVSAASSFLARIRLEN-VNITDVSLAVIGH-YGKAVADLALTGLQCV  362

Query  542  TDASLAAIAD  571
            ++     + +
Sbjct  363  SERGFWVMGN  372


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 92/204 (45%), Gaps = 8/204 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +  GCP +++L L +C L+SD G+++  +   ++ SL +E C  I        +     K
Sbjct  240  IGSGCPMLEKLDLCRCPLISDEGLIAVAQKCPNLTSLMIESCLSIGNE-CLQAMGRCCPK  298

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK++  ++C  + D           + L  + + N     D SL V+      +  L L+
Sbjct  299  LKSIVIKDCPLVGDQGVASLVSAASSFLARIRLEN-VNITDVSLAVIGHYGKAVADLALT  357

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
            GL  V++ G   +V     GL  +    ++ C  VTD  + AIAK     L+ L L  C 
Sbjct  358  GLQCVSERGF--WVMGNAFGLENMKSILINSCRGVTDLGLEAIAK-SCPNLKQLCLRRCC  414

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             ++DA L A A     L +L + +
Sbjct  415  YLSDAGLKAFAMTARALENLHVEE  438



>ref|XP_003609344.1| Ein3-binding f-box protein [Medicago truncatula]
 gb|AES91541.1| EIN3-binding F-box-like protein [Medicago truncatula]
Length=739

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +G PN+KQ+CLR+C ++SDNG+V+F K+A  + +LQLEEC+R +Q G+F  L     
Sbjct  378  AMGRGFPNLKQICLRRCCVVSDNGLVAFAKSAIFLGTLQLEECNRFTQCGIFYALSFIKT  437

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L    C G++D+   V  L PC  LRS++I NC GFG ASL V+ +LCP L  ++L
Sbjct  438  KLKSLTLVKCLGIQDIDVEVSMLSPCRYLRSVTIRNCPGFGSASLAVIGKLCPQLQDVDL  497

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD GLLP +++C+AGLVKVNL GC N+TD  +S +A+LHG TLE+LNL+GC  +
Sbjct  498  TGLCGITDAGLLPLLENCEAGLVKVNLKGCCNLTDNIVSELARLHGGTLEILNLDGCQNI  557

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL A+ D C +L DLD+SK
Sbjct  558  TDASLVAVEDNCLLLNDLDVSK  579



>ref|XP_010907280.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KGCPN+KQLCLR+C  LSD G+ +F   A ++E+L LEEC+RIS  GV G L++   
Sbjct  386  AIAKGCPNLKQLCLRRCCYLSDAGLKAFAVTARALENLHLEECNRISLIGVLGCLLNCNE  445

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   C G+KD++F    LP C SLRSL+I +C GF  ASL V+ ++CP L H++L
Sbjct  446  KFRALSLVKCLGIKDISFCTAPLPSCLSLRSLTIRDCPGFTGASLAVVGKICPQLQHVDL  505

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G TD GLLP ++S + GLV VNLSGC+++TD  ++A+ K HG TL++LNL GC  V
Sbjct  506  SGLVGATDAGLLPLIESSEVGLVTVNLSGCVDLTDAVVTALVKAHGSTLQMLNLEGCKKV  565

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD SL  IAD CS L DLD+S+
Sbjct  566  TDKSLLLIADSCSFLDDLDMSR  587


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 95/204 (47%), Gaps = 8/204 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L L +C L+SD G+++  +   ++ SL +E C  I   G+  I      K
Sbjct  229  IASGCPTLEKLDLCQCPLISDKGLIAVAQKCPNLTSLMVESCLSIGNEGLQAI-GRCCPK  287

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK++  ++C  + D           + L  + + N     D SL V+      +  L L+
Sbjct  288  LKSIVIKDCPRIGDQGVASLVSAASSFLARIRLEN-VNISDVSLAVIGHYGKAVADLALT  346

Query  365  GLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
            GL  V++ G   +V     GL     + ++ C  VTD  + AIAK     L+ L L  C 
Sbjct  347  GLQSVSERGF--WVMGNAFGLQNLKSIMINSCRGVTDLGLEAIAK-GCPNLKQLCLRRCC  403

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             ++DA L A A     L +L + +
Sbjct  404  YLSDAGLKAFAVTARALENLHLEE  427


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 94/201 (47%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP+++ L +     +SD G+        ++E L L +C  IS  G+  +      
Sbjct  202  AVARGCPSLRVLSMWNVPFISDIGLSEIASGCPTLEKLDLCQCPLISDKGLIAV-AQKCP  260

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVL-SRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C  L+S+ I +C   GD  +  L S     L  +
Sbjct  261  NLTSLMVESCLSIGN--EGLQAIGRCCPKLKSIVIKDCPRIGDQGVASLVSAASSFLARI  318

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  +N ++D   L  +      +  + L+G  +V+++    +    G + L+ + +N C
Sbjct  319  RLENVN-ISDVS-LAVIGHYGKAVADLALTGLQSVSERGFWVMGNAFGLQNLKSIMINSC  376

Query  533  GCVTDASLAAIADYCSVLRDL  595
              VTD  L AIA  C  L+ L
Sbjct  377  RGVTDLGLEAIAKGCPNLKQL  397


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/259 (21%), Positives = 98/259 (38%), Gaps = 64/259 (25%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++ CPN+  L +  C  + + G+ +  +    ++S+ +++C RI   GV  ++  ++ 
Sbjct  254  AVAQKCPNLTSLMVESCLSIGNEGLQAIGRCCPKLKSIVIKDCPRIGDQGVASLVSAASS  313

Query  182  KLKALAFENC--------------------------------FGMKDLAFGVPALPPCNS  265
             L  +  EN                                 F +   AFG+       +
Sbjct  314  FLARIRLENVNISDVSLAVIGHYGKAVADLALTGLQSVSERGFWVMGNAFGL------QN  367

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------  412
            L+S+ I +C G  D  L  +++ CPNL  L L     ++D GL  F  +           
Sbjct  368  LKSIMINSCRGVTDLGLEAIAKGCPNLKQLCLRRCCYLSDAGLKAFAVTARALENLHLEE  427

Query  413  ---------------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
                           C+     ++L  C+ + D +          +L  L +  C   T 
Sbjct  428  CNRISLIGVLGCLLNCNEKFRALSLVKCLGIKDISFCTAPLPSCLSLRSLTIRDCPGFTG  487

Query  548  ASLAAIADYCSVLRDLDIS  604
            ASLA +   C  L+ +D+S
Sbjct  488  ASLAVVGKICPQLQHVDLS  506



>ref|XP_006358273.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum tuberosum]
Length=642

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 149/202 (74%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGC N+K +CLR+C  ++D+G+V+F +AA S+E L LEEC +I+Q G+    V    
Sbjct  367  AVGKGCTNIKSMCLRECERVTDSGLVAFAQAAGSLEYLLLEECDKITQTGILNA-VSICS  425

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G++DL      L PC+SLRSLSI +C GFG  SL ++ +LCP L HL+L
Sbjct  426  KLKSLSLVKCSGVRDLPPQASLLSPCDSLRSLSIRSCAGFGSRSLAMVGKLCPQLHHLDL  485

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD GLLP ++S  AGLVKVNL+ C+NVTD+ + ++A+LHGETLELLNL+GC  V
Sbjct  486  SGLTRITDAGLLPLLESSKAGLVKVNLTHCLNVTDEVVLSLARLHGETLELLNLDGCRRV  545

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIAD C +L DLD+SK
Sbjct  546  TDASLVAIADNCLLLNDLDVSK  567


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 85/185 (46%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C       +    K    +  L L    RI+ AG+  +L  S   L  +
Sbjct  451  CDSLRSLSIRSCAGFGSRSLAMVGKLCPQLHHLDLSGLTRITDAGLLPLLESSKAGLVKV  510

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
               +C  + D      A     +L  L++  C    DASLV ++  C  L  L++S  + 
Sbjct  511  NLTHCLNVTDEVVLSLARLHGETLELLNLDGCRRVTDASLVAIADNCLLLNDLDVSKCS-  569

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD GL    Q     L  ++LSGC  VT+K+ S++  L GE+L  LNL  C  +  + +
Sbjct  570  ITDSGLAALSQGVQLNLQVLSLSGCSMVTNKSFSSLRTL-GESLIGLNLQHCNAIGSSRI  628

Query  557  AAIAD  571
             A+ +
Sbjct  629  EALVE  633


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 98/201 (49%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G++   +   S+E L L +C  IS  G+  I   +  
Sbjct  183  AIAHGCPSLRVLSLWDVQDVGDEGLMEIARGCHSLEKLDLTKCPSISNKGLVAI-AENCP  241

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C  L SL+I +C   GD ++V +LS     L  +
Sbjct  242  SLTSLTIESCKNIGN--EGLQAIGRCCTKLESLTIKDCPLVGDQAVVSLLSSGNTRLKKV  299

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  L  +      ++ +NL    +V+ +    +    G ++L  L +  C
Sbjct  300  KLHSLN-ITDFS-LAVIGHYGKAIIDLNLCKLGHVSPRGFWVMGAAQGLQSLASLTVTSC  357

Query  533  GCVTDASLAAIADYCSVLRDL  595
              +T+ SL A+   C+ ++ +
Sbjct  358  IGLTNPSLEAVGKGCTNIKSM  378


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 93/200 (47%), Gaps = 8/200 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC ++++L L KC  +S+ G+V+  +   S+ SL +E C  I   G+  I      K
Sbjct  210  IARGCHSLEKLDLTKCPSISNKGLVAIAENCPSLTSLTIESCKNIGNEGLQAI-GRCCTK  268

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L++L  ++C  + D A  V  L   N+       +     D SL V+      ++ LNL 
Sbjct  269  LESLTIKDCPLVGDQAV-VSLLSSGNTRLKKVKLHSLNITDFSLAVIGHYGKAIIDLNLC  327

Query  365  GLNGVTDYGLLPFVQSCDAG---LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             L  V+  G   +V     G   L  + ++ CI +T+ ++ A+ K     ++ + L  C 
Sbjct  328  KLGHVSPRGF--WVMGAAQGLQSLASLTVTSCIGLTNPSLEAVGK-GCTNIKSMCLRECE  384

Query  536  CVTDASLAAIADYCSVLRDL  595
             VTD+ L A A     L  L
Sbjct  385  RVTDSGLVAFAQAAGSLEYL  404



>ref|XP_010533156.1| PREDICTED: EIN3-binding F-box protein 1-like [Tarenaya hassleriana]
Length=632

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 143/194 (74%), Gaps = 0/194 (0%)
 Frame = +2

Query  26   VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE  205
            +K + LRKC  +SDNG+V F KA  S+E+LQLEEC+R++Q+G+ G+L  S   LK+L+  
Sbjct  363  LKHVFLRKCCFVSDNGLVEFSKAIGSLETLQLEECNRVTQSGICGVLSSSGANLKSLSLL  422

Query  206  NCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTD  385
             C GMKDL  G   L PCNSLRSL++CNC GFG+  L +L +L P L +L+L GL G TD
Sbjct  423  RCTGMKDLTLGSMDLSPCNSLRSLTVCNCPGFGNVGLTILGKLSPQLQNLDLGGLYGTTD  482

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
             GLLP +++  AGLV VNLSGC N+TD+ +  +AK HGETLE+LNL GC  +TD+SL+AI
Sbjct  483  AGLLPIIENNRAGLVSVNLSGCFNLTDEVVYYLAKFHGETLEVLNLEGCRRITDSSLSAI  542

Query  566  ADYCSVLRDLDISK  607
            A+ C  L+DLD+SK
Sbjct  543  AESCLFLKDLDMSK  556


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 82/191 (43%), Gaps = 6/191 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++ CP+++ L L     + D G+    K    +E L L  C  +S  G+  I  +   
Sbjct  171  AIARSCPSLRSLSLWNVLRVGDKGLSEVAKECRLLEKLDLCHCPSVSSLGLIAIARYCP-  229

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVL-SRLCPNLVHLN  358
             L  L  E+C  + + A        C  L S S+ +C   GD  +  L S   P L  +N
Sbjct  230  NLTTLHIESCPKIGNEALQAVG-QCCPKLASTSVKDCPLIGDHGISSLVSSASPTLSKVN  288

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE-TLELLNLNGCG  535
            + GL G+TD+  L  +      +  + LS   NVT++    +    G   L  L +  C 
Sbjct  289  IHGL-GITDFS-LAVIGHYGKSISSLMLSNLPNVTERGFWVMGNAQGLCKLMSLGITSCK  346

Query  536  CVTDASLAAIA  568
             +TD S  A+ 
Sbjct  347  GITDLSFGALG  357


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 87/185 (47%), Gaps = 4/185 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C  + +L +R  +++SD GV +  ++  S+ SL L    R+   G+  +       L+ L
Sbjct  150  CDGLVKLSIRGSSMVSDFGVSAIARSCPSLRSLSLWNVLRVGDKGLSEV-AKECRLLEKL  208

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
               +C  +  L   +     C +L +L I +C   G+ +L  + + CP L   ++     
Sbjct  209  DLCHCPSVSSLGL-IAIARYCPNLTTLHIESCPKIGNEALQAVGQCCPKLASTSVKDCPL  267

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            + D+G+   V S    L KVN+ G + +TD +++ I   +G+++  L L+    VT+   
Sbjct  268  IGDHGISSLVSSASPTLSKVNIHG-LGITDFSLAVIGH-YGKSISSLMLSNLPNVTERGF  325

Query  557  AAIAD  571
              + +
Sbjct  326  WVMGN  330



>ref|XP_010417316.1| PREDICTED: EIN3-binding F-box protein 1-like [Camelina sativa]
Length=632

 Score =   220 bits (560),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 148/202 (73%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + +  LLSDNG+VSF KA+ S+ES+QLEECHR++Q G FG L++   
Sbjct  359  SVGKGCPNMKKAIISRSPLLSDNGLVSFAKASVSLESVQLEECHRVTQFGFFGSLLNCGE  418

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DLA G+PA P C++LRSLSI NC GFGDA+L  L +LCP L  ++L
Sbjct  419  KLKAFSLVNCLGIRDLATGLPASPHCSALRSLSIRNCPGFGDANLAALGKLCPQLEEIDL  478

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L   Q+    LVKVN SGC ++TDK +SAI   +G TLE+LN++GC  +
Sbjct  479  CGLKGITESGFLHLTQN---SLVKVNFSGCSSLTDKVVSAITARNGWTLEVLNIDGCSNI  535

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DAS+ +IA  C +L DLD+SK
Sbjct  536  SDASMVSIAANCQILSDLDLSK  557


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 89/169 (53%), Gaps = 15/169 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC  +++L L +C+ ++D G+V+  ++  ++  L LE C RI   G+  I   S  K
Sbjct  202  IAEGCTQLEKLDLNRCSTITDKGLVAIARSCPNLSELTLEACSRIGDEGLQAI-ARSCSK  260

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLR----SLSICNCTGFGDASLVVLSRLCPNLVH  352
            LK+++ +NC  ++D   G+ +L    +       L + N T   D SL V+     ++  
Sbjct  261  LKSVSIKNCPLVRDQ--GIASLLSNTTFSLAKLKLQMLNVT---DVSLAVVGHYGLSVTD  315

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            L LSGL+ V++ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  316  LVLSGLSHVSEKGF--WVMGNGVGLQKLNSLTITACQGVTDAGLESVGK  362


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 93/205 (45%), Gaps = 6/205 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ + CP++  L L   + ++DNG++   +    +E L L  C  I+  G+  I   S  
Sbjct  175  SIGRSCPSLGSLSLWNLSTVTDNGLLEIAEGCTQLEKLDLNRCSTITDKGLVAI-ARSCP  233

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L  L  E C  + D      A   C+ L+S+SI NC    D  +  +LS    +L  L 
Sbjct  234  NLSELTLEACSRIGDEGLQAIA-RSCSKLKSVSIKNCPLVRDQGIASLLSNTTFSLAKLK  292

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN VTD   L  V      +  + LSG  +V++K    +    G + L  L +  C 
Sbjct  293  LQMLN-VTDVS-LAVVGHYGLSVTDLVLSGLSHVSEKGFWVMGNGVGLQKLNSLTITACQ  350

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             VTDA L ++   C  ++   IS+S
Sbjct  351  GVTDAGLESVGKGCPNMKKAIISRS  375


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 100/252 (40%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL---VH  172
            A+++ CPN+ +L L  C+ + D G+ +  ++   ++S+ ++ C  +   G+  +L     
Sbjct  227  AIARSCPNLSELTLEACSRIGDEGLQAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTF  286

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPCNS--------------LRSLSI  283
            S  KLK         +LA    +G+      +  L   +               L SL+I
Sbjct  287  SLAKLKLQMLNVTDVSLAVVGHYGLSVTDLVLSGLSHVSEKGFWVMGNGVGLQKLNSLTI  346

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
              C G  DA L  + + CPN+    +S    ++D GL+ F ++                 
Sbjct  347  TACQGVTDAGLESVGKGCPNMKKAIISRSPLLSDNGLVSFAKASVSLESVQLEECHRVTQ  406

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C   L   +L  C+ + D      A  H   L  L++  C    DA+LAA+
Sbjct  407  FGFFGSLLNCGEKLKAFSLVNCLGIRDLATGLPASPHCSALRSLSIRNCPGFGDANLAAL  466

Query  566  ADYCSVLRDLDI  601
               C  L ++D+
Sbjct  467  GKLCPQLEEIDL  478


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +2

Query  305  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI  484
            D  L  + R CP+L  L+L  L+ VTD GLL   + C   L K++L+ C  +TDK + AI
Sbjct  170  DVGLRSIGRSCPSLGSLSLWNLSTVTDNGLLEIAEGCTQ-LEKLDLNRCSTITDKGLVAI  228

Query  485  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            A+     L  L L  C  + D  L AIA  CS L+ + I
Sbjct  229  AR-SCPNLSELTLEACSRIGDEGLQAIARSCSKLKSVSI  266


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 88/183 (48%), Gaps = 5/183 (3%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            S  C  ++ L +R C    D  + +  K    +E + L     I+++G   +  +S  K+
Sbjct  441  SPHCSALRSLSIRNCPGFGDANLAALGKLCPQLEEIDLCGLKGITESGFLHLTQNSLVKV  500

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
                F  C  + D            +L  L+I  C+   DAS+V ++  C  L  L+LS 
Sbjct  501  N---FSGCSSLTDKVVSAITARNGWTLEVLNIDGCSNISDASMVSIAANCQILSDLDLSK  557

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
             + ++D G+     S    L  ++++GC  VTDK+++AI +L G TL  LNL  C  +++
Sbjct  558  CS-ISDSGIQALASSDKLKLQILSMAGCSMVTDKSLAAIVRL-GSTLLGLNLQQCRSISN  615

Query  548  ASL  556
            +++
Sbjct  616  STV  618



>dbj|BAH20224.1| AT2G25490 [Arabidopsis thaliana]
Length=604

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + K  LLSDNG+VSF KA+ S+ESLQLEECHR++Q G FG L++   
Sbjct  331  SVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGE  390

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC  ++DL  G+PA   C++LRSLSI NC GFGDA+L  + +LCP L  ++L
Sbjct  391  KLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDL  450

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  +QS    LVK+N SGC N+TD+ ISAI   +G TLE+LN++GC  +
Sbjct  451  CGLKGITESGFLHLIQS---SLVKINFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNI  507

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL +IA  C +L DLDISK
Sbjct  508  TDASLVSIAANCQILSDLDISK  529


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 60/252 (24%), Positives = 101/252 (40%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH---  172
            A++K CPN+ +L L  C+ + D G+++  ++   ++S+ ++ C  +   G+  +L +   
Sbjct  199  AIAKSCPNLTELTLEACSRIGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTC  258

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPCNS--------------LRSLSI  283
            S  KLK         +LA    +G+      +  L   +               L SL+I
Sbjct  259  SLAKLKLQMLNVTDVSLAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNSLTI  318

Query  284  CNCTGFGDASLVVLSRLCPN--------------------------LVHLNLSGLNGVTD  385
              C G  D  L  + + CPN                          L  L L   + VT 
Sbjct  319  TACQGVTDMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQ  378

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G    + +C   L   +L  C+++ D T    A  H   L  L++  C    DA+LAAI
Sbjct  379  FGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAI  438

Query  566  ADYCSVLRDLDI  601
               C  L D+D+
Sbjct  439  GKLCPQLEDIDL  450


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 91/169 (54%), Gaps = 15/169 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC  +++L L +C+ ++D G+V+  K+  ++  L LE C RI   G+  I   S  K
Sbjct  174  IAEGCAQLEKLELNRCSTITDKGLVAIAKSCPNLTELTLEACSRIGDEGLLAI-ARSCSK  232

Query  185  LKALAFENCFGMKDLAFGVPAL---PPCNSLR-SLSICNCTGFGDASLVVLSRLCPNLVH  352
            LK+++ +NC  ++D   G+ +L     C+  +  L + N T   D SL V+     ++  
Sbjct  233  LKSVSIKNCPLVRDQ--GIASLLSNTTCSLAKLKLQMLNVT---DVSLAVVGHYGLSITD  287

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            L L+GL+ V++ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  288  LVLAGLSHVSEKGF--WVMGNGVGLQKLNSLTITACQGVTDMGLESVGK  334


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 93/205 (45%), Gaps = 6/205 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ + CP++  L L   + ++DNG++   +    +E L+L  C  I+  G+  I   S  
Sbjct  147  SIGRSCPSLGSLSLWNVSTITDNGLLEIAEGCAQLEKLELNRCSTITDKGLVAI-AKSCP  205

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L  L  E C  + D      A   C+ L+S+SI NC    D  +  +LS    +L  L 
Sbjct  206  NLTELTLEACSRIGDEGLLAIA-RSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLK  264

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN VTD   L  V      +  + L+G  +V++K    +    G + L  L +  C 
Sbjct  265  LQMLN-VTDVS-LAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNSLTITACQ  322

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             VTD  L ++   C  ++   ISKS
Sbjct  323  GVTDMGLESVGKGCPNMKKAIISKS  347


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 54/105 (51%), Gaps = 2/105 (2%)
 Frame = +2

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
            N     D  L  + R CP+L  L+L  ++ +TD GLL   + C A L K+ L+ C  +TD
Sbjct  136  NSAKVSDLGLRSIGRSCPSLGSLSLWNVSTITDNGLLEIAEGC-AQLEKLELNRCSTITD  194

Query  467  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            K + AIAK     L  L L  C  + D  L AIA  CS L+ + I
Sbjct  195  KGLVAIAK-SCPNLTELTLEACSRIGDEGLLAIARSCSKLKSVSI  238


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 85/183 (46%), Gaps = 5/183 (3%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            S  C  ++ L +R C    D  + +  K    +E + L     I+++G   ++  S  K+
Sbjct  413  SSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDLCGLKGITESGFLHLIQSSLVKI  472

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
                F  C  + D            +L  L+I  C+   DASLV ++  C  L  L++S 
Sbjct  473  N---FSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISK  529

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
               ++D G+     S    L  ++++GC  VTDK++ AI  L G TL  LNL  C  +++
Sbjct  530  C-AISDSGIQALASSDKLKLQILSVAGCSMVTDKSLPAIVGL-GSTLLGLNLQQCRSISN  587

Query  548  ASL  556
            +++
Sbjct  588  STV  590



>ref|NP_565597.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
 sp|Q9SKK0.1|EBF1_ARATH RecName: Full=EIN3-binding F-box protein 1; AltName: Full=F-box/LRR-repeat 
protein 6 [Arabidopsis thaliana]
 gb|AAD20708.1| F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAL60026.1| putative F-box protein family, AtFBL6 [Arabidopsis thaliana]
 gb|AAM14272.1| unknown protein [Arabidopsis thaliana]
 emb|CAE75864.1| F-box protein [Arabidopsis thaliana]
 gb|AEC07708.1| EIN3-binding F-box protein 1 [Arabidopsis thaliana]
Length=628

 Score =   219 bits (559),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + K  LLSDNG+VSF KA+ S+ESLQLEECHR++Q G FG L++   
Sbjct  355  SVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGE  414

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC  ++DL  G+PA   C++LRSLSI NC GFGDA+L  + +LCP L  ++L
Sbjct  415  KLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDL  474

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  +QS    LVK+N SGC N+TD+ ISAI   +G TLE+LN++GC  +
Sbjct  475  CGLKGITESGFLHLIQS---SLVKINFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNI  531

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL +IA  C +L DLDISK
Sbjct  532  TDASLVSIAANCQILSDLDISK  553


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/252 (24%), Positives = 101/252 (40%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH---  172
            A++K CPN+ +L L  C+ + D G+++  ++   ++S+ ++ C  +   G+  +L +   
Sbjct  223  AIAKSCPNLTELTLEACSRIGDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTC  282

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPCNS--------------LRSLSI  283
            S  KLK         +LA    +G+      +  L   +               L SL+I
Sbjct  283  SLAKLKLQMLNVTDVSLAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNSLTI  342

Query  284  CNCTGFGDASLVVLSRLCPN--------------------------LVHLNLSGLNGVTD  385
              C G  D  L  + + CPN                          L  L L   + VT 
Sbjct  343  TACQGVTDMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQ  402

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G    + +C   L   +L  C+++ D T    A  H   L  L++  C    DA+LAAI
Sbjct  403  FGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAI  462

Query  566  ADYCSVLRDLDI  601
               C  L D+D+
Sbjct  463  GKLCPQLEDIDL  474


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 91/169 (54%), Gaps = 15/169 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC  +++L L +C+ ++D G+V+  K+  ++  L LE C RI   G+  I   S  K
Sbjct  198  IAEGCAQLEKLELNRCSTITDKGLVAIAKSCPNLTELTLEACSRIGDEGLLAI-ARSCSK  256

Query  185  LKALAFENCFGMKDLAFGVPAL---PPCNSLR-SLSICNCTGFGDASLVVLSRLCPNLVH  352
            LK+++ +NC  ++D   G+ +L     C+  +  L + N T   D SL V+     ++  
Sbjct  257  LKSVSIKNCPLVRDQ--GIASLLSNTTCSLAKLKLQMLNVT---DVSLAVVGHYGLSITD  311

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            L L+GL+ V++ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  312  LVLAGLSHVSEKGF--WVMGNGVGLQKLNSLTITACQGVTDMGLESVGK  358


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 93/205 (45%), Gaps = 6/205 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ + CP++  L L   + ++DNG++   +    +E L+L  C  I+  G+  I   S  
Sbjct  171  SIGRSCPSLGSLSLWNVSTITDNGLLEIAEGCAQLEKLELNRCSTITDKGLVAI-AKSCP  229

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L  L  E C  + D      A   C+ L+S+SI NC    D  +  +LS    +L  L 
Sbjct  230  NLTELTLEACSRIGDEGLLAIA-RSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLK  288

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN VTD   L  V      +  + L+G  +V++K    +    G + L  L +  C 
Sbjct  289  LQMLN-VTDVS-LAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNSLTITACQ  346

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             VTD  L ++   C  ++   ISKS
Sbjct  347  GVTDMGLESVGKGCPNMKKAIISKS  371


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 54/105 (51%), Gaps = 2/105 (2%)
 Frame = +2

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
            N     D  L  + R CP+L  L+L  ++ +TD GLL   + C A L K+ L+ C  +TD
Sbjct  160  NSAKVSDLGLRSIGRSCPSLGSLSLWNVSTITDNGLLEIAEGC-AQLEKLELNRCSTITD  218

Query  467  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            K + AIAK     L  L L  C  + D  L AIA  CS L+ + I
Sbjct  219  KGLVAIAK-SCPNLTELTLEACSRIGDEGLLAIARSCSKLKSVSI  262


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 85/183 (46%), Gaps = 5/183 (3%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            S  C  ++ L +R C    D  + +  K    +E + L     I+++G   ++  S  K+
Sbjct  437  SSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDLCGLKGITESGFLHLIQSSLVKI  496

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
                F  C  + D            +L  L+I  C+   DASLV ++  C  L  L++S 
Sbjct  497  N---FSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISK  553

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
               ++D G+     S    L  ++++GC  VTDK++ AI  L G TL  LNL  C  +++
Sbjct  554  C-AISDSGIQALASSDKLKLQILSVAGCSMVTDKSLPAIVGL-GSTLLGLNLQQCRSISN  611

Query  548  ASL  556
            +++
Sbjct  612  STV  614



>gb|KJB07621.1| hypothetical protein B456_001G033400 [Gossypium raimondii]
Length=613

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 147/202 (73%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGC N+KQ  + KC LLSD G+VSF K A S+ESLQLE+CHRI+Q G+F  L++ + 
Sbjct  338  AVGKGCVNLKQFYIFKCDLLSDKGLVSFAKVAGSLESLQLEDCHRITQIGLFCSLLNCSA  397

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK ++  NC G+ DL  G+P L PC SL+SLSI NC GF D+SL V+ +LCP L H+ L
Sbjct  398  KLKVISLVNCLGVMDLTTGLPPLSPCESLQSLSIRNCPGFSDSSLAVMGKLCPQLQHVEL  457

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL+G+TD G L  ++S +AGLVKVNL  C+N++DK +  +  LH  TLE LNL+GC  +
Sbjct  458  RGLHGITDAGFLQLLKSRNAGLVKVNLKDCVNLSDKGVCRLTNLHRWTLETLNLDGCK-I  516

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIA+ C +L DLD+SK
Sbjct  517  SDASLFAIAENCRLLGDLDVSK  538


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 55/254 (22%), Positives = 102/254 (40%), Gaps = 56/254 (22%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A++KGCP +  L +  C  + + G+++      +++S+ ++ C  +   GV         
Sbjct  206  AIAKGCPKLNDLTIESCANVGNEGLLALACYCPNLKSVSIKNCPLVGDQGVASLLSSASY  265

Query  155  ------------------------------------------FGILVHSAG--KLKALAF  202
                                                      F I+ +S G  KLK+   
Sbjct  266  SLTKLKLQALNITDEMFSVIGHYGKSVTDLSLTSLPNVSDKGFWIMGNSQGLQKLKSFTI  325

Query  203  ENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV  379
             +C G+ D   G+ A+   C +L+   I  C    D  LV  +++  +L  L L   + +
Sbjct  326  ASCLGLTD--RGLEAVGKGCVNLKQFYIFKCDLLSDKGLVSFAKVAGSLESLQLEDCHRI  383

Query  380  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  559
            T  GL   + +C A L  ++L  C+ V D T         E+L+ L++  C   +D+SLA
Sbjct  384  TQIGLFCSLLNCSAKLKVISLVNCLGVMDLTTGLPPLSPCESLQSLSIRNCPGFSDSSLA  443

Query  560  AIADYCSVLRDLDI  601
             +   C  L+ +++
Sbjct  444  VMGKLCPQLQHVEL  457



>ref|XP_006293838.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
 gb|EOA26736.1| hypothetical protein CARUB_v10022822mg [Capsella rubella]
Length=628

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 148/202 (73%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + +  LLSDNG+VSF KA+ S+ES+QLEECHR++Q G FG L++   
Sbjct  355  SVGKGCPNMKKAIISRSPLLSDNGLVSFAKASLSLESVQLEECHRVTQFGFFGSLLNCGE  414

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DL  G+PA P C++LRSLSI NC GFGDA+L  + +LCP L  ++L
Sbjct  415  KLKAFSLVNCLGIRDLTTGLPASPHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDL  474

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  VQ+    LVKVN +GC N+TD+ ISAI   +G TLE+LN++GC  +
Sbjct  475  CGLKGITESGFLHLVQN---SLVKVNFNGCSNLTDRVISAITARNGWTLEVLNVDGCSKI  531

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL +IA  C +L DLD+SK
Sbjct  532  SDASLVSIAANCQILSDLDLSK  553


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 101/252 (40%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL---VH  172
            A+++ CPN+ +L L  C+ + D G+ +  ++   ++S+ ++ C  +   G+  +L     
Sbjct  223  AIARSCPNLSELTLEACSRIGDEGLQAIARSCSKLKSVLIKNCPLVRDQGIAALLSNTTF  282

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPCNS--------------LRSLSI  283
            S  KLK         +LA    +G+      +  LP  +               L SL+I
Sbjct  283  SLAKLKLQMLNVTDVSLAVVGHYGLSVTDLVLSGLPHVSEKGFWVMGNGVGLQKLNSLTI  342

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
              C G  D  L  + + CPN+    +S    ++D GL+ F ++                 
Sbjct  343  TACQGVTDTGLESVGKGCPNMKKAIISRSPLLSDNGLVSFAKASLSLESVQLEECHRVTQ  402

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C   L   +L  C+ + D T    A  H   L  L++  C    DA+LAAI
Sbjct  403  FGFFGSLLNCGEKLKAFSLVNCLGIRDLTTGLPASPHCSALRSLSIRNCPGFGDANLAAI  462

Query  566  ADYCSVLRDLDI  601
               C  L D+D+
Sbjct  463  GKLCPQLEDIDL  474


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 87/169 (51%), Gaps = 15/169 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC  +++L L +C+ ++D G+V+  ++  ++  L LE C RI   G+  I   S  K
Sbjct  198  IAEGCSQLEKLELNRCSTITDKGLVAIARSCPNLSELTLEACSRIGDEGLQAI-ARSCSK  256

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLR----SLSICNCTGFGDASLVVLSRLCPNLVH  352
            LK++  +NC  ++D   G+ AL    +       L + N T   D SL V+     ++  
Sbjct  257  LKSVLIKNCPLVRDQ--GIAALLSNTTFSLAKLKLQMLNVT---DVSLAVVGHYGLSVTD  311

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            L LSGL  V++ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  312  LVLSGLPHVSEKGF--WVMGNGVGLQKLNSLTITACQGVTDTGLESVGK  358


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 88/183 (48%), Gaps = 5/183 (3%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            S  C  ++ L +R C    D  + +  K    +E + L     I+++G   ++ +S  K+
Sbjct  437  SPHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDLCGLKGITESGFLHLVQNSLVKV  496

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
                F  C  + D            +L  L++  C+   DASLV ++  C  L  L+LS 
Sbjct  497  N---FNGCSNLTDRVISAITARNGWTLEVLNVDGCSKISDASLVSIAANCQILSDLDLSK  553

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
             + ++D G+     S +  L  ++L+GC  VTD+++ AI  L G TL  LNL  C  +++
Sbjct  554  CS-ISDCGIQALASSDNLKLQILSLAGCSMVTDESLPAIVSL-GSTLLGLNLQQCRSISN  611

Query  548  ASL  556
            +++
Sbjct  612  STV  614


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 52/99 (53%), Gaps = 2/99 (2%)
 Frame = +2

Query  305  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI  484
            D  L  + R C +L  L+L  L+ VTD GLL   + C + L K+ L+ C  +TDK + AI
Sbjct  166  DVGLRSIGRSCASLGSLSLWNLSSVTDNGLLEIAEGC-SQLEKLELNRCSTITDKGLVAI  224

Query  485  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            A+     L  L L  C  + D  L AIA  CS L+ + I
Sbjct  225  AR-SCPNLSELTLEACSRIGDEGLQAIARSCSKLKSVLI  262


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 60/124 (48%), Gaps = 18/124 (15%)
 Frame = +2

Query  257  CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV  436
            C+ L  L +  C+   D  LV ++R CPNL  L L   + + D GL    +SC + L  V
Sbjct  202  CSQLEKLELNRCSTITDKGLVAIARSCPNLSELTLEACSRIGDEGLQAIARSC-SKLKSV  260

Query  437  NLSGCINVTDKTISAI--------AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD  592
             +  C  V D+ I+A+        AKL    L++LN      VTD SLA +  Y   + D
Sbjct  261  LIKNCPLVRDQGIAALLSNTTFSLAKLK---LQMLN------VTDVSLAVVGHYGLSVTD  311

Query  593  LDIS  604
            L +S
Sbjct  312  LVLS  315



>ref|XP_004242782.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=641

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 148/201 (74%), Gaps = 1/201 (0%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V KGC N+K +C R+C  ++D+G+V+F +AA S+E L LE+C +I+Q G+    V    K
Sbjct  367  VGKGCTNMKSMCFRECKHVTDSGLVAFAQAAGSLEHLLLEQCDKITQTGILNA-VSICSK  425

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK+L+   C G++DL     +L PC+SLRSLSI +C GFG  SL ++ +LCP L HL+LS
Sbjct  426  LKSLSLVKCLGVRDLPPQASSLSPCDSLRSLSIRSCPGFGSTSLAMVGKLCPQLHHLDLS  485

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            GL  +TD GLLP ++S  AGLVKVNL+ C+NVTD+ + ++A+LHGETLELLNL+GC  VT
Sbjct  486  GLTRITDAGLLPLLESSKAGLVKVNLTHCMNVTDEVVLSLARLHGETLELLNLDGCRKVT  545

Query  545  DASLAAIADYCSVLRDLDISK  607
            DASL AIAD C +L DLD+SK
Sbjct  546  DASLVAIADNCLLLNDLDVSK  566


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 96/201 (48%), Gaps = 8/201 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G++   +   S+E L L +C  +S  G+  I   +  
Sbjct  182  AIAHGCPSLRVLSLWDVQDVGDEGLMEIARGCHSLEKLDLTKCPSVSNKGLVAI-AENCP  240

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C  L SL+I +C   GD ++V +LS     L  +
Sbjct  241  SLTSLTIESCKHIGN--EGLQAIGRCCTKLESLTIKDCPLVGDQAVVSLLSSDNTRLRKV  298

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  L  +      +  +NL    +V+ +    +   HG ++L  L +  C
Sbjct  299  KLHSLN-ITDFS-LAIIGHYGKAITDLNLCKLEHVSPRGFWVMGAAHGLQSLASLTVTSC  356

Query  533  GCVTDASLAAIADYCSVLRDL  595
              + D SL  +   C+ ++ +
Sbjct  357  IGLADESLEEVGKGCTNMKSM  377


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 85/185 (46%), Gaps = 2/185 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C       +    K    +  L L    RI+ AG+  +L  S   L  +
Sbjct  450  CDSLRSLSIRSCPGFGSTSLAMVGKLCPQLHHLDLSGLTRITDAGLLPLLESSKAGLVKV  509

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
               +C  + D      A     +L  L++  C    DASLV ++  C  L  L++S  + 
Sbjct  510  NLTHCMNVTDEVVLSLARLHGETLELLNLDGCRKVTDASLVAIADNCLLLNDLDVSKCS-  568

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD G+    Q     L  ++LSGC  VT+K+ S++  L GE+L  LNL  C  +  + +
Sbjct  569  ITDSGVAALSQGVQMNLQVLSLSGCSMVTNKSFSSLRTL-GESLIGLNLQHCSSIGSSRV  627

Query  557  AAIAD  571
             A+ +
Sbjct  628  EALVE  632


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 94/201 (47%), Gaps = 10/201 (5%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC ++++L L KC  +S+ G+V+  +   S+ SL +E C  I   G+  I      K
Sbjct  209  IARGCHSLEKLDLTKCPSVSNKGLVAIAENCPSLTSLTIESCKHIGNEGLQAI-GRCCTK  267

Query  185  LKALAFENCFGMKDLAFGVPALPPCNS-LRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            L++L  ++C  + D A  V  L   N+ LR + + +     D SL ++      +  LNL
Sbjct  268  LESLTIKDCPLVGDQAV-VSLLSSDNTRLRKVKL-HSLNITDFSLAIIGHYGKAITDLNL  325

Query  362  SGLNGVTDYGLLPFVQSCDAG---LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGC  532
              L  V+  G   +V     G   L  + ++ CI + D+++  + K     ++ +    C
Sbjct  326  CKLEHVSPRGF--WVMGAAHGLQSLASLTVTSCIGLADESLEEVGK-GCTNMKSMCFREC  382

Query  533  GCVTDASLAAIADYCSVLRDL  595
              VTD+ L A A     L  L
Sbjct  383  KHVTDSGLVAFAQAAGSLEHL  403



>ref|XP_008362900.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 154/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLRKC  +SDNG+V+F KAA S+ESLQLEEC+R++Q+G+   L +   
Sbjct  371  AIGKGCTNLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRVTQSGIISALSNCGE  430

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL++L    C G+KD+   VP    C SLRSLSI NC GFG ASL ++ RLCP L ++++
Sbjct  431  KLRSLTLVKCMGIKDVGAAVPIXSSCRSLRSLSIRNCPGFGSASLAMVGRLCPQLHNVDM  490

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+L  ++S + GLVKVNL+GC+N+TD+ + A+ +LHGETLE+LNL+GC  +
Sbjct  491  SGLYGMTDAGVLSLLESLEEGLVKVNLNGCLNLTDEVVMALVRLHGETLEVLNLDGCRKI  550

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASLA IA+ C  LR+LD+SK
Sbjct  551  TDASLATIANNCLFLRELDVSK  572


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 95/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP++K L L   + + D G++   K    +  L L +C  IS  G+  I   +  
Sbjct  187  AVAQGCPSLKSLALWDISSVGDEGLIEIAKGCPLLAKLDLFQCPSISNXGLIAI-AENCP  245

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHL  355
             L  L  E+C  + +   G+ A+   C  L+S+ I +C   GD     +LS     L+ +
Sbjct  246  NLTXLNIESCSRIGN--EGLQAIGRSCXKLQSICIRDCVLVGDHGVSSLLSSGSSVLMKV  303

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  L  +      +  + LSG  NV++K    +      + L  L +  C
Sbjct  304  RLQALN-ITDFS-LAVIGHYGKAVTNLFLSGLQNVSEKGFWVMGNAQALQNLASLTITSC  361

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD SL AI   C+ L+ + + K
Sbjct  362  RGTTDVSLEAIGKGCTNLKQMCLRK  386



>ref|XP_010047961.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
Length=654

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+C+RKC  +SD G+++F  A  S+E LQ+EE  RIS  GV G++ +   
Sbjct  378  AIGKGCTNLKQMCIRKCLFVSDAGLIAFSGAVSSLEYLQVEELDRISMRGVIGVISNCEM  437

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+KDL  G   L  C SLRSLSI NC GFG ASL ++ +LCP+L H++L
Sbjct  438  KLKSLSIAKCMGIKDLLEGSLMLSSCTSLRSLSIRNCPGFGSASLAMVGKLCPHLEHIDL  497

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
              L G+TD GL P +++ +AGLVKVNLS C+N+TD+ +S + +LHG TLELLNL+GC  V
Sbjct  498  ISLCGLTDAGLSPLLENSEAGLVKVNLSNCLNITDEAVSTLVRLHGGTLELLNLDGCRKV  557

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIAD C +L DLD+SK
Sbjct  558  SDASLVAIADNCLLLNDLDMSK  579


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 99/205 (48%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + + D+G+V   K    ++ L L +C  +S  G+  I   +  
Sbjct  194  AIARGCPSLRALSLWNLSSIGDDGLVEIAKECRLLKKLDLSQCPFVSNKGLIAI-AENCR  252

Query  182  KLKALAFENCFGMKDLAFGVPALPPC-NSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+  C   L+S+SI +C   GD     ++S     L  +
Sbjct  253  DLISLNIESCPKIGN--EGLEAIGRCCPRLQSISIKDCPLVGDHGVASLVSSASSVLSKI  310

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L GLN +TD+ L   +      +  + L    N ++K    +    G + +  L +  C
Sbjct  311  KLQGLN-ITDFSL-AVIGHFGLAVTSLFLGSLRNASEKGFWVMGNAQGLKKVSSLTIASC  368

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              +TD SLAAI   C+ L+ + I K
Sbjct  369  HGITDLSLAAIGKGCTNLKQMCIRK  393



>ref|XP_002880682.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56941.1| ein3-binding F box protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   217 bits (552),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + K  LLSDNG+VSF KA+ S+ESLQLEECHR++Q G FG L++   
Sbjct  356  SVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCGE  415

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC  ++DL  G+PA   C++LRSLSI NC GFGDA+L  + +LCP L  ++L
Sbjct  416  KLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAIGKLCPQLEEIDL  475

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  ++S    LVKVN SGC N+TD+ ISAI   +G TLE+LN++GC  +
Sbjct  476  CGLKGITESGFLHLIKS---SLVKVNFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNI  532

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL +IA  C +L DLD+SK
Sbjct  533  TDASLVSIAANCQILSDLDLSK  554


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 92/169 (54%), Gaps = 15/169 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GCP +++L L +C+ ++D G+V+  K+  ++  L LE C +I   G+  I   S  K
Sbjct  199  IAEGCPQLEKLDLNQCSTITDKGLVAIAKSCPNLSELTLEACSKIGDEGLQAI-ARSCSK  257

Query  185  LKALAFENCFGMKDLAFGVPAL---PPCNSLR-SLSICNCTGFGDASLVVLSRLCPNLVH  352
            LK+++ +NC  ++D   G+ +L     C+  +  L + N T   D SL V+     ++  
Sbjct  258  LKSVSIKNCPLVRDQ--GIASLLSNTTCSLAKLKLQMLNVT---DVSLAVVGHYGLSITD  312

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            L L+GL+ V++ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  313  LVLAGLSHVSEKGF--WVMGNGVGLQKLNALTITACQGVTDTGLESVGK  359


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 93/205 (45%), Gaps = 6/205 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ + CP++  L L   + +SDNG++   +    +E L L +C  I+  G+  I   S  
Sbjct  172  SIGRSCPSLGSLSLWNLSTISDNGLLEIAEGCPQLEKLDLNQCSTITDKGLVAI-AKSCP  230

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L  L  E C  + D      A   C+ L+S+SI NC    D  +  +LS    +L  L 
Sbjct  231  NLSELTLEACSKIGDEGLQAIA-RSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLK  289

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN VTD   L  V      +  + L+G  +V++K    +    G + L  L +  C 
Sbjct  290  LQMLN-VTDVS-LAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNALTITACQ  347

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             VTD  L ++   C  ++   ISKS
Sbjct  348  GVTDTGLESVGKGCPNMKKAIISKS  372


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 100/252 (40%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH---  172
            A++K CPN+ +L L  C+ + D G+ +  ++   ++S+ ++ C  +   G+  +L +   
Sbjct  224  AIAKSCPNLSELTLEACSKIGDEGLQAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTC  283

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPCNS--------------LRSLSI  283
            S  KLK         +LA    +G+      +  L   +               L +L+I
Sbjct  284  SLAKLKLQMLNVTDVSLAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNALTI  343

Query  284  CNCTGFGDASLVVLSRLCPN--------------------------LVHLNLSGLNGVTD  385
              C G  D  L  + + CPN                          L  L L   + VT 
Sbjct  344  TACQGVTDTGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESLQLEECHRVTQ  403

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G    + +C   L   +L  C+++ D T    A  H   L  L++  C    DA+LAAI
Sbjct  404  FGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPASSHCSALRSLSIRNCPGFGDANLAAI  463

Query  566  ADYCSVLRDLDI  601
               C  L ++D+
Sbjct  464  GKLCPQLEEIDL  475


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +2

Query  305  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI  484
            D  L  + R CP+L  L+L  L+ ++D GLL   + C   L K++L+ C  +TDK + AI
Sbjct  167  DIGLTSIGRSCPSLGSLSLWNLSTISDNGLLEIAEGCPQ-LEKLDLNQCSTITDKGLVAI  225

Query  485  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            AK     L  L L  C  + D  L AIA  CS L+ + I
Sbjct  226  AK-SCPNLSELTLEACSKIGDEGLQAIARSCSKLKSVSI  263



>ref|XP_010907279.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=662

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 144/202 (71%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KGCPN+KQLCLR+C  LSD G+ +F   A ++E+L LEEC+RIS  GV G L++   
Sbjct  386  AIAKGCPNLKQLCLRRCCYLSDAGLKAFAITARALENLHLEECNRISLIGVLGCLLNCNE  445

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   C G+KD++F    LP C SLRSL+I +C GF  ASL V+ ++CP L H++L
Sbjct  446  KFRALSLVKCLGIKDISFCTAPLPSCLSLRSLTIRDCPGFTGASLAVVGKICPQLQHVDL  505

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL   TD GLLP ++S + GLV VNL GC+++TD  ++A+ K HG TL++LNL GC  V
Sbjct  506  SGLVSATDAGLLPLIESSEVGLVTVNLRGCVDLTDAVVTALVKAHGSTLQMLNLEGCKKV  565

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD SL  IAD CS L DLD+S+
Sbjct  566  TDKSLLVIADSCSFLDDLDMSR  587


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 95/204 (47%), Gaps = 8/204 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L L +C L+SD G+++  +   ++ SL +E C  I   G+  I      K
Sbjct  229  IASGCPMLEKLDLCQCPLISDKGLIAVARKCPNLTSLMVESCLSIGNEGLQAI-GRCCPK  287

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK++  ++C  + D           + L  + + N     D SL V+      +  L L+
Sbjct  288  LKSIVIKDCPRVGDQGVASLVSAASSFLARIRLEN-VNISDVSLAVIGHYGKAVADLALT  346

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
            GL  V++ G   +V     GL  +    ++ C  VTD  + AIAK     L+ L L  C 
Sbjct  347  GLQSVSERGF--WVMGNAFGLQNLESIMINSCRGVTDLGLEAIAK-GCPNLKQLCLRRCC  403

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             ++DA L A A     L +L + +
Sbjct  404  YLSDAGLKAFAITARALENLHLEE  427


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/200 (27%), Positives = 92/200 (46%), Gaps = 8/200 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V++GCP+++ L +     +SD G+         +E L L +C  IS  G+  +       
Sbjct  203  VARGCPSLRVLSMWNVPFISDIGLSEIASGCPMLEKLDLCQCPLISDKGLIAV-ARKCPN  261

Query  185  LKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVL-SRLCPNLVHLN  358
            L +L  E+C  + +   G+ A+   C  L+S+ I +C   GD  +  L S     L  + 
Sbjct  262  LTSLMVESCLSIGN--EGLQAIGRCCPKLKSIVIKDCPRVGDQGVASLVSAASSFLARIR  319

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  +N ++D   L  +      +  + L+G  +V+++    +    G + LE + +N C 
Sbjct  320  LENVN-ISDVS-LAVIGHYGKAVADLALTGLQSVSERGFWVMGNAFGLQNLESIMINSCR  377

Query  536  CVTDASLAAIADYCSVLRDL  595
             VTD  L AIA  C  L+ L
Sbjct  378  GVTDLGLEAIAKGCPNLKQL  397



>ref|XP_006405190.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
 gb|ESQ46643.1| hypothetical protein EUTSA_v10000087mg [Eutrema salsugineum]
Length=633

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + K  LLSDNG+VSF KA+ S+ESLQ+EECHR++Q G FG L++   
Sbjct  360  SVGKGCPNMKKALVSKSPLLSDNGLVSFAKASLSLESLQIEECHRVTQFGFFGSLLNCGA  419

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +   C G++DL  G+PA   C++LRSLS+ NC GFGDA+L  L +LCP L  + L
Sbjct  420  KLKAFSLVKCLGIRDLTTGLPASTHCSALRSLSVRNCPGFGDANLAALGKLCPKLEDIEL  479

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  +Q+    LVKVN SGC N+TDK ISAI+  +G TLE+L ++GC  +
Sbjct  480  YGLKGITESGFLHLLQN---SLVKVNFSGCSNLTDKVISAISARNGWTLEVLTVDGCNKI  536

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL +IA+ C +L DLD+SK
Sbjct  537  TDASLVSIAENCQILSDLDLSK  558


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 83/165 (50%), Gaps = 7/165 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GCP +++L L +C  +++ G+V+  K   ++  L LE C RI   G+  +   S  K
Sbjct  203  IAQGCPQLEKLDLSRCNTITNKGLVAIAKCCPNLSELTLEACSRIGDEGLQAV-ARSCSK  261

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK+++ +NC  ++D            SL  L +       D SL V+     ++  L LS
Sbjct  262  LKSVSIKNCPLVRDQGIAALLSNTTYSLAKLKL-QMLNVTDVSLAVVGHYGLSITDLVLS  320

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            GL+ V++ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  321  GLSHVSEKGF--WVMGNGVGLQKLNSLTITACQGVTDTGLESVGK  363


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 100/252 (40%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL---VH  172
            A++K CPN+ +L L  C+ + D G+ +  ++   ++S+ ++ C  +   G+  +L    +
Sbjct  228  AIAKCCPNLSELTLEACSRIGDEGLQAVARSCSKLKSVSIKNCPLVRDQGIAALLSNTTY  287

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPCNS--------------LRSLSI  283
            S  KLK         +LA    +G+      +  L   +               L SL+I
Sbjct  288  SLAKLKLQMLNVTDVSLAVVGHYGLSITDLVLSGLSHVSEKGFWVMGNGVGLQKLNSLTI  347

Query  284  CNCTGFGDASLVVLSRLCPN--------------------------LVHLNLSGLNGVTD  385
              C G  D  L  + + CPN                          L  L +   + VT 
Sbjct  348  TACQGVTDTGLESVGKGCPNMKKALVSKSPLLSDNGLVSFAKASLSLESLQIEECHRVTQ  407

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G    + +C A L   +L  C+ + D T    A  H   L  L++  C    DA+LAA+
Sbjct  408  FGFFGSLLNCGAKLKAFSLVKCLGIRDLTTGLPASTHCSALRSLSVRNCPGFGDANLAAL  467

Query  566  ADYCSVLRDLDI  601
               C  L D+++
Sbjct  468  GKLCPKLEDIEL  479


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 92/205 (45%), Gaps = 6/205 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ + CP++K + L   + ++DNG+    +    +E L L  C+ I+  G+  I      
Sbjct  176  SIGRSCPSLKAVSLWNLSTITDNGLSEIAQGCPQLEKLDLSRCNTITNKGLVAI-AKCCP  234

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASL-VVLSRLCPNLVHLN  358
             L  L  E C  + D      A   C+ L+S+SI NC    D  +  +LS    +L  L 
Sbjct  235  NLSELTLEACSRIGDEGLQAVA-RSCSKLKSVSIKNCPLVRDQGIAALLSNTTYSLAKLK  293

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN VTD   L  V      +  + LSG  +V++K    +    G + L  L +  C 
Sbjct  294  LQMLN-VTDVS-LAVVGHYGLSITDLVLSGLSHVSEKGFWVMGNGVGLQKLNSLTITACQ  351

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             VTD  L ++   C  ++   +SKS
Sbjct  352  GVTDTGLESVGKGCPNMKKALVSKS  376


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 52/99 (53%), Gaps = 2/99 (2%)
 Frame = +2

Query  305  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI  484
            D  L  + R CP+L  ++L  L+ +TD GL    Q C   L K++LS C  +T+K + AI
Sbjct  171  DLGLRSIGRSCPSLKAVSLWNLSTITDNGLSEIAQGCPQ-LEKLDLSRCNTITNKGLVAI  229

Query  485  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            AK     L  L L  C  + D  L A+A  CS L+ + I
Sbjct  230  AKCC-PNLSELTLEACSRIGDEGLQAVARSCSKLKSVSI  267



>ref|XP_010048082.1| PREDICTED: EIN3-binding F-box protein 1-like [Eucalyptus grandis]
 gb|KCW80181.1| hypothetical protein EUGRSUZ_C01524 [Eucalyptus grandis]
Length=657

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLRKC  +SD G+++F  A  S+E LQ+EE  RIS  GV G++ +   
Sbjct  381  AIGKGCTNLKQMCLRKCLFVSDAGLIAFSGAVSSLEYLQVEELDRISLRGVIGVISNCEM  440

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+KDL  G   L  C SLRSLSI NC GFG ASL ++ +LCP+L H++L
Sbjct  441  KLKSLSIAKCMGIKDLLEGSLMLSSCASLRSLSIRNCPGFGSASLAMVGKLCPHLEHIDL  500

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
              L G+TD GL P +++ +AGLVKVNLS C+N+TD+ +S + +LHG TLELLNL+GC  V
Sbjct  501  ISLCGLTDAGLSPLLENSEAGLVKVNLSNCLNITDEAVSTLVRLHGGTLELLNLDGCRKV  560

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIAD C +L DLD+SK
Sbjct  561  SDASLVAIADNCLLLNDLDMSK  582


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 98/205 (48%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + + D+G+V   K    +E L L  C  +S  G+  I   +  
Sbjct  197  AIARGCPSLRALSLWNLSSIGDDGLVEIAKECRLLEKLDLSHCPFVSNKGLIAI-AENCR  255

Query  182  KLKALAFENCFGMKDLAFGVPALPPC-NSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+  C   L+S+SI +C   GD     ++S     L  +
Sbjct  256  DLISLNIESCPKIGN--EGLEAIGRCCPRLQSISIKDCPLVGDHGVASLVSSASSVLSKI  313

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L GLN +TD+ L   +      +  + L    N ++K    +    G + +  L +  C
Sbjct  314  KLQGLN-ITDFSL-AVIGHFGLAVTSLFLGSLRNASEKGFWVMGNAQGLKKVSSLTIASC  371

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              +TD SLAAI   C+ L+ + + K
Sbjct  372  HGITDLSLAAIGKGCTNLKQMCLRK  396



>gb|KFK32577.1| hypothetical protein AALP_AA6G261300 [Arabis alpina]
Length=630

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 145/202 (72%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K   + KC LLSDNG+VSF KA+ S+ESLQL ECHR++Q G FG L++   
Sbjct  357  SVGKGCPNMKMAVVSKCPLLSDNGLVSFAKASLSLESLQLVECHRVTQFGFFGSLLNCGT  416

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DL  G+PA   C +LRSLSI NC GFGDA+L  L +LCP L  + L
Sbjct  417  KLKAFSLVNCLGVRDLTTGLPASSHCIALRSLSIRNCPGFGDANLAALGKLCPLLEDVEL  476

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  +Q+    LVKVN SGC N+TD+ ISAI+  +G TLE+LN++GC  +
Sbjct  477  YGLKGITESGFLHLLQN---SLVKVNFSGCSNLTDRVISAISARNGWTLEVLNVDGCTQI  533

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIA  C +L DLDISK
Sbjct  534  SDASLVAIAANCQILSDLDISK  555


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 86/165 (52%), Gaps = 7/165 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC  +++L L +C++++D G+V+  K+  ++  L LE C +I   G+  +   S  K
Sbjct  200  IAEGCSQLEKLDLNRCSMITDKGLVAIAKSCPNLTELTLETCLKIGDEGLQAV-ARSCPK  258

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK+++ +NC  ++D           +SL  L +       D SL V+     ++  L LS
Sbjct  259  LKSVSIKNCPLVRDQGIAALLSNTTSSLGKLKL-QLLNVTDVSLAVVGHYGLSVTDLVLS  317

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            GL+ VT+ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  318  GLSHVTEKGF--WVMGNGVGLQKLNSLTITACQGVTDMGLESVGK  360


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 91/204 (45%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++++ CP+++ + L   + ++DNG+    +    +E L L  C  I+  G+  I   S  
Sbjct  173  SIARSCPSLRSVSLWNLSTITDNGLSEIAEGCSQLEKLDLNRCSMITDKGLVAI-AKSCP  231

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASL-VVLSRLCPNLVHLN  358
             L  L  E C  + D      A   C  L+S+SI NC    D  +  +LS    +L  L 
Sbjct  232  NLTELTLETCLKIGDEGLQAVA-RSCPKLKSVSIKNCPLVRDQGIAALLSNTTSSLGKLK  290

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN VTD   L  V      +  + LSG  +VT+K    +    G + L  L +  C 
Sbjct  291  LQLLN-VTDVS-LAVVGHYGLSVTDLVLSGLSHVTEKGFWVMGNGVGLQKLNSLTITACQ  348

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             VTD  L ++   C  ++   +SK
Sbjct  349  GVTDMGLESVGKGCPNMKMAVVSK  372


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/252 (24%), Positives = 98/252 (39%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL---VH  172
            A++K CPN+ +L L  C  + D G+ +  ++   ++S+ ++ C  +   G+  +L     
Sbjct  225  AIAKSCPNLTELTLETCLKIGDEGLQAVARSCPKLKSVSIKNCPLVRDQGIAALLSNTTS  284

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPC--------------NSLRSLSI  283
            S GKLK         +LA    +G+      +  L                   L SL+I
Sbjct  285  SLGKLKLQLLNVTDVSLAVVGHYGLSVTDLVLSGLSHVTEKGFWVMGNGVGLQKLNSLTI  344

Query  284  CNCTGFGDASLVVLSRLCPN--------------------------LVHLNLSGLNGVTD  385
              C G  D  L  + + CPN                          L  L L   + VT 
Sbjct  345  TACQGVTDMGLESVGKGCPNMKMAVVSKCPLLSDNGLVSFAKASLSLESLQLVECHRVTQ  404

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G    + +C   L   +L  C+ V D T    A  H   L  L++  C    DA+LAA+
Sbjct  405  FGFFGSLLNCGTKLKAFSLVNCLGVRDLTTGLPASSHCIALRSLSIRNCPGFGDANLAAL  464

Query  566  ADYCSVLRDLDI  601
               C +L D+++
Sbjct  465  GKLCPLLEDVEL  476



>ref|NP_001237471.1| grr1 protein [Glycine max]
 gb|AAB70660.1| grr1 [Glycine max]
Length=690

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 147/202 (73%), Gaps = 1/202 (0%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQL-EECHRISQAGVFGILVHSAG  181
            + +GCPNV+ L LRK   LSD G+VSF +AA S+ESLQL +  HRI+Q G+FG+  +   
Sbjct  404  IGRGCPNVQNLKLRKSAFLSDKGLVSFARAAPSVESLQLAKSAHRITQIGLFGVFFNCGA  463

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L   +C+G+KDL   +PA+ P  S+ SL+I +C GFG+A+L +L +LCP L H+ L
Sbjct  464  KLKVLTLISCYGIKDLNMDLPAISPSESIWSLTIHDCPGFGNANLALLGKLCPRLQHVEL  523

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD G LP ++S +AGLVKVNL+GC+N++D+ + ++   HG TLE+L+L+GC  V
Sbjct  524  SGLQGVTDAGFLPLLESSEAGLVKVNLNGCVNLSDRVVLSMVNSHGWTLEVLSLDGCKRV  583

Query  542  TDASLAAIADYCSVLRDLDISK  607
             DASL AIA  C +L DLD+S+
Sbjct  584  GDASLMAIAGSCPLLADLDVSR  605


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 87/204 (43%), Gaps = 33/204 (16%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GC  +++L L KC  +SD  +++  K   ++  L +E C  I   G+  I     GK
Sbjct  247  IASGCHQLEKLDLCKCPNISDKTLIAVAKNCPNLAELSIESCPNIGNEGLQAI-----GK  301

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLNL  361
                                    C +LRS+SI NC+G GD  +  +LS     L  + L
Sbjct  302  ------------------------CPNLRSISIKNCSGVGDQGVAGLLSSASFALTKVKL  337

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGC  538
              L  V+D   L  +      +  + L    NV++K    +   HG + L  + +N C  
Sbjct  338  ESLT-VSDLS-LAVIGHYGVAVTDLVLICLPNVSEKGFWVMGNAHGLQKLTSITINCCQG  395

Query  539  VTDASLAAIADYCSVLRDLDISKS  610
            VTD  L  I   C  +++L + KS
Sbjct  396  VTDVGLEPIGRGCPNVQNLKLRKS  419



>ref|XP_008337284.1| PREDICTED: EIN3-binding F-box protein 1-like [Malus domestica]
Length=647

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 152/202 (75%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC ++KQ+CLRKC  +SDNG+V+F KAA S+ESLQLEEC+R++Q+G+   L     
Sbjct  371  AIGKGCTSLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRVTQSGIIYALTXCGE  430

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL++L    C G+KD++  VP    C SLRSLS  NC GFG ASL ++ RLCP L +++L
Sbjct  431  KLRSLTLVKCMGIKDVSLAVPMTSSCRSLRSLSXRNCPGFGSASLAMVGRLCPQLHNIDL  490

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+L  ++S + GLVKVNL+GC+N+TDK + ++  LHGETLE+LNL+GC  +
Sbjct  491  SGLYGMTDAGILSLLESSEEGLVKVNLNGCLNLTDKXVVSLVSLHGETLEVLNLDGCRKI  550

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIA+ C  LR+LD+SK
Sbjct  551  TDASLVAIANNCLFLRELDVSK  572


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 99/205 (48%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP++K L L   + + D G++   K    +E L L  C  IS  G+  I   +  
Sbjct  187  AVAQGCPSLKSLSLWNISSVGDEGLIEIAKGCPLLEKLDLCGCPSISNKGLIAI-AENCP  245

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C+ L+S+SI +C   GD     +LS     L+ L
Sbjct  246  NLNSLNIESCSRIGN--EGLQAIGKSCSKLQSVSIRDCVLVGDHGVSSLLSSASSVLMKL  303

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+ L       +A +  + LSG  NV++K    +      + L  L +  C
Sbjct  304  KLQALN-ITDFSLAVIGHXGNA-VTNLVLSGLQNVSEKGFWVMGNAQALQNLVSLTITSC  361

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD SL AI   C+ L+ + + K
Sbjct  362  RGTTDVSLEAIGKGCTSLKQMCLRK  386


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 93/202 (46%), Gaps = 4/202 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++KGCP +++L L  C  +S+ G+++  +   ++ SL +E C RI   G+  I   S  K
Sbjct  214  IAKGCPLLEKLDLCGCPSISNKGLIAIAENCPNLNSLNIESCSRIGNEGLQAI-GKSCSK  272

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L++++  +C  + D           + L  L +       D SL V+      + +L LS
Sbjct  273  LQSVSIRDCVLVGDHGVSSLLSSASSVLMKLKL-QALNITDFSLAVIGHXGNAVTNLVLS  331

Query  365  GLNGVTDYGLLPFVQSCD-AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            GL  V++ G      +     LV + ++ C   TD ++ AI K    +L+ + L  C  V
Sbjct  332  GLQNVSEKGFWVMGNAQALQNLVSLTITSCRGTTDVSLEAIGK-GCTSLKQMCLRKCCFV  390

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +D  L A A     L  L + +
Sbjct  391  SDNGLVAFAKAAGSLESLQLEE  412



>ref|XP_010472548.1| PREDICTED: EIN3-binding F-box protein 1 [Camelina sativa]
Length=631

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 147/202 (73%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + +  LLSDNG+VSF KA+ S+ES+QLEECHR++Q G FG L++   
Sbjct  358  SVGKGCPNMKKAIISRSPLLSDNGLVSFAKASVSLESVQLEECHRVTQFGFFGSLLNCGE  417

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DL  G+PA P C++LRSLSI NC GFGDA+L  L +LC  L  ++L
Sbjct  418  KLKAFSLVNCLGIRDLTTGLPASPHCSALRSLSIRNCPGFGDANLAALGKLCLQLEEIDL  477

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  +Q+    LVK+N SGC ++TDK ISAI   +G TLE+LN++GC  +
Sbjct  478  CGLKGITESGFLHLIQN---SLVKMNFSGCSSLTDKVISAITARNGWTLEVLNIDGCSNI  534

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DAS+ +IA  C +L DLD+SK
Sbjct  535  SDASMVSIAANCQILSDLDLSK  556


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 89/169 (53%), Gaps = 15/169 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC  +++L L +C+ ++D G+V+  ++  ++  L LE C RI   G+  I   S  K
Sbjct  201  IAEGCTQLEKLDLNRCSTITDKGLVAIARSCPNLTELTLEACSRIGDEGLQAI-ARSCSK  259

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLR----SLSICNCTGFGDASLVVLSRLCPNLVH  352
            LK+++ +NC  ++D   G+ +L    +       L + N T   D SL V+     ++  
Sbjct  260  LKSVSIKNCPLVRDQ--GIASLLSNTTFSLAKLKLQMLNVT---DVSLAVVGHYGLSVTD  314

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            L LSGL+ V++ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  315  LVLSGLSHVSEKGF--WVMGNGVGLQKLNSLTITACQGVTDAGLESVGK  361


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 93/205 (45%), Gaps = 6/205 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ + CP++  L L   + ++DNG++   +    +E L L  C  I+  G+  I   S  
Sbjct  174  SIGRSCPSLGSLSLWNLSTVTDNGLLEIAEGCTQLEKLDLNRCSTITDKGLVAI-ARSCP  232

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLN  358
             L  L  E C  + D      A   C+ L+S+SI NC    D  +  +LS    +L  L 
Sbjct  233  NLTELTLEACSRIGDEGLQAIA-RSCSKLKSVSIKNCPLVRDQGIASLLSNTTFSLAKLK  291

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN VTD   L  V      +  + LSG  +V++K    +    G + L  L +  C 
Sbjct  292  LQMLN-VTDVS-LAVVGHYGLSVTDLVLSGLSHVSEKGFWVMGNGVGLQKLNSLTITACQ  349

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             VTDA L ++   C  ++   IS+S
Sbjct  350  GVTDAGLESVGKGCPNMKKAIISRS  374


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/252 (23%), Positives = 101/252 (40%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL---VH  172
            A+++ CPN+ +L L  C+ + D G+ +  ++   ++S+ ++ C  +   G+  +L     
Sbjct  226  AIARSCPNLTELTLEACSRIGDEGLQAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTF  285

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPCNS--------------LRSLSI  283
            S  KLK         +LA    +G+      +  L   +               L SL+I
Sbjct  286  SLAKLKLQMLNVTDVSLAVVGHYGLSVTDLVLSGLSHVSEKGFWVMGNGVGLQKLNSLTI  345

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
              C G  DA L  + + CPN+    +S    ++D GL+ F ++                 
Sbjct  346  TACQGVTDAGLESVGKGCPNMKKAIISRSPLLSDNGLVSFAKASVSLESVQLEECHRVTQ  405

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
                     C   L   +L  C+ + D T    A  H   L  L++  C    DA+LAA+
Sbjct  406  FGFFGSLLNCGEKLKAFSLVNCLGIRDLTTGLPASPHCSALRSLSIRNCPGFGDANLAAL  465

Query  566  ADYCSVLRDLDI  601
               C  L ++D+
Sbjct  466  GKLCLQLEEIDL  477


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 88/183 (48%), Gaps = 5/183 (3%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            S  C  ++ L +R C    D  + +  K    +E + L     I+++G   ++ +S  K+
Sbjct  440  SPHCSALRSLSIRNCPGFGDANLAALGKLCLQLEEIDLCGLKGITESGFLHLIQNSLVKM  499

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
                F  C  + D            +L  L+I  C+   DAS+V ++  C  L  L+LS 
Sbjct  500  N---FSGCSSLTDKVISAITARNGWTLEVLNIDGCSNISDASMVSIAANCQILSDLDLSK  556

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTD  547
             + ++D G+     S    L  ++++GC  VTDK++ AI +L G TL  LNL  C  +++
Sbjct  557  CS-ISDSGIQALASSEKLKLQILSMAGCSMVTDKSLPAIVRL-GSTLLGLNLQQCRSISN  614

Query  548  ASL  556
            +++
Sbjct  615  STV  617


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +2

Query  305  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI  484
            D  L  + R CP+L  L+L  L+ VTD GLL   + C   L K++L+ C  +TDK + AI
Sbjct  169  DIGLRSIGRSCPSLGSLSLWNLSTVTDNGLLEIAEGCTQ-LEKLDLNRCSTITDKGLVAI  227

Query  485  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            A+     L  L L  C  + D  L AIA  CS L+ + I
Sbjct  228  AR-SCPNLTELTLEACSRIGDEGLQAIARSCSKLKSVSI  265



>ref|XP_009368857.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 153/202 (76%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC ++KQ+CLRKC  +SDNG+V+F KAA S+ESLQLEEC+R++Q+G+   L +   
Sbjct  371  AIGKGCTSLKQMCLRKCCFVSDNGLVAFAKAAGSLESLQLEECNRVTQSGIIYALTNCGE  430

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL++L    C G+KD++  VP    C SLRSLSI NC GFG ASL ++ RLCP L +++L
Sbjct  431  KLRSLTLVKCMGIKDVSLAVPMTSSCRSLRSLSIRNCPGFGSASLAMVGRLCPQLHNIDL  490

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+L  ++S + GLVKVNL+GC+N+TDK + ++  LHG+TLE+LNL+GC  +
Sbjct  491  SGLYGMTDAGILSLLESLEEGLVKVNLNGCLNLTDKVVVSLVSLHGDTLEVLNLDGCRKI  550

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL  IA+ C  LR+LD+SK
Sbjct  551  TDASLVTIANNCLFLRELDVSK  572


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/205 (30%), Positives = 98/205 (48%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP +K L L   + + D G++   K    +E L L +C  IS  G+  I      
Sbjct  187  AVAQGCPFLKSLSLWNISSVGDEGLIEIAKGCPLLEKLDLCQCPSISNKGLIAI-AEKCP  245

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C+ L+S+S+ +C   GD     +LS     L+ L
Sbjct  246  NLNSLNIESCSRIGN--EGLQAIGKSCSKLQSVSVRDCVLVGDHGVSSLLSSASSVLMKL  303

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+ L       +A +  + LSG  NV++K    +      + L  L +  C
Sbjct  304  KLQALN-ITDFSLAVIGHYGNA-VTNLVLSGLQNVSEKGFWVMGNAQALQNLVSLTITSC  361

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD SL AI   C+ L+ + + K
Sbjct  362  RGTTDVSLEAIGKGCTSLKQMCLRK  386


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 94/202 (47%), Gaps = 4/202 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++KGCP +++L L +C  +S+ G+++  +   ++ SL +E C RI   G+  I   S  K
Sbjct  214  IAKGCPLLEKLDLCQCPSISNKGLIAIAEKCPNLNSLNIESCSRIGNEGLQAI-GKSCSK  272

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L++++  +C  + D           + L  L +       D SL V+      + +L LS
Sbjct  273  LQSVSVRDCVLVGDHGVSSLLSSASSVLMKLKL-QALNITDFSLAVIGHYGNAVTNLVLS  331

Query  365  GLNGVTDYGLLPFVQSCD-AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            GL  V++ G      +     LV + ++ C   TD ++ AI K    +L+ + L  C  V
Sbjct  332  GLQNVSEKGFWVMGNAQALQNLVSLTITSCRGTTDVSLEAIGK-GCTSLKQMCLRKCCFV  390

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +D  L A A     L  L + +
Sbjct  391  SDNGLVAFAKAAGSLESLQLEE  412



>gb|AES91540.2| EIN3-binding F-box-like protein [Medicago truncatula]
Length=633

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KG P++KQ+CLR+C+ +SD G+  F K   S++SLQLEEC+R +Q G+F  L +   
Sbjct  357  AMGKGFPHLKQMCLRRCSFVSDFGLAEFAKCTRSLQSLQLEECNRFTQCGIFYALSNIKT  416

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+     C G+KD+   V  L PC SLRSL+I NC GFG AS+ V+ +LCP L H++L
Sbjct  417  KLKSFTLVKCMGIKDIDVEVSMLSPCKSLRSLTIQNCPGFGSASMAVVGKLCPQLQHVDL  476

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD GLLP +++C+AGLV+VNL+GC N+TD  +S +A+LHG TLE+LNL+GC  +
Sbjct  477  TGLCGITDAGLLPLLENCEAGLVEVNLTGCWNLTDYIVSKVARLHGGTLEILNLDGCQNI  536

Query  542  TDASLAAIA  568
            TDASL A+A
Sbjct  537  TDASLVAVA  545


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 84/190 (44%), Gaps = 5/190 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCP+++ L L   + + D G+    K    +E+L L     I+  G+  I      
Sbjct  174  AVACGCPSLRSLSLWNVSSIGDKGLCEIAKGCHMLETLDLSHSSSITNKGLIAI-AEGCP  232

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L  L  E+C  + +      A   C  L S+ I +C   GD  +  L  L  NL  + L
Sbjct  233  NLTTLNIESCSMIGNEGLQTVA-KLCPKLHSICIKDCPLVGDHGVSSLLSLASNLSKVKL  291

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGC  538
              LN +TD+  L  +      +  + LSG  NV+++    +    G + L  L +  C  
Sbjct  292  QILN-ITDFS-LAVIGHYGKAVTNLVLSGLQNVSERGFCVMGVAQGLQKLMSLTITSCQG  349

Query  539  VTDASLAAIA  568
            VTDAS+ A+ 
Sbjct  350  VTDASIEAMG  359



>ref|XP_008457494.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=657

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 147/202 (73%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KG  N+KQ+C++KC  +SDNG+++F KAA S+E LQLEEC+RI+  G+ G L +   
Sbjct  382  AMGKGIANLKQMCIQKCCFVSDNGLIAFAKAAGSLEMLQLEECNRITLLGIGGALSNHIR  441

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G+KD+A  V     C SLRSLS+ NC GFG ASL ++ +LCP L H+ L
Sbjct  442  NLKSLTVVKCLGIKDIAQEVTLPSLCTSLRSLSVQNCPGFGSASLSMVGKLCPQLQHVEL  501

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+TD  + P +++C+ GLVKVNLSGCIN+TD+T+S + +LHG T+E+LNL+GC  +
Sbjct  502  IGLYGITDASMFPLLETCE-GLVKVNLSGCINLTDETVSTLVRLHGGTIEVLNLDGCRKI  560

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AIAD C +L +LD SK
Sbjct  561  TDASLVAIADACLLLNELDASK  582


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 98/206 (48%), Gaps = 10/206 (5%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G+    +    +E L L  C  IS  G+  I      
Sbjct  198  AIAHGCPSLRMLSLWNVPSVGDEGLFEIARECHLLEKLDLCHCPSISDKGLIAI-AEQCT  256

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVL--SRLCPNLVH  352
             L +L+ E+C  + +   G+ A+   C+ L+++SI +C   GD  +  L  S  C  ++ 
Sbjct  257  NLTSLSIESCPKIGN--EGLQAIGKLCSKLQTISIRDCPRVGDQGVSSLFASSSCA-IMK  313

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNG  529
            + +  LN +TD+  L  +      +  + LSG  NV++K    +    G + L ++ +  
Sbjct  314  VKIQALN-ITDFS-LAVIGHYGQAITHLTLSGLQNVSEKGFWVMGSAQGLKKLTMMTIAS  371

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            C  +TD SL A+    + L+ + I K
Sbjct  372  CRGMTDVSLEAMGKGIANLKQMCIQK  397



>emb|CDY35358.1| BnaA04g14890D [Brassica napus]
Length=623

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 145/202 (72%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + K  LLSDNG+VSF K + S+ES+QLEECHR++Q G FG L++   
Sbjct  350  SVGKGCPNMKKALISKSPLLSDNGLVSFAKGSLSLESIQLEECHRVTQFGFFGSLLNCGA  409

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DLA G+PA   C+ LRSLS+ NC GFGDA+L  L +LCP L  + L
Sbjct  410  KLKAFSMVNCLGIRDLATGLPASSHCSGLRSLSVRNCPGFGDANLAALGKLCPQLEDIEL  469

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  +Q+    LVKVN SGC  +TD+ +SAI+  +G TLE+LN++GC  +
Sbjct  470  CGLKGITESGFLHLLQN---SLVKVNFSGCSGLTDRVVSAISARNGLTLEVLNMDGCSKI  526

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL +IA  C +L DLD+SK
Sbjct  527  SDASLVSIAANCQILSDLDLSK  548


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 90/169 (53%), Gaps = 15/169 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GCP +++L L +C  ++D G+V+  K+  ++  L LE C RI   G+  +   S  K
Sbjct  193  IAEGCPQLEKLDLSRCPAITDKGLVAIAKSCPNLSELTLEACLRIGDEGLQAV-ARSCSK  251

Query  185  LKALAFENCFGMKDLAFGVPAL---PPCNSLR-SLSICNCTGFGDASLVVLSRLCPNLVH  352
            LK+++ +NC  ++D   GV AL     C+  +  L + N T   D SL V+     ++  
Sbjct  252  LKSVSIKNCPLVRDQ--GVAALLSNTTCSLTKLKLQMLNVT---DVSLAVVGHYGLSITE  306

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            L L+GL+ VT+ G   +V     GL K+N   +  C  VTD  + ++ K
Sbjct  307  LVLAGLSHVTEKGF--WVMGNGIGLQKLNSLTIIACQGVTDAGLESVGK  353


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 98/252 (39%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH---  172
            A++K CPN+ +L L  C  + D G+ +  ++   ++S+ ++ C  +   GV  +L +   
Sbjct  218  AIAKSCPNLSELTLEACLRIGDEGLQAVARSCSKLKSVSIKNCPLVRDQGVAALLSNTTC  277

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPC--------------NSLRSLSI  283
            S  KLK         +LA    +G+      +  L                   L SL+I
Sbjct  278  SLTKLKLQMLNVTDVSLAVVGHYGLSITELVLAGLSHVTEKGFWVMGNGIGLQKLNSLTI  337

Query  284  CNCTGFGDASLVVLSRLCPN--------------------------LVHLNLSGLNGVTD  385
              C G  DA L  + + CPN                          L  + L   + VT 
Sbjct  338  IACQGVTDAGLESVGKGCPNMKKALISKSPLLSDNGLVSFAKGSLSLESIQLEECHRVTQ  397

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G    + +C A L   ++  C+ + D      A  H   L  L++  C    DA+LAA+
Sbjct  398  FGFFGSLLNCGAKLKAFSMVNCLGIRDLATGLPASSHCSGLRSLSVRNCPGFGDANLAAL  457

Query  566  ADYCSVLRDLDI  601
               C  L D+++
Sbjct  458  GKLCPQLEDIEL  469


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = +2

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
            L  LS+       D  L  + R CP+L  L+L  L+ VTD GLL   + C   L K++LS
Sbjct  148  LGKLSVRGSDKVSDLGLRSIGRSCPSLGSLSLCNLSAVTDVGLLEIAEGCPQ-LEKLDLS  206

Query  446  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
             C  +TDK + AIAK     L  L L  C  + D  L A+A  CS L+ + I
Sbjct  207  RCPAITDKGLVAIAK-SCPNLSELTLEACLRIGDEGLQAVARSCSKLKSVSI  257


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = +2

Query  257  CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV  436
            C SL SLS+CN +   D  L+ ++  CP L  L+LS    +TD GL+   +SC   L ++
Sbjct  171  CPSLGSLSLCNLSAVTDVGLLEIAEGCPQLEKLDLSRCPAITDKGLVAIAKSC-PNLSEL  229

Query  437  NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
             L  C+ + D+ + A+A+     L+ +++  C  V D  +AA+
Sbjct  230  TLEACLRIGDEGLQAVAR-SCSKLKSVSIKNCPLVRDQGVAAL  271



>ref|XP_009140675.1| PREDICTED: EIN3-binding F-box protein 1 [Brassica rapa]
Length=622

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 145/202 (72%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + K  LLSDNG+VSF K + S+ES+QLEECHR++Q G FG L++   
Sbjct  349  SVGKGCPNMKKALISKSPLLSDNGLVSFAKGSLSLESIQLEECHRVTQFGFFGSLLNCGA  408

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DLA G+PA   C+ LRSLS+ NC GFGDA+L  L +LCP L  + L
Sbjct  409  KLKAFSMVNCLGIRDLATGLPASSHCSGLRSLSVRNCPGFGDANLAALGKLCPQLEDIEL  468

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+T+ G L  +Q+    LVKVN SGC  +TD+ +SAI+  +G TLE+LN++GC  +
Sbjct  469  CGLKGITESGFLHLLQN---SLVKVNFSGCSGLTDRVVSAISARNGLTLEVLNMDGCSKI  525

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL +IA  C +L DLD+SK
Sbjct  526  SDASLVSIAANCQILSDLDLSK  547


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 91/169 (54%), Gaps = 15/169 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GCP +++L L +C  ++D G+V+  K+  ++  L LE C RI   G+  +   S  K
Sbjct  192  IAEGCPQLEKLDLSRCPAITDKGLVAIAKSCPNLSELSLEACLRIGDEGLQAV-ARSCSK  250

Query  185  LKALAFENCFGMKDLAFGVPAL---PPCNSLR-SLSICNCTGFGDASLVVLSRLCPNLVH  352
            L++++ +NC  ++D   GV AL     C+  +  L + N T   D SL V+     ++  
Sbjct  251  LRSVSIKNCPLVRDQ--GVAALLSNTTCSLTKLKLQMLNVT---DVSLAVVGHYGLSVTE  305

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            L L+GL+ VT+ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  306  LVLAGLSHVTEKGF--WVMGNGIGLQKLNSLTITACQGVTDTGLESVGK  352


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 58/112 (52%), Gaps = 2/112 (2%)
 Frame = +2

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
            L  LS+       D  L  + R CP+L  L+L  L+ VTD GLL   + C   L K++LS
Sbjct  147  LGKLSVRGSDKVSDLGLRSIGRSCPSLGSLSLCNLSAVTDIGLLEIAEGCPQ-LEKLDLS  205

Query  446  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
             C  +TDK + AIAK     L  L+L  C  + D  L A+A  CS LR + I
Sbjct  206  RCPAITDKGLVAIAK-SCPNLSELSLEACLRIGDEGLQAVARSCSKLRSVSI  256


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/252 (23%), Positives = 96/252 (38%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH---  172
            A++K CPN+ +L L  C  + D G+ +  ++   + S+ ++ C  +   GV  +L +   
Sbjct  217  AIAKSCPNLSELSLEACLRIGDEGLQAVARSCSKLRSVSIKNCPLVRDQGVAALLSNTTC  276

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPC--------------NSLRSLSI  283
            S  KLK         +LA    +G+      +  L                   L SL+I
Sbjct  277  SLTKLKLQMLNVTDVSLAVVGHYGLSVTELVLAGLSHVTEKGFWVMGNGIGLQKLNSLTI  336

Query  284  CNCTGFGDASLVVLSRLCPN--------------------------LVHLNLSGLNGVTD  385
              C G  D  L  + + CPN                          L  + L   + VT 
Sbjct  337  TACQGVTDTGLESVGKGCPNMKKALISKSPLLSDNGLVSFAKGSLSLESIQLEECHRVTQ  396

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G    + +C A L   ++  C+ + D      A  H   L  L++  C    DA+LAA+
Sbjct  397  FGFFGSLLNCGAKLKAFSMVNCLGIRDLATGLPASSHCSGLRSLSVRNCPGFGDANLAAL  456

Query  566  ADYCSVLRDLDI  601
               C  L D+++
Sbjct  457  GKLCPQLEDIEL  468


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = +2

Query  257  CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKV  436
            C SL SLS+CN +   D  L+ ++  CP L  L+LS    +TD GL+   +SC   L ++
Sbjct  170  CPSLGSLSLCNLSAVTDIGLLEIAEGCPQLEKLDLSRCPAITDKGLVAIAKSC-PNLSEL  228

Query  437  NLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +L  C+ + D+ + A+A+     L  +++  C  V D  +AA+
Sbjct  229  SLEACLRIGDEGLQAVAR-SCSKLRSVSIKNCPLVRDQGVAAL  270



>ref|XP_004139306.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 ref|XP_004169733.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
 gb|KGN60684.1| Grr1 [Cucumis sativus]
Length=661

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 147/202 (73%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KG  N+KQ+C++KC  +SDNG+++F KAA S+E LQLEEC+RI+  G+ G L +   
Sbjct  386  AMGKGIANLKQMCIQKCCFVSDNGLIAFAKAAGSLEMLQLEECNRITLLGIGGALSNHIR  445

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G+KD+A  V     C SLRSLSI NC GFG ASL ++ +LCP L H+ L
Sbjct  446  NLKSLTVVKCLGIKDIAQEVTLPSLCTSLRSLSIQNCPGFGSASLSMVGKLCPQLQHVEL  505

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+TD  + P +++C+ GLVKVNLSGCIN+TD+T+S + +LHG T+E+LNL+GC  +
Sbjct  506  IGLYGITDASMFPLLETCE-GLVKVNLSGCINLTDETVSTLVRLHGGTIEVLNLDGCRKI  564

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +DASL AIAD C +L +LD SK
Sbjct  565  SDASLVAIADACLLLNELDASK  586


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 97/206 (47%), Gaps = 10/206 (5%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D G+    +    +E L L  C  IS  G+  I      
Sbjct  202  AIAHGCPSLRILSLWNVPSVGDEGLFEIARECHLLEKLDLCHCPSISDKGLIAI-AEQCT  260

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVL--SRLCPNLVH  352
             L +L+ E+C  + +   G+ A+   C+ L+++SI +C   GD  +  L  S  C  ++ 
Sbjct  261  NLTSLSIESCPKIGN--EGLQAIGKLCSKLQTISIRDCPRVGDQGVSSLFASSSCA-IMK  317

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNG  529
            + +  LN +TD+  L  +      +  + L G  NV++K    +    G + L LL +  
Sbjct  318  VKIQALN-ITDFS-LAVIGHYGQAITHLTLGGLQNVSEKGFWVMGSAQGLKKLTLLMIAS  375

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            C  +TD SL A+    + L+ + I K
Sbjct  376  CRGMTDVSLEAMGKGIANLKQMCIQK  401



>ref|XP_003609343.1| Ein3-binding f-box protein [Medicago truncatula]
Length=1052

 Score =   215 bits (547),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 140/189 (74%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KG P++KQ+CLR+C+ +SD G+  F K   S++SLQLEEC+R +Q G+F  L +   
Sbjct  357  AMGKGFPHLKQMCLRRCSFVSDFGLAEFAKCTRSLQSLQLEECNRFTQCGIFYALSNIKT  416

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+     C G+KD+   V  L PC SLRSL+I NC GFG AS+ V+ +LCP L H++L
Sbjct  417  KLKSFTLVKCMGIKDIDVEVSMLSPCKSLRSLTIQNCPGFGSASMAVVGKLCPQLQHVDL  476

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL G+TD GLLP +++C+AGLV+VNL+GC N+TD  +S +A+LHG TLE+LNL+GC  +
Sbjct  477  TGLCGITDAGLLPLLENCEAGLVEVNLTGCWNLTDYIVSKVARLHGGTLEILNLDGCQNI  536

Query  542  TDASLAAIA  568
            TDASL A+A
Sbjct  537  TDASLVAVA  545



>dbj|BAJ34438.1| unnamed protein product [Thellungiella halophila]
Length=430

 Score =   207 bits (526),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+V+  K+A S+ESL+LEECHRI+Q G  G L +   
Sbjct  152  AVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGFLGFLTNCGS  211

Query  182  KLKALAFENCFGMKDLAFGVP-ALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            KLKA +  NC G++DL    P  L  C+S+RSLSI  C GFGDASL  L + C  L  + 
Sbjct  212  KLKAFSLANCMGIQDLNPESPLQLTGCSSIRSLSIRCCPGFGDASLAFLGKFCHQLQDVE  271

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            LSGLNGVTD G+L  +QS + GLVKVNLSGCINV+D T+SAI+  HG  +E LNL+GC  
Sbjct  272  LSGLNGVTDAGVLELLQSNNVGLVKVNLSGCINVSDNTVSAISMCHGRFMESLNLDGCKN  331

Query  539  VTDASLAAIADYCSVLRDLDISKS  610
            +TDASL A+A  C  + DLDIS +
Sbjct  332  ITDASLVAVAKNCYSVSDLDISNT  355


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/232 (25%), Positives = 103/232 (44%), Gaps = 35/232 (15%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES---LQLEECHRISQAGVFGILVH  172
            A+++ C N++ + +R C  + D GV   +  A S  +   LQ+     +S A    +L H
Sbjct  46   AIARRCTNLRSISIRSCPRIGDQGVAFLLAQAGSYLTKVKLQMLNITGLSLA----VLGH  101

Query  173  SAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLV  349
                +  L      G+ +  F V A       L+SLS+ +C G  D  L  +   CP+L 
Sbjct  102  YGAAVTDLVLHGLQGVNEKGFWVMANAKGMKKLKSLSVMSCRGMTDVGLEAVGNGCPDLK  161

Query  350  HLNLS--------GL------------------NGVTDYGLLPFVQSCDAGLVKVNLSGC  451
            H++L+        GL                  + +  +G L F+ +C + L   +L+ C
Sbjct  162  HVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGFLGFLTNCGSKLKAFSLANC  221

Query  452  INVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + + D    +  +L G  ++  L++  C    DASLA +  +C  L+D+++S
Sbjct  222  MGIQDLNPESPLQLTGCSSIRSLSIRCCPGFGDASLAFLGKFCHQLQDVELS  273


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 93/188 (49%), Gaps = 3/188 (2%)
 Frame = +2

Query  14   GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKA  193
            GC +++ L +R C    D  +    K    ++ ++L   + ++ AGV  +L  +   L  
Sbjct  237  GCSSIRSLSIRCCPGFGDASLAFLGKFCHQLQDVELSGLNGVTDAGVLELLQSNNVGLVK  296

Query  194  LAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN  373
            +    C  + D      ++     + SL++  C    DASLV +++ C ++  L++S   
Sbjct  297  VNLSGCINVSDNTVSAISMCHGRFMESLNLDGCKNITDASLVAVAKNCYSVSDLDISN-T  355

Query  374  GVTDYGLLPFVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA  550
             V+D+G+     S +   L  +++ GC  +TDK+ + I KL G TL  LN+  CG ++ +
Sbjct  356  LVSDHGIKALASSPNHLNLQVLSVGGCSAITDKSKACIQKL-GRTLLGLNIQRCGRISSS  414

Query  551  SLAAIADY  574
            ++  + ++
Sbjct  415  TVDNLLEH  422



>ref|XP_006842065.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
 gb|ERN03740.1| hypothetical protein AMTR_s00078p00046140 [Amborella trichopoda]
Length=649

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 150/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +GCPN+KQLCLR+C+ LSD G+ +F ++A  ++SLQLEEC++I+Q G+   L +  G
Sbjct  373  AIGRGCPNLKQLCLRRCSSLSDKGLEAFTQSAVLLKSLQLEECNKITQMGLLASLFNCRG  432

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L +L+   C G++D   G+  L  CNSL+SLS+ +C+GFG+  L +L + CP L +L+L
Sbjct  433  NLNSLSLVKCMGIRDSLVGLAPLSTCNSLKSLSVRHCSGFGNGCLDILGKACPQLQNLDL  492

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL GVTD G +  ++S +A L+K NLSGCIN+TD+++ A+AKLHGE+LELL+  GCG V
Sbjct  493  SGLCGVTDDGFVALLESREALLLKANLSGCINLTDRSVMALAKLHGESLELLSFEGCGKV  552

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD+ L A++ +C  L+DLDIS+
Sbjct  553  TDSGLMAVSSFCVCLKDLDISR  574


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 90/199 (45%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP +K L L     +SD G+         +E L L +C RI+  G+  +      
Sbjct  190  AIAHGCPALKALSLWNTPFVSDEGLSEIADGCPQLEKLDLCQCPRITDKGLIAV-AKKCP  248

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L  +  E+C  + + A    A   C +LRS+SI  C   GD  +  L  L  ++  + L
Sbjct  249  SLTTMNLESCEKIGNGALKAIA-QSCPNLRSVSIHGCPLIGDQGVASLVSLATHVSKIKL  307

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGC  538
              LN +TD   L  +      +  + L G  NV+++   A+    G + L+L ++  C  
Sbjct  308  QSLN-ITDVS-LALIGHYGKEIEDLGLVGLHNVSERGFWALGNALGLQKLKLCSIALCMG  365

Query  539  VTDASLAAIADYCSVLRDL  595
            +TD  L AI   C  L+ L
Sbjct  366  ITDLGLEAIGRGCPNLKQL  384



>ref|XP_009364023.1| PREDICTED: EIN3-binding F-box protein 1-like [Pyrus x bretschneideri]
Length=647

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 150/202 (74%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC N+KQ+CLRKC  +SDNG+ +F KAA S+ES+QLEEC+R++Q+G+   L +   
Sbjct  371  AIGKGCTNLKQMCLRKCCFVSDNGLAAFAKAAGSLESVQLEECNRVTQSGIISALSNCGE  430

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL++L    C G+KD    VP    C SLRSLSI NC GFG ASL ++ RLCP L ++++
Sbjct  431  KLRSLTLVKCMGIKDADAAVPIPSSCRSLRSLSIRNCPGFGSASLAMVGRLCPQLHNVDM  490

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+L  + S + GLVKVNL+GC+N+TD+ + A+ +LHGETLE+LNL+GC  +
Sbjct  491  SGLYGMTDAGVLSLLGSLEEGLVKVNLNGCLNLTDEVVMALVRLHGETLEVLNLDGCRKI  550

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASLA IA  C  LR+LD+SK
Sbjct  551  TDASLATIASNCLFLRELDVSK  572


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 98/205 (48%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP++K L L   + + D G++   K    +  L L +C  IS  G+  I   +  
Sbjct  187  AVAQGCPSLKSLALWDISSVGDEGLIEIAKGCPLLAKLDLFQCPSISNKGLIAI-AENCP  245

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHL  355
             L +L  E+C  + +   G+ A+   C+ L+S+SI +C   GD     +LS     L+ +
Sbjct  246  NLTSLNIESCSRIGN--EGLQAIGRSCSKLQSISIRDCVLVGDHGVSSLLSSGSSVLMKV  303

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN +TD+  L  +      +  + LSG  NV++K    +      + L  L +  C
Sbjct  304  RLQALN-ITDFS-LAVIGHYGKAVTNLFLSGLQNVSEKGFWVMGNAQALQDLASLTITSC  361

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
               TD SL AI   C+ L+ + + K
Sbjct  362  RGTTDVSLEAIGKGCTNLKQMCLRK  386


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 92/202 (46%), Gaps = 4/202 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++KGCP + +L L +C  +S+ G+++  +   ++ SL +E C RI   G+  I   S  K
Sbjct  214  IAKGCPLLAKLDLFQCPSISNKGLIAIAENCPNLTSLNIESCSRIGNEGLQAI-GRSCSK  272

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L++++  +C  + D           + L  + +       D SL V+      + +L LS
Sbjct  273  LQSISIRDCVLVGDHGVSSLLSSGSSVLMKVRL-QALNITDFSLAVIGHYGKAVTNLFLS  331

Query  365  GLNGVTDYGLLPFVQSCD-AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            GL  V++ G      +     L  + ++ C   TD ++ AI K     L+ + L  C  V
Sbjct  332  GLQNVSEKGFWVMGNAQALQDLASLTITSCRGTTDVSLEAIGK-GCTNLKQMCLRKCCFV  390

Query  542  TDASLAAIADYCSVLRDLDISK  607
            +D  LAA A     L  + + +
Sbjct  391  SDNGLAAFAKAAGSLESVQLEE  412



>ref|XP_008805624.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KGCP++KQL LR+C  LSD G+  F + A ++E+L LEEC+RIS  GV G L+    
Sbjct  385  AIAKGCPSLKQLFLRRCCYLSDAGLKIFAQTARALENLHLEECNRISLIGVLGCLLSCNA  444

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   CFG+ D +F    LP C SLRSL+I +C GF   SL V+ ++CP L H++L
Sbjct  445  KFRALSLVKCFGINDTSFCPSPLPSCMSLRSLTIRDCPGFTSTSLAVVGKICPQLQHVDL  504

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G TD GLLP ++S   GLV VNLSGC+++TD  I+A+AK HG TL++LNL  C  V
Sbjct  505  SGLVGATDAGLLPLIES-SVGLVTVNLSGCVDLTDAAITALAKAHGTTLQMLNLESCKNV  563

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD SL AIAD CS+L DLD+S+
Sbjct  564  TDKSLLAIADCCSLLDDLDMSR  585


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 102/211 (48%), Gaps = 22/211 (10%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L L +C L+SD G+++  +    + SL +E C  I   G+  I      K
Sbjct  228  IANGCPMLEKLDLCRCPLISDKGLIAVARKCPKLTSLTIESCSSIGNEGLHAI-GRCCPK  286

Query  185  LKALAFENCFGMKDLAFGVPALPPCNS-------LRSLSICNCTGFGDASLVVLSRLCPN  343
            LK++  ++C G+ D   GV +L    S       L+S+SI       DASL V+      
Sbjct  287  LKSIIIKDCPGVGD--RGVASLVSAASCSLARIDLQSISI------SDASLAVIGHYGKA  338

Query  344  LVHLNLSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLEL  514
            +  L L+GL  V++ G   +V     GL K   + +  C  VT+  + AIAK    +L+ 
Sbjct  339  VADLMLTGLQYVSERGF--WVMGNTLGLQKLKSITIDSCHGVTNLGLEAIAK-GCPSLKQ  395

Query  515  LNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            L L  C  ++DA L   A     L +L + +
Sbjct  396  LFLRRCCYLSDAGLKIFAQTARALENLHLEE  426


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 100/229 (44%), Gaps = 30/229 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAA--------------------------ES  103
            A+ + CP +K + ++ C  + D GV S V AA                          ++
Sbjct  279  AIGRCCPKLKSIIIKDCPGVGDRGVASLVSAASCSLARIDLQSISISDASLAVIGHYGKA  338

Query  104  IESLQLEECHRISQAGVFGILVHSAG--KLKALAFENCFGMKDLAFGVPALPPCNSLRSL  277
            +  L L     +S+ G F ++ ++ G  KLK++  ++C G+ +L     A   C SL+ L
Sbjct  339  VADLMLTGLQYVSERG-FWVMGNTLGLQKLKSITIDSCHGVTNLGLEAIA-KGCPSLKQL  396

Query  278  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
             +  C    DA L + ++    L +L+L   N ++  G+L  + SC+A    ++L  C  
Sbjct  397  FLRRCCYLSDAGLKIFAQTARALENLHLEECNRISLIGVLGCLLSCNAKFRALSLVKCFG  456

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + D +          +L  L +  C   T  SLA +   C  L+ +D+S
Sbjct  457  INDTSFCPSPLPSCMSLRSLTIRDCPGFTSTSLAVVGKICPQLQHVDLS  505



>ref|XP_008805623.1| PREDICTED: EIN3-binding F-box protein 1-like [Phoenix dactylifera]
Length=660

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KGCP++KQL L +C  LSD+G+  F + A ++E+L LEEC+RIS  GV G L+    
Sbjct  385  AIAKGCPSLKQLFLSRCCYLSDSGLKLFAQTARALENLHLEECNRISLIGVLGFLLSCNA  444

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   CFG+ D +F    LP C SLRSL+I +C GF   SL V+ ++CP L H++L
Sbjct  445  KFRALSLVKCFGINDTSFCPSPLPSCMSLRSLTIRDCPGFTGTSLAVVGKICPQLQHVDL  504

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G TD GLLP ++S   GLV VNLSGC+++TD  I+A+AK HG TL++LNL  C  V
Sbjct  505  SGLVGATDAGLLPLIES-SVGLVTVNLSGCVDLTDAAITALAKAHGTTLQMLNLESCKNV  563

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD SL AIAD CS+L DLD+S+
Sbjct  564  TDKSLLAIADCCSLLDDLDMSR  585


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 97/204 (48%), Gaps = 8/204 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L L +C  +SD G+++  +    + SL +E C  I   G+  I      K
Sbjct  228  IANGCPMLEKLDLCRCPSISDKGLIAVARKCPKLTSLTIESCSSIGNEGLHAI-GRCCPK  286

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK++  ++C G+ D           +SL  + +       DASL V+      +  L L+
Sbjct  287  LKSIIIKDCPGVGDRGVASLVSAASSSLARIDL-QSINISDASLAVIGHYGKAVADLALT  345

Query  365  GLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
            GL  V++ G   +V S   GL K   + +  C  VTD  + AIAK    +L+ L L+ C 
Sbjct  346  GLQYVSERGF--WVMSNALGLQKLKSITIDSCNGVTDLGLEAIAK-GCPSLKQLFLSRCC  402

Query  536  CVTDASLAAIADYCSVLRDLDISK  607
             ++D+ L   A     L +L + +
Sbjct  403  YLSDSGLKLFAQTARALENLHLEE  426


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 100/229 (44%), Gaps = 30/229 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKA--------------------------AES  103
            A+ + CP +K + ++ C  + D GV S V A                           ++
Sbjct  279  AIGRCCPKLKSIIIKDCPGVGDRGVASLVSAASSSLARIDLQSINISDASLAVIGHYGKA  338

Query  104  IESLQLEECHRISQAGVFGILVHSAG--KLKALAFENCFGMKDLAFGVPALPPCNSLRSL  277
            +  L L     +S+ G F ++ ++ G  KLK++  ++C G+ DL     A   C SL+ L
Sbjct  339  VADLALTGLQYVSERG-FWVMSNALGLQKLKSITIDSCNGVTDLGLEAIA-KGCPSLKQL  396

Query  278  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
             +  C    D+ L + ++    L +L+L   N ++  G+L F+ SC+A    ++L  C  
Sbjct  397  FLSRCCYLSDSGLKLFAQTARALENLHLEECNRISLIGVLGFLLSCNAKFRALSLVKCFG  456

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + D +          +L  L +  C   T  SLA +   C  L+ +D+S
Sbjct  457  INDTSFCPSPLPSCMSLRSLTIRDCPGFTGTSLAVVGKICPQLQHVDLS  505



>ref|XP_010687976.1| PREDICTED: EIN3-binding F-box protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=615

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 149/203 (73%), Gaps = 0/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KGC  +KQ+ LR C  +S+NG+++  K+AES+E++ LE+C+RI+  GV   L + + 
Sbjct  339  AIAKGCSTLKQISLRNCCFMSNNGLLALSKSAESLENMHLEDCNRITLPGVISALSNCSS  398

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K ++L+   C G++D+AF    L PC SLR LSI NC  FG ASL +L ++CPNL  ++L
Sbjct  399  KFRSLSLVKCMGLRDMAFQDVVLNPCISLRCLSIKNCPAFGSASLAILGKMCPNLRQVDL  458

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G+TD G+   ++S  AGLVK+NL+GCIN++D+ ++A+A+LHGET+++LNL+GC  +
Sbjct  459  SGLYGMTDEGIHSLLESSLAGLVKLNLNGCINLSDECVTAVARLHGETIKVLNLDGCRKI  518

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TD SL+ IA  C +L DLD+S S
Sbjct  519  TDVSLSTIASSCPLLSDLDVSNS  541


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 95/202 (47%), Gaps = 6/202 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP++K L +   + + D G+         +E L L +C  I+  G+  I   +  
Sbjct  155  AIARGCPSLKSLSVWNVSSIGDEGLFEIANECHVLEKLDLCQCPSITNKGLIAI-AENCP  213

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGD-ASLVVLSRLCPNLVHLN  358
             L  L+ E+C  + + +    A   C  L S+SI +C   GD     +LS     L  + 
Sbjct  214  NLTTLSIESCANIGNDSIQAIA-QGCTKLESISIKDCPLVGDQGLASLLSSSSSVLAKVK  272

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCG  535
            L  LN ++D+  L  +      L  + L    NV++K    +    G ++L  L+++ C 
Sbjct  273  LQSLN-ISDFS-LAVIGHYGKSLTSLTLINLRNVSEKGFWVMGNAQGLKSLASLSISSCL  330

Query  536  CVTDASLAAIADYCSVLRDLDI  601
             VTD SL AIA  CS L+ + +
Sbjct  331  GVTDLSLEAIAKGCSTLKQISL  352


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/254 (19%), Positives = 104/254 (41%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++ CPN+  L +  C  + ++ + +  +    +ES+ +++C  +   G+         
Sbjct  207  AIAENCPNLTTLSIESCANIGNDSIQAIAQGCTKLESISIKDCPLVGDQGLASLLSSSSS  266

Query  155  ------------------------------------------FGILVHSAG--KLKALAF  202
                                                      F ++ ++ G   L +L+ 
Sbjct  267  VLAKVKLQSLNISDFSLAVIGHYGKSLTSLTLINLRNVSEKGFWVMGNAQGLKSLASLSI  326

Query  203  ENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVT  382
             +C G+ DL+    A   C++L+ +S+ NC    +  L+ LS+   +L +++L   N +T
Sbjct  327  SSCLGVTDLSLEAIA-KGCSTLKQISLRNCCFMSNNGLLALSKSAESLENMHLEDCNRIT  385

Query  383  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
              G++  + +C +    ++L  C+ + D     +      +L  L++  C     ASLA 
Sbjct  386  LPGVISALSNCSSKFRSLSLVKCMGLRDMAFQDVVLNPCISLRCLSIKNCPAFGSASLAI  445

Query  563  IADYCSVLRDLDIS  604
            +   C  LR +D+S
Sbjct  446  LGKMCPNLRQVDLS  459



>ref|XP_004170235.1| PREDICTED: LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like, 
partial [Cucumis sativus]
Length=509

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 146/201 (73%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+  GC ++KQ+CL+KC+ +S +G+ +F KAA ++ESLQLEEC+RI+ +G+ G+L +   
Sbjct  234  AIGNGCRSLKQICLQKCSFVSGDGLAAFSKAARTLESLQLEECNRITISGIIGLLTNHES  293

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G+KD A   P     +SLR +SI NCTGFG  SL ++ RLC  L HL+L
Sbjct  294  NLKSLVLVKCSGIKDTALQFPLPSYSSSLRWVSIRNCTGFGAESLALVGRLCSQLQHLDL  353

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+TD   +P ++SC+ GLVKVNLSGC+N+TD++I A+A+LHG TL+L+NL+GC  +
Sbjct  354  VGLYGLTDAVFVPLLESCE-GLVKVNLSGCLNLTDESIIALARLHGATLQLVNLDGCRKI  412

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD SL AIAD   VL +LD+S
Sbjct  413  TDQSLVAIADNLLVLNELDVS  433


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/205 (25%), Positives = 95/205 (46%), Gaps = 8/205 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++ GC +++ L L     + D G++   K    +E   + +C  IS   +  I      
Sbjct  50   SIAYGCSSLRALSLWNIASIGDEGLLEIAKECHLLEKFDVCQCPLISNRALIAI-AEGCS  108

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH-L  355
             L  L+ E+C  + +   G+ A+   C+ L S+SI +C+  GD+ +  L     + +H +
Sbjct  109  NLTVLSIESCPNIGN--EGMQAIGRSCSKLESISIKDCSLIGDSGVSSLISSACSSLHKV  166

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL-LNLNGC  532
             L GLN +TD+ L       +  +  + L    NV++K    +       L + L ++ C
Sbjct  167  KLQGLN-ITDFSLAVIGHYGNV-VTHLTLCSLXNVSEKGFWVMGNAQALKLLISLTISAC  224

Query  533  GCVTDASLAAIADYCSVLRDLDISK  607
              VT+ SL AI + C  L+ + + K
Sbjct  225  QGVTNVSLEAIGNGCRSLKQICLQK  249



>ref|XP_006394785.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
 gb|ESQ32071.1| hypothetical protein EUTSA_v10003828mg [Eutrema salsugineum]
Length=621

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+V+  K+A S+ESL+LEECHRI+Q G  G L +   
Sbjct  343  AVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGFLGFLTNCGS  402

Query  182  KLKALAFENCFGMKDLAFGVP-ALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            KLKA +  NC G++DL    P  L  C+S+RSLSI  C GFGDASL  L + C  L  + 
Sbjct  403  KLKAFSLANCMGIQDLNPESPLQLTGCSSIRSLSIRCCPGFGDASLAFLGKFCHQLQDVE  462

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            LSGLNGVTD G+L  +QS + GLVKVNLSGCINV+D T+SAI+  HG  +E LNL+GC  
Sbjct  463  LSGLNGVTDAGVLELLQSNNVGLVKVNLSGCINVSDNTVSAISMCHGRFMESLNLDGCKN  522

Query  539  VTDASLAAIADYCSVLRDLDISKS  610
            +TDASL A+A  C  + DLDIS +
Sbjct  523  ITDASLVAVAKNCYSVSDLDISNT  546


 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/232 (25%), Positives = 103/232 (44%), Gaps = 35/232 (15%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIES---LQLEECHRISQAGVFGILVH  172
            A+++ C N++ + +R C  + D GV   +  A S  +   LQ+     +S A    +L H
Sbjct  237  AIARRCTNLRSISIRSCPRIGDQGVAFLLAQAGSYLTKVKLQMLNITGLSLA----VLGH  292

Query  173  SAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLV  349
                +  L      G+ +  F V A       L+SLS+ +C G  D  L  +   CP+L 
Sbjct  293  YGAAVTDLVLHGLQGVNEKGFWVMANAKGMKKLKSLSVMSCRGMTDVGLEAVGNGCPDLK  352

Query  350  HLNLS--------GL------------------NGVTDYGLLPFVQSCDAGLVKVNLSGC  451
            H++L+        GL                  + +  +G L F+ +C + L   +L+ C
Sbjct  353  HVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGFLGFLTNCGSKLKAFSLANC  412

Query  452  INVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + + D    +  +L G  ++  L++  C    DASLA +  +C  L+D+++S
Sbjct  413  MGIQDLNPESPLQLTGCSSIRSLSIRCCPGFGDASLAFLGKFCHQLQDVELS  464


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 93/188 (49%), Gaps = 3/188 (2%)
 Frame = +2

Query  14   GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKA  193
            GC +++ L +R C    D  +    K    ++ ++L   + ++ AGV  +L  +   L  
Sbjct  428  GCSSIRSLSIRCCPGFGDASLAFLGKFCHQLQDVELSGLNGVTDAGVLELLQSNNVGLVK  487

Query  194  LAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN  373
            +    C  + D      ++     + SL++  C    DASLV +++ C ++  L++S   
Sbjct  488  VNLSGCINVSDNTVSAISMCHGRFMESLNLDGCKNITDASLVAVAKNCYSVSDLDISN-T  546

Query  374  GVTDYGLLPFVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA  550
             V+D+G+     S +   L  +++ GC  +TDK+ + I KL G TL  LN+  CG ++ +
Sbjct  547  LVSDHGIKALASSPNHLNLQVLSVGGCSAITDKSKACIQKL-GRTLLGLNIQRCGRISSS  605

Query  551  SLAAIADY  574
            ++  + ++
Sbjct  606  TVDNLLEH  613


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/229 (22%), Positives = 93/229 (41%), Gaps = 56/229 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++ GCP+++ L L     +SD G+    ++   IE L L  C  I+   +  I      
Sbjct  159  SIAHGCPSLRVLSLWNLPAVSDIGLSEIARSCPMIEKLDLSRCPGITDNAMVAIA-----  213

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                   ENC  + DL                +I +C+G G+  L  ++R C NL  +++
Sbjct  214  -------ENCLHLSDL----------------TIDSCSGIGNEGLRAIARRCTNLRSISI  250

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK---------LHG-----  499
                 + D G+   +    + L KV L   +N+T  +++ +           LHG     
Sbjct  251  RSCPRIGDQGVAFLLAQAGSYLTKVKLQ-MLNITGLSLAVLGHYGAAVTDLVLHGLQGVN  309

Query  500  -------------ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                         + L+ L++  C  +TD  L A+ + C  L+ + ++K
Sbjct  310  EKGFWVMANAKGMKKLKSLSVMSCRGMTDVGLEAVGNGCPDLKHVSLNK  358



>ref|XP_008443991.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis melo]
Length=614

 Score =   206 bits (524),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 144/201 (72%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+  GC ++KQ+CL+KC+ +S   + +F KAA ++ESLQLEEC+RI+ +G+ G+L +   
Sbjct  339  AIGNGCKSLKQICLQKCSFISGEELAAFSKAARTLESLQLEECNRITISGIIGLLTNHES  398

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G+KD     P L   +SLR LSI NCTGFG  SL ++ RLC  L HL+L
Sbjct  399  NLKSLVLVKCSGIKDTTLQFPLLSYSSSLRWLSIRNCTGFGAGSLALVGRLCSQLQHLDL  458

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+TD  L+P ++SC+ GLVKVNLSGC+N+TDK+I A+A+LHG TL+L+NL GC  +
Sbjct  459  VGLYGLTDAVLVPLLESCE-GLVKVNLSGCLNLTDKSILALARLHGATLQLVNLEGCRKI  517

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD SL AIAD   VL +LD+S
Sbjct  518  TDQSLVAIADNLLVLNELDVS  538


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 98/207 (47%), Gaps = 12/207 (6%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++ GC +++ L L    L+ D G++   K    +E   + +C  IS   +  I      
Sbjct  155  SIAYGCSSLRALSLWNIALIGDEGLLEIAKECHLLEKFDVCQCPLISNKALIAI-AEGCP  213

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH-L  355
             L  L+ E+C  + +   G+ A+   C+ L S+SI +C+  GD+ +  L     + +H +
Sbjct  214  NLTVLSIESCPNIGN--EGMQAIGRSCSKLESISIKDCSLIGDSGVSSLISSACSSLHKV  271

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC--INVTDKTISAIAKLHG-ETLELLNLN  526
             L GLN +TD+ L         G V  +L+ C   NV++K    +      + L  L ++
Sbjct  272  KLQGLN-ITDFSLAVIGH---YGNVVNHLTLCSLKNVSEKGFWVMGNAQALKLLVSLTIS  327

Query  527  GCGCVTDASLAAIADYCSVLRDLDISK  607
             C  VT+ SL AI + C  L+ + + K
Sbjct  328  SCQGVTNVSLEAIGNGCKSLKQICLQK  354



>ref|XP_010541601.1| PREDICTED: EIN3-binding F-box protein 2 [Tarenaya hassleriana]
Length=624

 Score =   206 bits (524),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 142/205 (69%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++KQLCL KC L+S NG+VS  K+A S+ESL+LEECHRI+Q G F  LV+   
Sbjct  346  AVGNGCPDLKQLCLSKCLLVSGNGLVSLAKSAMSLESLKLEECHRINQYGFFSFLVNCGL  405

Query  182  KLKALAFENCFGMKDLAFGVPALPPC--NSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
            KLKAL+   C G++D+  G P LP    NSLRSLSI +C G  D+SL +L + C  L  L
Sbjct  406  KLKALSVVKCLGIRDMNPGSP-LPSTRSNSLRSLSISHCPGIRDSSLALLGKFCHQLQDL  464

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             L GLNGVTD GLL  +Q   AGL+KVNLS C+N+TD  +SAI   HG TLE LNL+GC 
Sbjct  465  ELCGLNGVTDSGLLELIQFNSAGLLKVNLSCCLNLTDSAVSAIVTRHGLTLESLNLDGCR  524

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             +TDASL ++A  C  + DLD+S S
Sbjct  525  NITDASLVSVAKNCYSINDLDVSNS  549


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 53/253 (21%), Positives = 97/253 (38%), Gaps = 53/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++ CPN+  L +  C+ L + G+ +  +    + S+ +  C RI   GV         
Sbjct  214  AIAENCPNLIDLTIDSCSGLGNEGLKAIARHCTKLRSISIRNCSRIGDQGVAFLLAQPGC  273

Query  155  ----------------FGILVHSAGKLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSI  283
                              +L      +  +      G+ +  F V         L+SLS+
Sbjct  274  SLSKVKLQMLNITDLSLAVLGQYGASVTDIVLNGLRGVSEKGFWVMGNGKGLKKLKSLSV  333

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLS--------GL------------------NGVTD  385
             +C G  D  L  +   CP+L  L LS        GL                  + +  
Sbjct  334  TSCQGMTDGGLEAVGNGCPDLKQLCLSKCLLVSGNGLVSLAKSAMSLESLKLEECHRINQ  393

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTI-SAIAKLHGETLELLNLNGCGCVTDASLAA  562
            YG   F+ +C   L  +++  C+ + D    S +      +L  L+++ C  + D+SLA 
Sbjct  394  YGFFSFLVNCGLKLKALSVVKCLGIRDMNPGSPLPSTRSNSLRSLSISHCPGIRDSSLAL  453

Query  563  IADYCSVLRDLDI  601
            +  +C  L+DL++
Sbjct  454  LGKFCHQLQDLEL  466


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 55/99 (56%), Gaps = 2/99 (2%)
 Frame = +2

Query  305  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI  484
            D  L  ++R CP+L  L+L  L+ V D GL    QSC   L K+ LS C  +TDK + AI
Sbjct  157  DVGLRAIARGCPSLRVLSLLNLSSVGDVGLCEIAQSCLL-LEKLELSRCAGITDKGLVAI  215

Query  485  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            A+ +   L  L ++ C  + +  L AIA +C+ LR + I
Sbjct  216  AE-NCPNLIDLTIDSCSGLGNEGLKAIARHCTKLRSISI  253



>ref|XP_004150592.1| PREDICTED: EIN3-binding F-box protein 1-like [Cucumis sativus]
Length=614

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 146/201 (73%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+  GC ++KQ+CL+KC+ +S +G+ +F KAA ++ESLQLEEC+RI+ +G+ G+L +   
Sbjct  339  AIGNGCRSLKQICLQKCSFVSGDGLAAFSKAARTLESLQLEECNRITISGIIGLLTNHES  398

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G+KD A   P     +SLR +SI NCTGFG  SL ++ RLC  L HL+L
Sbjct  399  NLKSLVLVKCSGIKDTALQFPLPSYSSSLRWVSIRNCTGFGAESLALVGRLCSQLQHLDL  458

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G+TD   +P ++SC+ GLVKVNLSGC+N+TD++I A+A+LHG TL+L+NL+GC  +
Sbjct  459  VGLYGLTDAVFVPLLESCE-GLVKVNLSGCLNLTDESIIALARLHGATLQLVNLDGCRKI  517

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD SL AIAD   VL +LD+S
Sbjct  518  TDQSLVAIADNLLVLNELDVS  538


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 97/207 (47%), Gaps = 12/207 (6%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++ GC +++ L L     + D G++   K    +E   + +C  IS   +  I      
Sbjct  155  SIAYGCSSLRALSLWNIASIGDEGLLEIAKECHLLEKFDVCQCPLISNRALIAI-AEGCS  213

Query  182  KLKALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVH-L  355
             L  L+ E+C  + +   G+ A+   C+ L S+SI +C+  GD+ +  L     + +H +
Sbjct  214  NLTVLSIESCPNIGN--EGMQAIGRSCSKLESISIKDCSLIGDSGVSSLISSACSSLHKV  271

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC--INVTDKTISAIAKLHGETLEL-LNLN  526
             L GLN +TD+ L         G V  +L+ C   NV++K    +       L + L ++
Sbjct  272  KLQGLN-ITDFSLAVIGH---YGNVVTHLTLCSLKNVSEKGFWVMGNAQALKLLISLTIS  327

Query  527  GCGCVTDASLAAIADYCSVLRDLDISK  607
             C  VT+ SL AI + C  L+ + + K
Sbjct  328  ACQGVTNVSLEAIGNGCRSLKQICLQK  354



>gb|ACB59221.1| F-box protein [Brassica oleracea]
Length=629

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 141/202 (70%), Gaps = 3/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + K  LLSDNG+VSF KA+ S++SLQLEECHR +Q G FG L++   
Sbjct  356  SVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLDSLQLEECHRNTQFGFFGSLLNCGE  415

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC  ++ L  G+PA   C++LRSLSI NC G GDA+L  + +LCP L  ++L
Sbjct  416  KLKAFSLVNCLSIRHLTTGLPASSHCSALRSLSIRNCPGIGDANLAAIGKLCPQLEDIDL  475

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL G T+ G L  +QS    LVK+ LSGC N+TD+ ISAI   +G TLE+LN +GC  +
Sbjct  476  CGLKGTTESGNLHLIQS---SLVKIKLSGCSNLTDRVISAITARNGWTLEVLNRDGCSNI  532

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL +IA  C +L DLDIS+
Sbjct  533  TDASLVSIAANCQILSDLDISE  554


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 99/253 (39%), Gaps = 55/253 (22%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++K CPN+  + L  C+ + D G+++  ++   ++S+ ++ C  +   G+  +L ++   
Sbjct  224  IAKSCPNLTDVTLEACSRIGDEGLLAIARSRSKLKSVSIKNCPLVRDQGIASLLSNTTCS  283

Query  185  LKALAFENCFGMKDLAFGVPA--------LPP--------------------CNSLRSLS  280
            L  L  +    + D++  V          L P                       L SL+
Sbjct  284  LAKLKLQ-MLNVTDVSLAVVGHYGLSITDLAPRWIAHAVSEKGFWVMGNGVGLQKLNSLT  342

Query  281  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS----------------  412
            I  C G  D  L  + + CPN+    +S    ++D GL+ F ++                
Sbjct  343  IPACQGVADMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLDSLQLEECHRNT  402

Query  413  ----------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
                      C   L   +L  C+++   T    A  H   L  L++  C  + DA+LAA
Sbjct  403  QFGFFGSLLNCGEKLKAFSLVNCLSIRHLTTGLPASSHCSALRSLSIRNCPGIGDANLAA  462

Query  563  IADYCSVLRDLDI  601
            I   C  L D+D+
Sbjct  463  IGKLCPQLEDIDL  475



>ref|XP_010454859.1| PREDICTED: EIN3-binding F-box protein 2 [Camelina sativa]
Length=622

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 142/205 (69%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+V+  K+A S+ESL+LEECHRI+Q G+ G L++S  
Sbjct  344  AVGSGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLLGFLMNSGL  403

Query  182  KLKALAFENCFGMKDLAFGVPALPP--CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
            KLKA +  NC G++D     P LP   C+SLRSLSI  C GFGDASL  L   C  L  +
Sbjct  404  KLKAFSMANCLGIRDFNSESP-LPSTCCSSLRSLSIRCCPGFGDASLAFLGNFCHQLQDI  462

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             L GL+GVTD G+   +QS + GLVKVNLSGCINV+D T+SA++  HG TLE LNL+GC 
Sbjct  463  ELCGLDGVTDAGVRELLQSNNVGLVKVNLSGCINVSDNTVSAVSVCHGHTLESLNLDGCK  522

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             +TDASL A+A  C  + DLDIS +
Sbjct  523  NITDASLVAVAKNCYSVNDLDISNT  547


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/253 (21%), Positives = 102/253 (40%), Gaps = 53/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++ C N+  L +  C+ + + G+ +  +   ++ S+ +  C RI   GV         
Sbjct  212  AIAENCVNLSDLTIDSCSGVGNEGLRAIARRCINLRSISIRSCPRIGDQGVAFLLAQAGS  271

Query  155  ----------------FGILVHSAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSI  283
                              +L H    +  L  +   G+ +  F V         L+SLS+
Sbjct  272  YLTKVKLQMLNVTGMSLAVLGHYGAAVTDLVLQGLQGVNEKGFWVMGNAKGLKKLKSLSV  331

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLS--------GL------------------NGVTD  385
             +C G  D  L  +   CP+L H++L+        GL                  + +  
Sbjct  332  VSCRGMTDVGLEAVGSGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQ  391

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTD-KTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
            +GLL F+ +    L   +++ C+ + D  + S +      +L  L++  C    DASLA 
Sbjct  392  FGLLGFLMNSGLKLKAFSMANCLGIRDFNSESPLPSTCCSSLRSLSIRCCPGFGDASLAF  451

Query  563  IADYCSVLRDLDI  601
            + ++C  L+D+++
Sbjct  452  LGNFCHQLQDIEL  464


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 89/181 (49%), Gaps = 3/181 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +R C    D  +         ++ ++L     ++ AGV  +L  +   L  +
Sbjct  430  CSSLRSLSIRCCPGFGDASLAFLGNFCHQLQDIELCGLDGVTDAGVRELLQSNNVGLVKV  489

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D      ++   ++L SL++  C    DASLV +++ C ++  L++S    
Sbjct  490  NLSGCINVSDNTVSAVSVCHGHTLESLNLDGCKNITDASLVAVAKNCYSVNDLDISN-TL  548

Query  377  VTDYGLLPFVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  553
            V+D+G+     S +   L  +++ GC  +TDK+ + I KL G TL  LN+  CG ++ ++
Sbjct  549  VSDHGIKALASSPNHLNLQVLSVGGCSAITDKSKACIQKL-GRTLLGLNIQRCGRISSST  607

Query  554  L  556
            +
Sbjct  608  V  608



>gb|ADW83728.1| EIN3-binding F-box protein 1 [Musa acuminata AAA Group]
Length=453

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KG P +KQL +RK   LSD G+ SF + A ++E+L LE+C+RI+  GV G L+    
Sbjct  177  AIAKGSPFLKQLFVRKSCYLSDAGLRSFAETARALENLHLEDCNRITLMGVLGALLTCNP  236

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            +LK+L    C G++D+AF    LP C SLRSL+I +C G   ASL V+ ++CP L  L+L
Sbjct  237  ELKSLVLVRCLGIRDIAFAPTQLPSCMSLRSLTIRDCPGVTGASLQVVGKICPQLQKLDL  296

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SG  GVTD  L+P +QS + G V+VNLSGC+N+T+  ++ + K HG TL++LNL+GC  +
Sbjct  297  SGQVGVTDASLIPLIQSSEVGFVEVNLSGCVNLTEALVTMLVKAHGSTLKMLNLDGCKRI  356

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD SL AIAD CSV  DLD+S
Sbjct  357  TDQSLVAIADSCSVFDDLDLS  377


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 96/202 (48%), Gaps = 8/202 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L L +C L++D G+V+  K   ++ SL +E C  I   G   ++  S  K
Sbjct  20   IADGCPLLEKLDLCQCPLITDKGLVAVAKKCPNLTSLTIESCANICNEG-LQVIGRSCPK  78

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK+L  ++C  + D           + L  + +       D  L V+     NL+ L+L+
Sbjct  79   LKSLTIKDCLHVGDQGIVSLVSSASSCLERIKL-QALNISDIVLAVIGHYGKNLIDLSLN  137

Query  365  GLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
            GL  V + G   +V     GL K   + ++ C  +TDK + AIAK      +L     C 
Sbjct  138  GLQNVGEKGF--WVMGNALGLQKLRSITINCCNGLTDKGLQAIAKGSPFLKQLFVRKSCY  195

Query  536  CVTDASLAAIADYCSVLRDLDI  601
             ++DA L + A+    L +L +
Sbjct  196  -LSDAGLRSFAETARALENLHL  216



>ref|XP_010493788.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=622

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 141/205 (69%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+V+  K+A S+ESL+LEECHRI+Q G+ G L++S  
Sbjct  344  AVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLLGFLMNSGL  403

Query  182  KLKALAFENCFGMKDLAFGVPALPP--CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
            KLKA +  NC G+ D     P LP   C+SLRSLSI  C GFGDASL  L   C  L  +
Sbjct  404  KLKAFSLANCLGIGDFNSESP-LPSTSCSSLRSLSIRCCPGFGDASLAFLGNFCHQLQDV  462

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             L GL+GVTD G+   +QS + GLVKVNLSGCINV+D T+SA++  HG TLE LNL+GC 
Sbjct  463  ELCGLDGVTDAGVRELLQSNNVGLVKVNLSGCINVSDSTVSAVSVCHGHTLESLNLDGCK  522

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             +TDASL A+A  C  + DLDIS +
Sbjct  523  NITDASLVAVAKNCYSVNDLDISNT  547


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/253 (21%), Positives = 101/253 (40%), Gaps = 53/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++ C N+  L +  C+ + + G+ +  +   ++ S+ +  C RI   GV         
Sbjct  212  AIAENCVNLSDLTIDSCSGVGNEGLRAIARRCINLRSISIRSCPRIGDQGVAFLLAQAGS  271

Query  155  ----------------FGILVHSAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSI  283
                              +L H    +  L  +   G+ +  F V         L+ LS+
Sbjct  272  YLTKVKLQMLNVTGMSLAVLGHYGAAVTDLVLQGLQGVNEKGFWVMGNAKGLKKLKYLSV  331

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLS--------GL------------------NGVTD  385
             +C G  D  L  +   CP+L H++L+        GL                  + +  
Sbjct  332  VSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQ  391

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTD-KTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
            +GLL F+ +    L   +L+ C+ + D  + S +      +L  L++  C    DASLA 
Sbjct  392  FGLLGFLMNSGLKLKAFSLANCLGIGDFNSESPLPSTSCSSLRSLSIRCCPGFGDASLAF  451

Query  563  IADYCSVLRDLDI  601
            + ++C  L+D+++
Sbjct  452  LGNFCHQLQDVEL  464


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 90/184 (49%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            S  C +++ L +R C    D  +         ++ ++L     ++ AGV  +L  +   L
Sbjct  427  STSCSSLRSLSIRCCPGFGDASLAFLGNFCHQLQDVELCGLDGVTDAGVRELLQSNNVGL  486

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
              +    C  + D      ++   ++L SL++  C    DASLV +++ C ++  L++S 
Sbjct  487  VKVNLSGCINVSDSTVSAVSVCHGHTLESLNLDGCKNITDASLVAVAKNCYSVNDLDISN  546

Query  368  LNGVTDYGLLPFVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
               V+D+G+     S +   L  +++ GC  +TDK+ + I KL G TL  LN+  CG ++
Sbjct  547  -TLVSDHGIKALASSPNHLNLQVLSVGGCSAITDKSKACIQKL-GRTLLGLNIQRCGRIS  604

Query  545  DASL  556
             +++
Sbjct  605  SSTV  608



>ref|XP_009388655.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=655

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KG P +KQL +RK   LSD G+ SF + A ++E+L LE+C+RI+  GV G L+    
Sbjct  379  AIAKGSPFLKQLFVRKSCYLSDAGLRSFAETARALENLHLEDCNRITLMGVLGALLTCNP  438

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            +LK+L    C G++D+AF    LP C SLRSL+I +C G   ASL V+ ++CP L  L+L
Sbjct  439  ELKSLVLVRCLGIRDIAFAPTQLPSCMSLRSLTIRDCPGVTGASLQVVGKICPQLQKLDL  498

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SG  GVTD  L+P +QS + G V+VNLSGC+N+TD  ++ + K HG TL++LNL+GC  +
Sbjct  499  SGQVGVTDASLIPLIQSSEVGFVEVNLSGCVNLTDALVTMLVKAHGSTLKMLNLDGCKRI  558

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD SL AIAD CSV  DLD+S
Sbjct  559  TDQSLVAIADSCSVFDDLDLS  579


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 99/204 (49%), Gaps = 12/204 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L L +C L++D G+VS  K   ++ SL +E C  I   G   ++  S  K
Sbjct  222  IADGCPLLEKLDLCQCPLITDKGLVSVAKKCPNLTSLTIESCANICNEG-LQVIGRSCPK  280

Query  185  LKALAFENCFGMKD--LAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            LK+L  ++C  + D  +A  V +   C     L   N     D  L V+     NL+ L+
Sbjct  281  LKSLTIKDCLHVGDQGIASLVSSASSCLERIKLQALN---ISDIVLAVIGHYGKNLIDLS  337

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+GL  V + G   +V     GL K   + ++ C  +TDK + AIAK      +L     
Sbjct  338  LNGLQNVGEKGF--WVMGNALGLQKLRSITINCCNGLTDKGLQAIAKGSPFLKQLFVRKS  395

Query  530  CGCVTDASLAAIADYCSVLRDLDI  601
            C  ++DA L + A+    L +L +
Sbjct  396  C-YLSDAGLRSFAETARALENLHL  418



>gb|EPS63568.1| ein3-binding f-box protein 3, partial [Genlisea aurea]
Length=596

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V++GCP +    L   + +SD G+++F  +A+S+E+L +  C  I+Q GVF +L +   +
Sbjct  321  VAEGCPLMNFFALCDVSNVSDQGLIAFSNSAKSLETLHIGRCDNITQYGVFSVLSNCGRR  380

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LKAL+ ENC GMKDL F +P    C+SLRSL+I NC GFGD+ L +++R+C  L  L+ S
Sbjct  381  LKALSIENCLGMKDLNFTLPLTSSCDSLRSLAIVNCPGFGDSGLGMVARICLRLTSLDFS  440

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            GL  +TD G+LP VQ    GLVKVNLSGC N+TD  +++I +LHGE LE+LNL+GCG +T
Sbjct  441  GLPDITDAGILPVVQVSGFGLVKVNLSGCHNLTDNAVASIVELHGENLEVLNLDGCGNIT  500

Query  545  DASLAAIADYCSVLRDLDISK  607
            D SL AIA  C  L +LDIS+
Sbjct  501  DLSLDAIARNCWSLNELDISR  521


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 94/198 (47%), Gaps = 6/198 (3%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG-KLKA  193
            CP +K + +R C L+ D G+ +   +A +I  L+  +   +S   V   ++   G  +  
Sbjct  219  CPKLKHVSIRSCPLVGDRGISNLFSSAGNI--LEKAKLQSLSITDVSLAVIGKYGCAVTD  276

Query  194  LAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL  370
            LA  +   +K+  F V        +L+SLSI +C    DA+L V++  CP +    L  +
Sbjct  277  LALVDLRNVKERGFWVMGKAGGLQNLKSLSITSCREASDAALQVVAEGCPLMNFFALCDV  336

Query  371  NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA  550
            + V+D GL+ F  S  + L  +++  C N+T   + ++    G  L+ L++  C  + D 
Sbjct  337  SNVSDQGLIAFSNSAKS-LETLHIGRCDNITQYGVFSVLSNCGRRLKALSIENCLGMKDL  395

Query  551  SLA-AIADYCSVLRDLDI  601
            +    +   C  LR L I
Sbjct  396  NFTLPLTSSCDSLRSLAI  413



>ref|XP_010421385.1| PREDICTED: EIN3-binding F-box protein 2-like [Camelina sativa]
Length=618

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 141/205 (69%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+V+  K+A S+ESL+LEECHRI+Q G+ G L+++  
Sbjct  340  AVGSGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLLGFLMNAGL  399

Query  182  KLKALAFENCFGMKDLAFGVPALPP--CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
            KLKA +  NC G++D     P LP   C+SLRSLSI  C GFGD+SL  L   C  L  +
Sbjct  400  KLKAFSLANCLGIRDFNAESP-LPSTSCSSLRSLSIRCCPGFGDSSLAFLGNFCHQLQDV  458

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             L GL+GVTD G+   +Q  + GLVKVNLSGCINV+D T+SA++  HG TLE LNL+GC 
Sbjct  459  ELCGLDGVTDAGVRELLQRNNVGLVKVNLSGCINVSDNTVSAVSVCHGHTLESLNLDGCK  518

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             +TDASL A+A  C  + DLDIS +
Sbjct  519  NITDASLVAVAKNCYSVNDLDISNT  543


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/253 (21%), Positives = 101/253 (40%), Gaps = 53/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++ C N+  L +  C+ + + G+ +  +   ++ S+ +  C RI   GV         
Sbjct  208  AIAENCVNLSDLTIDSCSGVGNEGLRAIARRCINLRSISIRSCPRIGDQGVAFLLAQAGS  267

Query  155  ----------------FGILVHSAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSI  283
                              +L H    +  L  +   G+ +  F V         L+SLS+
Sbjct  268  YLTKVKLQMLNVTGMSLAVLGHYGAAVTDLVLQGLQGVNEKGFWVMGNAKGLKKLKSLSV  327

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLS--------GL------------------NGVTD  385
             +C G  D  L  +   CP+L H++L+        GL                  + +  
Sbjct  328  VSCRGMTDVGLEAVGSGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQ  387

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTD-KTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
            +GLL F+ +    L   +L+ C+ + D    S +      +L  L++  C    D+SLA 
Sbjct  388  FGLLGFLMNAGLKLKAFSLANCLGIRDFNAESPLPSTSCSSLRSLSIRCCPGFGDSSLAF  447

Query  563  IADYCSVLRDLDI  601
            + ++C  L+D+++
Sbjct  448  LGNFCHQLQDVEL  460


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 91/184 (49%), Gaps = 3/184 (2%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            S  C +++ L +R C    D+ +         ++ ++L     ++ AGV  +L  +   L
Sbjct  423  STSCSSLRSLSIRCCPGFGDSSLAFLGNFCHQLQDVELCGLDGVTDAGVRELLQRNNVGL  482

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
              +    C  + D      ++   ++L SL++  C    DASLV +++ C ++  L++S 
Sbjct  483  VKVNLSGCINVSDNTVSAVSVCHGHTLESLNLDGCKNITDASLVAVAKNCYSVNDLDISN  542

Query  368  LNGVTDYGLLPFVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
               V+D+G+     S +   L  +++ GC  +TDK+ + I KL G TL  LN+  CG ++
Sbjct  543  -TLVSDHGIKALASSPNHLNLQVLSVGGCSAITDKSKACIQKL-GRTLLGLNIQRCGRIS  600

Query  545  DASL  556
             +++
Sbjct  601  SSTV  604



>ref|XP_010555012.1| PREDICTED: EIN3-binding F-box protein 2-like [Tarenaya hassleriana]
Length=624

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 140/205 (68%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++KQ+ L KC L+S  G+VS  K+A S+ESL+LEECHRI+Q G FG LV+   
Sbjct  346  AVGSGCPDLKQVYLSKCLLVSGKGLVSLAKSALSLESLKLEECHRINQFGFFGFLVNCGL  405

Query  182  KLKALAFENCFGMKDLAFGVPALPP--CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
            KLKA +  NC G++D+  G P LP   C+SLRSLSI  C GFGD+SL +L + C  L  +
Sbjct  406  KLKAFSVVNCLGIRDINPGSP-LPSTYCSSLRSLSIHCCPGFGDSSLTLLGKFCHQLQEV  464

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             L GL+GVTD GLL  +Q   AGL+KVNLSGCIN+TD  +  I   HG TLE LNL+ C 
Sbjct  465  ELCGLSGVTDVGLLGLLQYNSAGLLKVNLSGCINITDNAVLTIVTRHGCTLESLNLDTCK  524

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             +TD SL A++  C  + DLD+S S
Sbjct  525  NITDTSLIAVSKNCYSINDLDVSNS  549


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 105/207 (51%), Gaps = 12/207 (6%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L L     + D+G+    ++  ++E L L  C  I+  G+  I   +  
Sbjct  162  AIACGCPSLRVLSLWNLPSVGDSGLYEIAQSCPALEKLDLSRCPGITDKGLAAI-ADNCP  220

Query  182  KLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHL  355
             L  L  ++C G+ +   G+ A+   C +LRS+SI NC+  GD  +  +L++   +L  +
Sbjct  221  NLIDLTIDSCSGLGN--EGLKAIARCCTNLRSISIRNCSQIGDQGVAFLLAQAAGSLNKV  278

Query  356  NLSGLNGVTDYGL--LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLN  526
             L  LN +TD  L  L    +  A LV   LSG   V++K    +    G + L+ L++ 
Sbjct  279  KLQMLN-ITDLSLAVLGHYGTLVADLV---LSGLRGVSEKGFWVMGNGKGLKKLKSLSVM  334

Query  527  GCGCVTDASLAAIADYCSVLRDLDISK  607
             C  +TD +L A+   C  L+ + +SK
Sbjct  335  SCLGMTDGALEAVGSGCPDLKQVYLSK  361


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 92/186 (49%), Gaps = 3/186 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +  C    D+ +    K    ++ ++L     ++  G+ G+L +++  L  +
Sbjct  432  CSSLRSLSIHCCPGFGDSSLTLLGKFCHQLQEVELCGLSGVTDVGLLGLLQYNSAGLLKV  491

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A          +L SL++  C    D SL+ +S+ C ++  L++S  + 
Sbjct  492  NLSGCINITDNAVLTIVTRHGCTLESLNLDTCKNITDTSLIAVSKNCYSINDLDVSN-SR  550

Query  377  VTDYGLLPFVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  553
            V+D G+     S +   L   ++ GC  VTDK+++++ KL G TL  L++  C  ++ ++
Sbjct  551  VSDVGIEALASSPNHLNLQIFSIGGCSAVTDKSLASLQKL-GHTLLGLSIRHCSKISSSA  609

Query  554  LAAIAD  571
            + A+ +
Sbjct  610  IDALLE  615


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 51/253 (20%), Positives = 99/253 (39%), Gaps = 53/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++  CPN+  L +  C+ L + G+ +  +   ++ S+ +  C +I   GV  +L  +AG
Sbjct  214  AIADNCPNLIDLTIDSCSGLGNEGLKAIARCCTNLRSISIRNCSQIGDQGVAFLLAQAAG  273

Query  182  KLKA-------------------------LAFENCFGMKDLAFGVPALPP-CNSLRSLSI  283
             L                           L      G+ +  F V         L+SLS+
Sbjct  274  SLNKVKLQMLNITDLSLAVLGHYGTLVADLVLSGLRGVSEKGFWVMGNGKGLKKLKSLSV  333

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLS--------GL------------------NGVTD  385
             +C G  D +L  +   CP+L  + LS        GL                  + +  
Sbjct  334  MSCLGMTDGALEAVGSGCPDLKQVYLSKCLLVSGKGLVSLAKSALSLESLKLEECHRINQ  393

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTD-KTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
            +G   F+ +C   L   ++  C+ + D    S +   +  +L  L+++ C    D+SL  
Sbjct  394  FGFFGFLVNCGLKLKAFSVVNCLGIRDINPGSPLPSTYCSSLRSLSIHCCPGFGDSSLTL  453

Query  563  IADYCSVLRDLDI  601
            +  +C  L+++++
Sbjct  454  LGKFCHQLQEVEL  466



>gb|EMS45959.1| hypothetical protein TRIUR3_29988 [Triticum urartu]
Length=383

 Score =   192 bits (489),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 142/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP++KQL LRKC+ +SD  +  F +AA+ +E+LQ+EEC+RI+  G+   L++ + 
Sbjct  108  SIAKFCPSLKQLYLRKCSQISDGLLKDFAEAAKVLENLQIEECNRITLMGILSFLLNCSP  167

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K K L+   C G+KD+      LP C SLRSL+I  C GF DASL V+  +CP+L +L+L
Sbjct  168  KFKTLSLVKCTGIKDICSAPAQLPVCKSLRSLTIKQCPGFTDASLAVVGMICPHLENLDL  227

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP ++S ++GL+ V+L+GC N+TD  ISA+ K HG +L  L+L GC  +
Sbjct  228  SGLGAVTDDGLLPLIRSSESGLIHVDLNGCENLTDAAISALVKAHGTSLAHLSLEGCSKI  287

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL AI++ CS L +LD+S
Sbjct  288  TDASLFAISESCSELAELDLS  308


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 86/192 (45%), Gaps = 4/192 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +++C   +D  +         +E+L L     ++  G+  ++  S   L  +
Sbjct  193  CKSLRSLTIKQCPGFTDASLAVVGMICPHLENLDLSGLGAVTDDGLLPLIRSSESGLIHV  252

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A          SL  LS+  C+   DASL  +S  C  L  L+LS    
Sbjct  253  DLNGCENLTDAAISALVKAHGTSLAHLSLEGCSKITDASLFAISESCSELAELDLSNCM-  311

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL--NGCGCVTDA  550
            V+DYG+     +    L  ++LSGC+ VT K++  +  +   +LE LNL  N  G    A
Sbjct  312  VSDYGVAVLSSAERLKLRVLSLSGCLKVTPKSVPFLGSMPA-SLEGLNLQFNFIGNHNIA  370

Query  551  SLAAIADYCSVL  586
            SL     +C +L
Sbjct  371  SLEKQLWWCDIL  382



>ref|XP_002453497.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
 gb|EES06473.1| hypothetical protein SORBIDRAFT_04g006870 [Sorghum bicolor]
Length=655

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP++KQLCLRKC  +SD G+ +F ++A+  E+LQLEEC+R++  G+   L++ + 
Sbjct  379  SIAKFCPSLKQLCLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVTLVGILAFLLNCSQ  438

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   C G+KD+      LP C SLR L+I +C GF DASL V+  +CP L  ++L
Sbjct  439  KFRALSLVKCMGIKDIGSAPAQLPLCRSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDL  498

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP +QS +AGL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +
Sbjct  499  SGLGEVTDNGLLPLIQSSEAGLIKVDLSGCKNITDVAVSSLVKGHGKSLKKVSLEGCSKI  558

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL  +++ C+ L +LD+S
Sbjct  559  TDASLFTMSESCTELAELDLS  579


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 108/206 (52%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP++++L + +C L++D G+ +  +   ++ SL +E C  ++  G+  I   S  K
Sbjct  222  IAAGCPSLERLDISRCPLITDKGLAAVAQGCPNLVSLTIEACSGVANEGLRAI-GRSCVK  280

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A+  +NC  + D   G+ +L  C++  SL+     G    DASL V+      +  L 
Sbjct  281  LQAVNIKNCPLVGDQ--GISSL-VCSATASLAKIRLQGLNITDASLAVIGYYGKAVTDLT  337

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +  AGL     ++++ C  VTD  +++IAK    +L+ L L  
Sbjct  338  LTRLATVGERGF--WVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFC-PSLKQLCLRK  394

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            CG V+DA L A  +   V  +L + +
Sbjct  395  CGHVSDAGLKAFTESAKVFENLQLEE  420


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 90/193 (47%), Gaps = 5/193 (3%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E + L     ++  G+  ++  S   L  +
Sbjct  464  CRSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLIKV  523

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D+A          SL+ +S+  C+   DASL  +S  C  L  L+LS    
Sbjct  524  DLSGCKNITDVAVSSLVKGHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCM-  582

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            V+D+G+     +    L  ++LSGC  VT K++  +  L G++LE LNL  C  + + ++
Sbjct  583  VSDHGVAILASARHLKLRVLSLSGCSKVTQKSVPFLGNL-GQSLEGLNLQFCNMIGNHNI  641

Query  557  AAIAD---YCSVL  586
            A++     +C +L
Sbjct  642  ASLEKQLWWCDIL  654


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 65/131 (50%), Gaps = 8/131 (6%)
 Frame = +2

Query  215  GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL  394
            G+ ++A G      C SL  L I  C    D  L  +++ CPNLV L +   +GV + GL
Sbjct  218  GLAEIAAG------CPSLERLDISRCPLITDKGLAAVAQGCPNLVSLTIEACSGVANEGL  271

Query  395  LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADY  574
                +SC   L  VN+  C  V D+ IS++      +L  + L G   +TDASLA I  Y
Sbjct  272  RAIGRSC-VKLQAVNIKNCPLVGDQGISSLVCSATASLAKIRLQGLN-ITDASLAVIGYY  329

Query  575  CSVLRDLDISK  607
               + DL +++
Sbjct  330  GKAVTDLTLTR  340


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/255 (23%), Positives = 104/255 (41%), Gaps = 56/255 (22%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            AV++GCPN+  L +  C+ +++ G+ +  ++   ++++ ++ C  +   G+         
Sbjct  247  AVAQGCPNLVSLTIEACSGVANEGLRAIGRSCVKLQAVNIKNCPLVGDQGISSLVCSATA  306

Query  155  ------------------------------------------FGILVHSAG--KLKALAF  202
                                                      F ++ ++AG   L+ ++ 
Sbjct  307  SLAKIRLQGLNITDASLAVIGYYGKAVTDLTLTRLATVGERGFWVMANAAGLQNLRCMSV  366

Query  203  ENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVT  382
             +C G+ DLA    A   C SL+ L +  C    DA L   +       +L L   N VT
Sbjct  367  TSCPGVTDLALASIA-KFCPSLKQLCLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVT  425

Query  383  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLA  559
              G+L F+ +C      ++L  C+ + D   SA A+L    +L  L +  C   TDASLA
Sbjct  426  LVGILAFLLNCSQKFRALSLVKCMGIKD-IGSAPAQLPLCRSLRFLTIKDCPGFTDASLA  484

Query  560  AIADYCSVLRDLDIS  604
             +   C  L  +D+S
Sbjct  485  VVGMICPQLEQVDLS  499



>ref|XP_009403463.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 141/201 (70%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KG P +K L +RK   LSD+G+ +F ++A+ +E+L LE+C++I+  GV G L   + 
Sbjct  378  AIAKGSPFLKHLFVRKSCYLSDSGLSAFAESAKELENLHLEDCNQITLIGVLGALSKCSP  437

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            +LK+L+   C G+KD AF    LP C SLRSL+I +C G   ASL V+ ++CP L +++L
Sbjct  438  QLKSLSLVRCLGIKDTAFAPVQLPSCISLRSLTIRDCPGVSSASLQVVGKICPQLQNIDL  497

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SG  GVTD  LLP ++S D G V+VNL+GC+NVTD  ++ + K HG TL++LNL GC  +
Sbjct  498  SGQVGVTDTFLLPLIKSSDVGFVQVNLNGCVNVTDDLVTTLVKAHGSTLKMLNLRGCKKI  557

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD SL AIAD CSV+ DLD+S
Sbjct  558  TDRSLLAIADGCSVIEDLDLS  578


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 100/206 (49%), Gaps = 8/206 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GCP+++ L + K  L++D G+         +E L L +C +IS  G+  +      
Sbjct  194  AIAHGCPSLRALSMWKVPLITDAGLSEIADGCPLLEKLDLCQCPQISDRGLIAV-AQKCP  252

Query  182  KLKALAFENCFGMKDLAFGVPALPPC-NSLRSLSICNCTGFGDASLVVLSRLCPNLV-HL  355
            KL +L  E+C  + +   G+ A+  C   L+S++I NC   GD  +  L     + +  +
Sbjct  253  KLTSLTIESCSSVGN--EGLQAIGRCCPKLKSVTIKNCLHVGDQGITSLVSSASSSLERI  310

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  L+ ++D  L   +  C   ++ ++LSG  NV +K    +    G   L  +++  C
Sbjct  311  KLQTLS-ISDVAL-AVIGHCGKNIIDLSLSGLQNVYEKGFWVMGSTLGLRKLRSISITCC  368

Query  533  GCVTDASLAAIADYCSVLRDLDISKS  610
              +TD +L AIA     L+ L + KS
Sbjct  369  NGLTDIALQAIAKGSPFLKHLFVRKS  394


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 95/202 (47%), Gaps = 8/202 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L L +C  +SD G+++  +    + SL +E C  +   G+  I      K
Sbjct  221  IADGCPLLEKLDLCQCPQISDRGLIAVAQKCPKLTSLTIESCSSVGNEGLQAI-GRCCPK  279

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK++  +NC  + D           +SL  + +       D +L V+     N++ L+LS
Sbjct  280  LKSVTIKNCLHVGDQGITSLVSSASSSLERIKL-QTLSISDVALAVIGHCGKNIIDLSLS  338

Query  365  GLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
            GL  V + G   +V     GL K   ++++ C  +TD  + AIAK       L     C 
Sbjct  339  GLQNVYEKGF--WVMGSTLGLRKLRSISITCCNGLTDIALQAIAKGSPFLKHLFVRKSC-  395

Query  536  CVTDASLAAIADYCSVLRDLDI  601
             ++D+ L+A A+    L +L +
Sbjct  396  YLSDSGLSAFAESAKELENLHL  417



>ref|XP_004951542.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=654

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 141/201 (70%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP++KQL LRKC  +SD G+ +F ++A+  E+LQLEEC+R++  G+   L + + 
Sbjct  378  SIAKFCPSLKQLYLRKCGYVSDAGLTAFTESAKVFENLQLEECNRVTLVGILSFLRNCSQ  437

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   C G+KD+      LP C SLR L+I +C GF DASL V+  +CP L  ++L
Sbjct  438  KFRALSLVKCMGIKDICSAPAQLPLCKSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDL  497

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP +QS +AGL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +
Sbjct  498  SGLGEVTDNGLLPLIQSSEAGLIKVDLSGCKNITDVAVSSLVKAHGKSLKKVSLEGCSKI  557

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL  IA+ C  L +LD+S
Sbjct  558  TDASLFTIAESCMELAELDLS  578


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 107/206 (52%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V+ GCP++++L + +C L++D G+ +  +   ++ SL +E C  ++  G+  I      K
Sbjct  221  VAAGCPSLERLDISRCPLITDKGLAAIAQGCPNLVSLTIEACSGVANEGLRAI-GRCCTK  279

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A+  +NC  + D   G+ +L  C++  SL+     G    DASL V+      +  L 
Sbjct  280  LQAVNIKNCAHVGDQ--GISSL-VCSATASLAKIRLQGLNITDASLAVIGYYGKAVTDLT  336

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +  AGL     ++++ C  VTD  +S+IAK    +L+ L L  
Sbjct  337  LTRLATVGERGF--WVMANAAGLQNLRCMSITSCPGVTDLALSSIAKFC-PSLKQLYLRK  393

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            CG V+DA L A  +   V  +L + +
Sbjct  394  CGYVSDAGLTAFTESAKVFENLQLEE  419


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 105/255 (41%), Gaps = 56/255 (22%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++GCPN+  L +  C+ +++ G+ +  +    ++++ ++ C  +   G+         
Sbjct  246  AIAQGCPNLVSLTIEACSGVANEGLRAIGRCCTKLQAVNIKNCAHVGDQGISSLVCSATA  305

Query  155  ------------------------------------------FGILVHSAG--KLKALAF  202
                                                      F ++ ++AG   L+ ++ 
Sbjct  306  SLAKIRLQGLNITDASLAVIGYYGKAVTDLTLTRLATVGERGFWVMANAAGLQNLRCMSI  365

Query  203  ENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVT  382
             +C G+ DLA    A   C SL+ L +  C    DA L   +       +L L   N VT
Sbjct  366  TSCPGVTDLALSSIA-KFCPSLKQLYLRKCGYVSDAGLTAFTESAKVFENLQLEECNRVT  424

Query  383  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLH-GETLELLNLNGCGCVTDASLA  559
              G+L F+++C      ++L  C+ + D   SA A+L   ++L  L +  C   TDASLA
Sbjct  425  LVGILSFLRNCSQKFRALSLVKCMGIKD-ICSAPAQLPLCKSLRFLTIKDCPGFTDASLA  483

Query  560  AIADYCSVLRDLDIS  604
             +   C  L  +D+S
Sbjct  484  VVGMICPQLEQVDLS  498


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 89/193 (46%), Gaps = 5/193 (3%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E + L     ++  G+  ++  S   L  +
Sbjct  463  CKSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLIKV  522

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D+A          SL+ +S+  C+   DASL  ++  C  L  L+LS    
Sbjct  523  DLSGCKNITDVAVSSLVKAHGKSLKKVSLEGCSKITDASLFTIAESCMELAELDLSNCM-  581

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            V+DYG+     +    L  ++LSGC  VT K++  +  L G++LE LNL  C  + + ++
Sbjct  582  VSDYGVAILSSARHLKLRVLSLSGCSKVTQKSVPFLGNL-GQSLEGLNLQFCNMIGNHNI  640

Query  557  AAIAD---YCSVL  586
             ++     +C +L
Sbjct  641  VSLEKKLWWCDIL  653



>gb|EMT32544.1| hypothetical protein F775_30491 [Aegilops tauschii]
Length=452

 Score =   192 bits (487),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 142/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP++KQL LRKC+ +SD  +  F +AA+ +E+LQ+EEC+RI+  G+   L++ + 
Sbjct  177  SIAKFCPSLKQLYLRKCSQISDGLLKDFAEAAKVLENLQIEECNRITLMGILSFLLNCSP  236

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K K L+   C G+KD+      LP C SLRSL+I  C GF DASL V+  +CP+L +L+L
Sbjct  237  KFKTLSLVKCTGIKDICSAPAQLPVCKSLRSLTIKQCPGFTDASLAVVGMICPHLENLDL  296

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP ++S ++GLV V+L+GC N+TD  ISA+ K HG +L  L+L GC  +
Sbjct  297  SGLGAVTDDGLLPLIRSSESGLVHVDLNGCENLTDAAISALVKAHGTSLAHLSLEGCSKI  356

Query  542  TDASLAAIADYCSVLRDLDIS  604
            +DASL AI++ CS L +LD+S
Sbjct  357  SDASLFAISESCSELAELDLS  377


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 86/192 (45%), Gaps = 4/192 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L +++C   +D  +         +E+L L     ++  G+  ++  S   L  +
Sbjct  262  CKSLRSLTIKQCPGFTDASLAVVGMICPHLENLDLSGLGAVTDDGLLPLIRSSESGLVHV  321

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A          SL  LS+  C+   DASL  +S  C  L  L+LS    
Sbjct  322  DLNGCENLTDAAISALVKAHGTSLAHLSLEGCSKISDASLFAISESCSELAELDLSNCM-  380

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL--NGCGCVTDA  550
            V+DYG+     +    L  ++LSGC+ VT K++  +  +   +LE LNL  N  G    A
Sbjct  381  VSDYGVAVLASAERLKLRVLSLSGCLKVTPKSVPFLGSMPA-SLEGLNLQFNFIGNHNIA  439

Query  551  SLAAIADYCSVL  586
            SL     +C +L
Sbjct  440  SLEKQLWWCDIL  451



>ref|XP_006648432.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=490

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP+++QL LRKC  ++D G+ +F  +A  +ESLQLEEC+ ++  G+   LV+   
Sbjct  214  SIAKFCPSLRQLSLRKCGHMTDAGLKAFTDSARLLESLQLEECNGVTLVGILAFLVNCGH  273

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K ++L+   C G+KD++     LP C SL+ L+I +C GF DASL V+  +CP L  ++L
Sbjct  274  KFRSLSLVKCMGIKDISSMPAQLPLCKSLQFLTIKDCPGFTDASLAVVGMVCPYLEQVDL  333

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP + S + GLVKV+LSGC N+TD  +SA+ K HG++L+ ++L GCG +
Sbjct  334  SGLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSALVKGHGKSLKQVSLEGCGKI  393

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AI++ CS L +LD+SK
Sbjct  394  TDASLLAISENCSELAELDLSK  415


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 105/255 (41%), Gaps = 56/255 (22%)
 Frame = +2

Query  2    AVSKGCPN--------------------------VKQLCLRKCTLLSDNGVVSFVKAA--  97
            AV++GCPN                          ++ L ++ C L+ D G+ S V AA  
Sbjct  82   AVAQGCPNLLSLTVESCPGVGNDGLRAIGRCCSKLQALNIKNCALVGDQGISSVVCAATA  141

Query  98   ------------------------ESIESLQLEECHRISQAGVFGILVHSAG--KLKALA  199
                                    +++  L L     +++ G F ++ ++AG   L+ ++
Sbjct  142  SLTKIRLQGLNITDASLAVIGYYGKAVTDLTLVRLSAVAERG-FWVMANAAGLQNLRCMS  200

Query  200  FENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV  379
              +C G+ +LA    A   C SLR LS+  C    DA L   +     L  L L   NGV
Sbjct  201  VISCPGVTNLALASIA-KFCPSLRQLSLRKCGHMTDAGLKAFTDSARLLESLQLEECNGV  259

Query  380  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLA  559
            T  G+L F+ +C      ++L  C+ + D +         ++L+ L +  C   TDASLA
Sbjct  260  TLVGILAFLVNCGHKFRSLSLVKCMGIKDISSMPAQLPLCKSLQFLTIKDCPGFTDASLA  319

Query  560  AIADYCSVLRDLDIS  604
             +   C  L  +D+S
Sbjct  320  VVGMVCPYLEQVDLS  334


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 89/223 (40%), Gaps = 56/223 (25%)
 Frame = +2

Query  20   PNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALA  199
            PN+  L L    L++D G+        S+E L +  C  I+  G+  +            
Sbjct  36   PNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITRCPLITDKGLTAV------------  83

Query  200  FENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGV  379
                      A G P      +L SL++ +C G G+  L  + R C  L  LN+     V
Sbjct  84   ----------AQGCP------NLLSLTVESCPGVGNDGLRAIGRCCSKLQALNIKNCALV  127

Query  380  TDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI-------------------------  484
             D G+   V +  A L K+ L G +N+TD +++ I                         
Sbjct  128  GDQGISSVVCAATASLTKIRLQG-LNITDASLAVIGYYGKAVTDLTLVRLSAVAERGFWV  186

Query  485  -AKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
             A   G + L  +++  C  VT+ +LA+IA +C  LR L + K
Sbjct  187  MANAAGLQNLRCMSVISCPGVTNLALASIAKFCPSLRQLSLRK  229



>ref|NP_001132560.1| F-box family member [Zea mays]
Length=375

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 144/201 (72%), Gaps = 2/201 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP++K+L LRKC  +SD G+ +F ++A+  E+LQLEEC+R++  G+   L + + 
Sbjct  101  SIAKFCPSLKKLYLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVTLVGILAFL-NCSQ  159

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   C G+KD+   VP LP C SLR L+I +C GF DASL V+  +CP L  ++L
Sbjct  160  KFRALSLVKCMGIKDIC-SVPQLPFCRSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDL  218

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP +QS ++GL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +
Sbjct  219  SGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKI  278

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL  +++ C+ L +LD+S
Sbjct  279  TDASLFTMSESCTELAELDLS  299


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 90/193 (47%), Gaps = 5/193 (3%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E + L     ++  G+  ++  S   L  +
Sbjct  184  CRSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDLSGLGEVTDNGLLPLIQSSESGLIKV  243

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D+A          SL+ +S+  C+   DASL  +S  C  L  L+LS    
Sbjct  244  DLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCM-  302

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            V+DYG+     +    L  ++LSGC  VT K++  +  L G++LE LNL  C  + + ++
Sbjct  303  VSDYGVAMLASARHLKLRVLSLSGCSKVTQKSVPFLGNL-GQSLEGLNLQFCNMIGNHNI  361

Query  557  AAIAD---YCSVL  586
            A++     +C +L
Sbjct  362  ASLEKKLWWCDIL  374


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 93/216 (43%), Gaps = 32/216 (15%)
 Frame = +2

Query  41   LRKCTLLSDNGVVSFV-KAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFG  217
            ++ C L+ D G+ S V  A  S+  ++L+  + I+ A +  ++ +    +  L+      
Sbjct  8    IKNCPLVGDQGISSLVCSATASLAKIRLQGLN-ITDASL-AVIGYYGKAITDLSLTRLAT  65

Query  218  MKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL  394
            + +  F V A      +LR +S+ +C G  D +L  +++ CP+L  L L     V+D GL
Sbjct  66   VGERGFWVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFCPSLKKLYLRKCGHVSDAGL  125

Query  395  LPFVQS-------------------------CDAGLVKVNLSGCINVTDKTISAIAKL-H  496
              F +S                         C      ++L  C+ + D  I ++ +L  
Sbjct  126  KAFTESAKVFENLQLEECNRVTLVGILAFLNCSQKFRALSLVKCMGIKD--ICSVPQLPF  183

Query  497  GETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
              +L  L +  C   TDASLA +   C  L  +D+S
Sbjct  184  CRSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDLS  219



>ref|XP_010322126.1| PREDICTED: EIN3-binding F-box protein 1-like [Solanum lycopersicum]
Length=613

 Score =   192 bits (488),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 138/202 (68%), Gaps = 1/202 (0%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            + K CPN+K  C+RK  +LSDNG+V+ +K   S++ L+LEECH I+QAG FGIL++   K
Sbjct  337  ICKACPNLKLFCVRKSVVLSDNGLVACIKDLVSLQHLRLEECHLITQAGFFGILLNCGKK  396

Query  185  LKALAFENCFGMKDLAFGVPALPPC-NSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            LK  +   CFG+ DL   +P+  PC NSL SL+I NC G G+A++ ++SRLC  L H+ L
Sbjct  397  LKTFSLVKCFGVNDLTNAIPSKAPCCNSLVSLTIRNCLGVGNATIAIISRLCHRLTHIKL  456

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GL  +TD G+ P V++C A LV VNLSGC+N+TD ++S I    G++L+ L ++GC  V
Sbjct  457  IGLLSITDEGIFPLVKNCAANLVAVNLSGCVNITDISVSYIVNKCGKSLKYLLVDGCKNV  516

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDA+L  I + C  L  LD+SK
Sbjct  517  TDATLVEIWNSCWTLNVLDVSK  538


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 57/229 (25%), Positives = 93/229 (41%), Gaps = 31/229 (14%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVS-FVKAAESIESLQLEECHRISQAGVFGILVHSA  178
            AV   CP +K + L+ C L+ D G+   F+ A  S+  ++L+  H    +    I+    
Sbjct  230  AVGLYCPKLKVIILKNCPLIGDRGIEDLFLSAGHSLTEVELQALHTSDIS--IKIISQHG  287

Query  179  GKLKALAFENCFGMKDLAFGVPALPPC-NSLRSLSICNCTGFGDASLVVLSRLCPN----  343
              L +L F     +    F V  +  C + L++LSI  C+G  D  L V+ + CPN    
Sbjct  288  TALTSLDFGELRRVVVRDFWVMGIGQCLHKLKALSISACSGVNDLGLHVICKACPNLKLF  347

Query  344  ----------------------LVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
                                  L HL L   + +T  G    + +C   L   +L  C  
Sbjct  348  CVRKSVVLSDNGLVACIKDLVSLQHLRLEECHLITQAGFFGILLNCGKKLKTFSLVKCFG  407

Query  458  VTDKTISAIAKLH-GETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            V D T +  +K     +L  L +  C  V +A++A I+  C  L  + +
Sbjct  408  VNDLTNAIPSKAPCCNSLVSLTIRNCLGVGNATIAIISRLCHRLTHIKL  456



>ref|NP_001145991.1| uncharacterized protein LOC100279520 [Zea mays]
 gb|ACL52991.1| unknown [Zea mays]
Length=522

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CPN+KQL LRKC  +SD G+ +F ++A+  E+L LEEC+R+S  G+   L++   
Sbjct  246  SIAKFCPNLKQLYLRKCGYVSDAGLKAFTESAKVFENLHLEECNRVSLVGILAFLLNCRE  305

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   C G+KD+      LP C SLR L+I +C GF DASL  +  +CP L  ++L
Sbjct  306  KFRALSLVKCMGIKDICSAPAQLPLCRSLRFLTIKDCPGFTDASLAAVGMICPQLEQVDL  365

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP +QS +AGLVKV+LSGC N+TD  +S++ K HG++L+ +NL GC  +
Sbjct  366  SGLGEVTDNGLLPLIQSSEAGLVKVDLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKI  425

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDA L  +++ C+ L +L++S
Sbjct  426  TDAILFTMSESCTELAELNLS  446


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 108/206 (52%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP++++L + +C L++D G+V+  +   ++ SL +E C  ++  G+  I   S  K
Sbjct  89   IAAGCPSLERLDICRCPLITDKGLVAVAQGCPNLVSLTIEACPGVANEGLRAI-GRSCVK  147

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A+  +NC  + D   G+ +L  C++  +L+     G    DASL V+      +  L 
Sbjct  148  LQAVNIKNCPLVGDQ--GISSL-VCSATAALTKIRLQGLNITDASLAVIGYYGKAITDLT  204

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +  AGL     ++++ C  VTD  +++IAK     L+ L L  
Sbjct  205  LTRLAAVGERGF--WVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFC-PNLKQLYLRK  261

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            CG V+DA L A  +   V  +L + +
Sbjct  262  CGYVSDAGLKAFTESAKVFENLHLEE  287


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 65/131 (50%), Gaps = 8/131 (6%)
 Frame = +2

Query  215  GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL  394
            G+ ++A G P      SL  L IC C    D  LV +++ CPNLV L +    GV + GL
Sbjct  85   GLAEIAAGCP------SLERLDICRCPLITDKGLVAVAQGCPNLVSLTIEACPGVANEGL  138

Query  395  LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADY  574
                +SC   L  VN+  C  V D+ IS++       L  + L G   +TDASLA I  Y
Sbjct  139  RAIGRSC-VKLQAVNIKNCPLVGDQGISSLVCSATAALTKIRLQGLN-ITDASLAVIGYY  196

Query  575  CSVLRDLDISK  607
               + DL +++
Sbjct  197  GKAITDLTLTR  207


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 90/193 (47%), Gaps = 5/193 (3%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  + +       +E + L     ++  G+  ++  S   L  +
Sbjct  331  CRSLRFLTIKDCPGFTDASLAAVGMICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLVKV  390

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D+A          SL+ +++  C+   DA L  +S  C  L  LNLS    
Sbjct  391  DLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKITDAILFTMSESCTELAELNLSNCM-  449

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            V+DYG+     +    L  ++LSGC  VT K++  +  L G+++E LNL  C  + + ++
Sbjct  450  VSDYGVAILASARHLKLRVLSLSGCSKVTQKSVLFLGNL-GQSIEGLNLQFCDMIGNHNI  508

Query  557  AAIAD---YCSVL  586
            A++     +C +L
Sbjct  509  ASLEKKLWWCDIL  521


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 106/254 (42%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCPN+  L +  C  +++ G+ +  ++   ++++ ++ C  +   G+  ++  +  
Sbjct  114  AVAQGCPNLVSLTIEACPGVANEGLRAIGRSCVKLQAVNIKNCPLVGDQGISSLVCSATA  173

Query  182  KLK------------ALAFENCFG--MKDL-----------AFGVPA-LPPCNSLRSLSI  283
             L             +LA    +G  + DL            F V A      +LR +S+
Sbjct  174  ALTKIRLQGLNITDASLAVIGYYGKAITDLTLTRLAAVGERGFWVMANAAGLQNLRCMSV  233

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D +L  +++ CPNL  L L     V+D GL  F +S                 
Sbjct  234  TSCPGVTDLALASIAKFCPNLKQLYLRKCGYVSDAGLKAFTESAKVFENLHLEECNRVSL  293

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLH-GETLELLNLNGCGCVTDASLAA  562
                     C      ++L  C+ + D   SA A+L    +L  L +  C   TDASLAA
Sbjct  294  VGILAFLLNCREKFRALSLVKCMGIKD-ICSAPAQLPLCRSLRFLTIKDCPGFTDASLAA  352

Query  563  IADYCSVLRDLDIS  604
            +   C  L  +D+S
Sbjct  353  VGMICPQLEQVDLS  366



>dbj|BAJ88579.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=649

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 142/200 (71%), Gaps = 0/200 (0%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++K CP +KQLCLRKC  +SD G+ +F ++A+ +E+LQLEEC+R++  GV   L++ + K
Sbjct  375  IAKFCPGLKQLCLRKCGHVSDAGLKAFTESAKVLENLQLEECNRVTLVGVLACLINCSQK  434

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
             +AL+   C G++D+      LP C SLR L+I +C GF DASL V+  +CP L  ++LS
Sbjct  435  FRALSLVKCTGVRDVCSAPAQLPVCKSLRFLTIKDCAGFTDASLAVVGMICPQLEQVDLS  494

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            GL  +TD GLLP ++S +  LVKV+LSGC N+TD T+S++ K HG++++ ++L GC  +T
Sbjct  495  GLGEITDNGLLPLIKSSEGSLVKVDLSGCKNITDVTVSSLVKAHGKSVKQVSLEGCSKIT  554

Query  545  DASLAAIADYCSVLRDLDIS  604
            DASL  I++ C+ L +LD+S
Sbjct  555  DASLFCISENCTELAELDLS  574


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 93/229 (41%), Gaps = 56/229 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++G PN+  L L    L++D G+        S+E L +  C  I+  G+  I      
Sbjct  190  AVARGSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITSCPLITDKGLAAI------  243

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                            A G P      +L SL+I  C+G G+  L  + R C  L  +++
Sbjct  244  ----------------AQGCP------NLVSLTIEACSGVGNEGLRAIGRCCLKLQAVSI  281

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI------------AKLHG--  499
                 V D G+   V S  A L K+ L G +N+TD +++ I            A+L    
Sbjct  282  KNCMHVGDQGISSLVCSASASLTKIRLQG-LNITDASLAVIGYYGKAVTELTLARLSAVG  340

Query  500  -------------ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                         + L  +++  C  VTD ++  IA +C  L+ L + K
Sbjct  341  ERGFWVMANAAGLQKLRCMSVTSCLGVTDLAITCIAKFCPGLKQLCLRK  389


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 102/254 (40%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCPN+  L +  C+ + + G+ +  +    ++++ ++ C  +   G+  ++  ++ 
Sbjct  242  AIAQGCPNLVSLTIEACSGVGNEGLRAIGRCCLKLQAVSIKNCMHVGDQGISSLVCSASA  301

Query  182  KLK------------ALAFENCFG-------------MKDLAFGVPA-LPPCNSLRSLSI  283
             L             +LA    +G             + +  F V A       LR +S+
Sbjct  302  SLTKIRLQGLNITDASLAVIGYYGKAVTELTLARLSAVGERGFWVMANAAGLQKLRCMSV  361

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D ++  +++ CP L  L L     V+D GL  F +S                 
Sbjct  362  TSCLGVTDLAITCIAKFCPGLKQLCLRKCGHVSDAGLKAFTESAKVLENLQLEECNRVTL  421

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAA  562
                     C      ++L  C  V D   SA A+L   ++L  L +  C   TDASLA 
Sbjct  422  VGVLACLINCSQKFRALSLVKCTGVRD-VCSAPAQLPVCKSLRFLTIKDCAGFTDASLAV  480

Query  563  IADYCSVLRDLDIS  604
            +   C  L  +D+S
Sbjct  481  VGMICPQLEQVDLS  494


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/193 (23%), Positives = 85/193 (44%), Gaps = 6/193 (3%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E + L     I+  G+  ++  S G L  +
Sbjct  459  CKSLRFLTIKDCAGFTDASLAVVGMICPQLEQVDLSGLGEITDNGLLPLIKSSEGSLVKV  518

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D+           S++ +S+  C+   DASL  +S  C  L  L+LS    
Sbjct  519  DLSGCKNITDVTVSSLVKAHGKSVKQVSLEGCSKITDASLFCISENCTELAELDLSNCM-  577

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            V+D G+     +    L  ++L GC NVT  ++  +  +    LE LNL  C  + + ++
Sbjct  578  VSDSGVASLASAKHFKLRVLSLFGCSNVTQASVQFLGSMG--KLEGLNLQYCNMIGNHNI  635

Query  557  AAIAD---YCSVL  586
            A++     +C ++
Sbjct  636  ASLEKQLWWCDIV  648



>gb|EMS68820.1| hypothetical protein TRIUR3_29831 [Triticum urartu]
Length=484

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 139/200 (70%), Gaps = 0/200 (0%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++K CP +KQLCLRKC  +SD G+ +F ++A+ +E+LQLEEC+R++  GV   L++ + K
Sbjct  210  IAKFCPGLKQLCLRKCGHVSDAGLKAFTESAKVMENLQLEECNRVTLVGVLACLINCSHK  269

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
             +AL+   C G+KD+      LP C SLR L+I +C GF DASL V+  +CP L  ++LS
Sbjct  270  FRALSLVKCTGVKDVCSAPAQLPVCKSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDLS  329

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            GL  VTD GLLP + S +  LVKV+LSGC N+TD  +S++ K HG++++ ++L GC  +T
Sbjct  330  GLGEVTDNGLLPLINSSEGSLVKVDLSGCKNITDVAVSSLVKAHGKSVKQISLEGCSKIT  389

Query  545  DASLAAIADYCSVLRDLDIS  604
            DASL  I++ C+ L  LD+S
Sbjct  390  DASLFCISENCTELAGLDLS  409


 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 107/206 (52%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP++++L +  C L++D G+ +  +   ++ SL +E C  +   G+  I      K
Sbjct  52   IAAGCPSLERLDITSCPLITDKGLAAIAQGCPNLVSLTMEACSGVGNEGLRAI-GRCCLK  110

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A++ +NC  + D   G+ +L  C++  SL+     G    DASL V+      +  L 
Sbjct  111  LQAVSIKNCVHVGDQ--GISSL-VCSASASLAKIRLQGLNITDASLAVIGYYGKAVTDLT  167

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +  AGL K   ++++ C+ VTD  I+ IAK     L+ L L  
Sbjct  168  LARLAAVGERGF--WVMANAAGLQKLRCMSVTSCLGVTDLAITCIAKFC-PGLKQLCLRK  224

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            CG V+DA L A  +   V+ +L + +
Sbjct  225  CGHVSDAGLKAFTESAKVMENLQLEE  250



>ref|XP_006657116.1| PREDICTED: EIN3-binding F-box protein 1-like [Oryza brachyantha]
Length=590

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP++KQL L+KC+ +SD  +  F ++A  +ESLQ+EEC++++  G+   L++ + 
Sbjct  315  SIAKFCPSLKQLSLKKCSQVSDGRLKDFAESAMVLESLQIEECNKVTLMGILAFLLNCSP  374

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K KAL+   C G+KD+      LP C SLRSL+I +C GF DASL V+  +CP L +++L
Sbjct  375  KFKALSLVKCNGIKDICSAPAQLPLCKSLRSLTIKDCPGFTDASLAVVGMICPQLENVDL  434

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP ++S ++GLV V+L+GC N+TD T+SA+ K HG +L  L+L GC  +
Sbjct  435  SGLGAVTDNGLLPLIKSSESGLVHVDLNGCENLTDATVSALVKAHGSSLARLSLEGCSKI  494

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL AI++ C+ L +LD+S
Sbjct  495  TDASLFAISEGCTDLAELDLS  515


 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 103/206 (50%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP++ +L +  C L++D G+ +  +    ++++ +E C  ++  G+  I      K
Sbjct  158  IAAGCPSLARLDITGCPLITDKGLTAVAQGCPDLKAVTIEACPGVADEGLKAI-GRCCAK  216

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A+  +NC  + D   GV  L  C++  SL+     G    DASL V+      +  L 
Sbjct  217  LQAVNIKNCAHVGDQ--GVSGL-VCSAAASLAKVRLQGLSITDASLAVIGYYGKAITDLT  273

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +   GL K   +++S C  VTD  +++IAK    +L+ L+L  
Sbjct  274  LARLPTVGERGF--WVMANALGLQKLRCMSVSSCPGVTDLALASIAKFC-PSLKQLSLKK  330

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            C  V+D  L   A+   VL  L I +
Sbjct  331  CSQVSDGRLKDFAESAMVLESLQIEE  356


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 58/254 (23%), Positives = 107/254 (42%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP++K + +  C  ++D G+ +  +    ++++ ++ C  +   GV G++  +A 
Sbjct  183  AVAQGCPDLKAVTIEACPGVADEGLKAIGRCCAKLQAVNIKNCAHVGDQGVSGLVCSAAA  242

Query  182  KL------------KALAFENCFGMKDLAFGVPALPPC--------------NSLRSLSI  283
             L             +LA    +G       +  LP                  LR +S+
Sbjct  243  SLAKVRLQGLSITDASLAVIGYYGKAITDLTLARLPTVGERGFWVMANALGLQKLRCMSV  302

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTD--------------------------  385
             +C G  D +L  +++ CP+L  L+L   + V+D                          
Sbjct  303  SSCPGVTDLALASIAKFCPSLKQLSLKKCSQVSDGRLKDFAESAMVLESLQIEECNKVTL  362

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLH-GETLELLNLNGCGCVTDASLAA  562
             G+L F+ +C      ++L  C  + D   SA A+L   ++L  L +  C   TDASLA 
Sbjct  363  MGILAFLLNCSPKFKALSLVKCNGIKD-ICSAPAQLPLCKSLRSLTIKDCPGFTDASLAV  421

Query  563  IADYCSVLRDLDIS  604
            +   C  L ++D+S
Sbjct  422  VGMICPQLENVDLS  435


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 86/192 (45%), Gaps = 4/192 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E++ L     ++  G+  ++  S   L  +
Sbjct  400  CKSLRSLTIKDCPGFTDASLAVVGMICPQLENVDLSGLGAVTDNGLLPLIKSSESGLVHV  459

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D           +SL  LS+  C+   DASL  +S  C +L  L+LS    
Sbjct  460  DLNGCENLTDATVSALVKAHGSSLARLSLEGCSKITDASLFAISEGCTDLAELDLSNCM-  518

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL--NGCGCVTDA  550
            V+DYG+     +    L  ++LSGC+ VT K++  +  +   +LE LNL  N  G    A
Sbjct  519  VSDYGVAVLASARQLKLRVLSLSGCLKVTQKSVPFLGSMSA-SLEGLNLQFNFIGNHNIA  577

Query  551  SLAAIADYCSVL  586
            SL     +C +L
Sbjct  578  SLEKQLWWCDIL  589


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (55%), Gaps = 2/102 (2%)
 Frame = +2

Query  296  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI  475
            G  DA L   +R CP+L+ L L  +  VTD GL      C + L +++++GC  +TDK +
Sbjct  123  GVTDAGLSAAARGCPSLLSLALWHVPQVTDAGLAEIAAGCPS-LARLDITGCPLITDKGL  181

Query  476  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            +A+A+     L+ + +  C  V D  L AI   C+ L+ ++I
Sbjct  182  TAVAQ-GCPDLKAVTIEACPGVADEGLKAIGRCCAKLQAVNI  222


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 62/142 (44%), Gaps = 26/142 (18%)
 Frame = +2

Query  257  CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD------  418
            C SL SL++ +     DA L  ++  CP+L  L+++G   +TD GL    Q C       
Sbjct  136  CPSLLSLALWHVPQVTDAGLAEIAAGCPSLARLDITGCPLITDKGLTAVAQGCPDLKAVT  195

Query  419  -------------------AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                               A L  VN+  C +V D+ +S +      +L  + L G   +
Sbjct  196  IEACPGVADEGLKAIGRCCAKLQAVNIKNCAHVGDQGVSGLVCSAAASLAKVRLQGLS-I  254

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASLA I  Y   + DL +++
Sbjct  255  TDASLAVIGYYGKAITDLTLAR  276



>ref|XP_008677099.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
 ref|XP_008677100.1| PREDICTED: uncharacterized protein LOC100279520 isoform X1 [Zea 
mays]
Length=651

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CPN+KQL LRKC  +SD G+ +F ++A+  E+L LEEC+R+S  G+   L++   
Sbjct  375  SIAKFCPNLKQLYLRKCGYVSDAGLKAFTESAKVFENLHLEECNRVSLVGILAFLLNCRE  434

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   C G+KD+      LP C SLR L+I +C GF DASL  +  +CP L  ++L
Sbjct  435  KFRALSLVKCMGIKDICSAPAQLPLCRSLRFLTIKDCPGFTDASLAAVGMICPQLEQVDL  494

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP +QS +AGLVKV+LSGC N+TD  +S++ K HG++L+ +NL GC  +
Sbjct  495  SGLGEVTDNGLLPLIQSSEAGLVKVDLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKI  554

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDA L  +++ C+ L +L++S
Sbjct  555  TDAILFTMSESCTELAELNLS  575


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 108/206 (52%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP++++L + +C L++D G+V+  +   ++ SL +E C  ++  G+  I   S  K
Sbjct  218  IAAGCPSLERLDICRCPLITDKGLVAVAQGCPNLVSLTIEACPGVANEGLRAI-GRSCVK  276

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A+  +NC  + D   G+ +L  C++  +L+     G    DASL V+      +  L 
Sbjct  277  LQAVNIKNCPLVGDQ--GISSL-VCSATAALTKIRLQGLNITDASLAVIGYYGKAITDLT  333

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +  AGL     ++++ C  VTD  +++IAK     L+ L L  
Sbjct  334  LTRLAAVGERGF--WVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFC-PNLKQLYLRK  390

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            CG V+DA L A  +   V  +L + +
Sbjct  391  CGYVSDAGLKAFTESAKVFENLHLEE  416


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 65/131 (50%), Gaps = 8/131 (6%)
 Frame = +2

Query  215  GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL  394
            G+ ++A G      C SL  L IC C    D  LV +++ CPNLV L +    GV + GL
Sbjct  214  GLAEIAAG------CPSLERLDICRCPLITDKGLVAVAQGCPNLVSLTIEACPGVANEGL  267

Query  395  LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADY  574
                +SC   L  VN+  C  V D+ IS++       L  + L G   +TDASLA I  Y
Sbjct  268  RAIGRSC-VKLQAVNIKNCPLVGDQGISSLVCSATAALTKIRLQGLN-ITDASLAVIGYY  325

Query  575  CSVLRDLDISK  607
               + DL +++
Sbjct  326  GKAITDLTLTR  336


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 106/254 (42%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCPN+  L +  C  +++ G+ +  ++   ++++ ++ C  +   G+  ++  +  
Sbjct  243  AVAQGCPNLVSLTIEACPGVANEGLRAIGRSCVKLQAVNIKNCPLVGDQGISSLVCSATA  302

Query  182  KLK------------ALAFENCFG--MKDL-----------AFGVPA-LPPCNSLRSLSI  283
             L             +LA    +G  + DL            F V A      +LR +S+
Sbjct  303  ALTKIRLQGLNITDASLAVIGYYGKAITDLTLTRLAAVGERGFWVMANAAGLQNLRCMSV  362

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D +L  +++ CPNL  L L     V+D GL  F +S                 
Sbjct  363  TSCPGVTDLALASIAKFCPNLKQLYLRKCGYVSDAGLKAFTESAKVFENLHLEECNRVSL  422

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAA  562
                     C      ++L  C+ + D   SA A+L    +L  L +  C   TDASLAA
Sbjct  423  VGILAFLLNCREKFRALSLVKCMGIKD-ICSAPAQLPLCRSLRFLTIKDCPGFTDASLAA  481

Query  563  IADYCSVLRDLDIS  604
            +   C  L  +D+S
Sbjct  482  VGMICPQLEQVDLS  495


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 90/193 (47%), Gaps = 5/193 (3%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  + +       +E + L     ++  G+  ++  S   L  +
Sbjct  460  CRSLRFLTIKDCPGFTDASLAAVGMICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLVKV  519

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D+A          SL+ +++  C+   DA L  +S  C  L  LNLS    
Sbjct  520  DLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKITDAILFTMSESCTELAELNLSNCM-  578

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            V+DYG+     +    L  ++LSGC  VT K++  +  L G+++E LNL  C  + + ++
Sbjct  579  VSDYGVAILASARHLKLRVLSLSGCSKVTQKSVLFLGNL-GQSIEGLNLQFCDMIGNHNI  637

Query  557  AAIAD---YCSVL  586
            A++     +C +L
Sbjct  638  ASLEKKLWWCDIL  650



>ref|XP_009419280.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 141/201 (70%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KG P +KQL + K   LSD G+++F   A+++E L LE+C+ I+  G+ G L+  + 
Sbjct  378  AIAKGSPFLKQLFVCKSCYLSDAGLIAFAGTAKALEGLHLEDCNHITLMGILGALLKRSA  437

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            +LK+L+   C G+KD++F    LP C SLRSL+I +C G   AS+ V+ R+CP L +++L
Sbjct  438  ELKSLSLVRCLGLKDISFEFSQLPSCMSLRSLTIQDCPGVTSASIQVVGRICPQLQNIDL  497

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SG  GVTD  L+P ++S + G V++NL+GC+NVTD  ++ + K+HG +L++LNL+GC  +
Sbjct  498  SGQVGVTDESLIPLIESSEVGFVEINLTGCVNVTDDLVTMLIKVHGSSLKMLNLHGCRKI  557

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD SL AI + CSVL DLD+S
Sbjct  558  TDRSLLAITESCSVLDDLDLS  578


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 93/203 (46%), Gaps = 8/203 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L L +C L+SD G+++  +    + SL ++ C RI   G+  I      K
Sbjct  221  IANGCPLLEKLDLCQCPLISDKGLIAVAQKCPDLTSLSIKSCSRIGNEGLQAI-GRCCPK  279

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK++   +C  + D           +SL  + +       D +L V+     N++ L+L+
Sbjct  280  LKSVTINDCLQVGDKGIASLVSSASSSLERIRL-RTLNISDIALAVIGHYGKNVIDLSLT  338

Query  365  GLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             L  V + G   +V     GL K   ++++ C  +TD  + AIAK      +L     C 
Sbjct  339  ELQDVNEKGF--WVMGNTHGLQKLKSISINCCNGLTDTALQAIAKGSPFLKQLFVCKSC-  395

Query  536  CVTDASLAAIADYCSVLRDLDIS  604
             ++DA L A A     L  L + 
Sbjct  396  YLSDAGLIAFAGTAKALEGLHLE  418


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/206 (25%), Positives = 101/206 (49%), Gaps = 8/206 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L + K   ++D G+         +E L L +C  IS  G+  +      
Sbjct  194  AIARGCPSLRVLSMWKVPFVTDVGLSEIANGCPLLEKLDLCQCPLISDKGLIAV-AQKCP  252

Query  182  KLKALAFENCFGMKDLAFGVPALPPC-NSLRSLSICNCTGFGDASLVVLSRLCPNLV-HL  355
             L +L+ ++C  + +   G+ A+  C   L+S++I +C   GD  +  L     + +  +
Sbjct  253  DLTSLSIKSCSRIGN--EGLQAIGRCCPKLKSVTINDCLQVGDKGIASLVSSASSSLERI  310

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L  LN ++D  L   +      ++ ++L+   +V +K    +   HG + L+ +++N C
Sbjct  311  RLRTLN-ISDIAL-AVIGHYGKNVIDLSLTELQDVNEKGFWVMGNTHGLQKLKSISINCC  368

Query  533  GCVTDASLAAIADYCSVLRDLDISKS  610
              +TD +L AIA     L+ L + KS
Sbjct  369  NGLTDTALQAIAKGSPFLKQLFVCKS  394



>gb|EPS63879.1| f-box family protein, partial [Genlisea aurea]
Length=680

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHS-AG  181
            +++GCP++K   L  C  +SD G+++F  AA ++E+L+L +C+ I+  GVF +LV S A 
Sbjct  404  IAEGCPSLKLFALSNCPYVSDQGLITFSSAAGALENLRLNKCNSITLFGVFSMLVSSCAR  463

Query  182  KLKALAFENCFGMKDLAFG--VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
            ++KAL+ ENC G+KDL F   +P+     SLRSL+I +C  FGD  L V   +CP L HL
Sbjct  464  RVKALSIENCSGIKDLDFPLPIPSSSCRRSLRSLTIADCPHFGDIGLGVFGGICPGLTHL  523

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
             L+ L  +TD G+LP V+S   GLVKVNLSGC NVTD  I++IA+LHG+TLE+LNL+GC 
Sbjct  524  TLNDLPDITDAGILPLVRSSKIGLVKVNLSGCYNVTDDIIASIAELHGKTLEILNLDGCK  583

Query  536  CVTDASLAAIADYCSVLRDLDISKS  610
             +TD SLAAIA+ CSVL +LDIS S
Sbjct  584  SITDLSLAAIAENCSVLSELDISTS  608


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 77/156 (49%), Gaps = 5/156 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVS-FVKAAESIESLQLEECHRISQAGVFGILVHSA  178
            A+ + CPN+  + +R C L+ D G+ S F+ A   ++  +L+  + IS   +  I  +  
Sbjct  297  ALGRHCPNLNHIVIRSCPLIGDQGITSLFLSAGRILQKAKLQSLN-ISDVSLAVIGKYGT  355

Query  179  GKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL  355
            G +  L   +   +K+  F V         L+SLSI +C G  D  L V++  CP+L   
Sbjct  356  GMVD-LTLGDLHNVKEKGFWVMGKAQGLQMLKSLSISSCPGTSDFGLQVIAEGCPSLKLF  414

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
             LS    V+D GL+ F  +  A L  + L+ C ++T
Sbjct  415  ALSNCPYVSDQGLITFSSAAGA-LENLRLNKCNSIT  449


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 87/222 (39%), Gaps = 54/222 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A ++ CP++  L L   + ++D G+        S+E L+L  CH                
Sbjct  219  ATARSCPSLNVLSLSNVSSITDEGLCEIAHGCHSLEKLEL--CH----------------  260

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL--  355
                     C G+ D A  V     C SL+S+++  C   G+ SL  L R CPNL H+  
Sbjct  261  ---------CPGITDKAL-VEIASQCPSLKSVTLECCKNIGNESLKALGRHCPNLNHIVI  310

Query  356  ---NLSGLNGVTDYGL--------------------LPFVQSCDAGLVKVNLSGCINVTD  466
                L G  G+T   L                    L  +     G+V + L    NV +
Sbjct  311  RSCPLIGDQGITSLFLSAGRILQKAKLQSLNISDVSLAVIGKYGTGMVDLTLGDLHNVKE  370

Query  467  KTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLR  589
            K    + K  G + L+ L+++ C   +D  L  IA+ C  L+
Sbjct  371  KGFWVMGKAQGLQMLKSLSISSCPGTSDFGLQVIAEGCPSLK  412



>ref|XP_003563656.1| PREDICTED: EIN3-binding F-box protein 1 [Brachypodium distachyon]
 gb|ACF22741.1| EIN3-binding F-box protein [Brachypodium distachyon]
Length=642

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP+++QL LRKC+ LSD  +  F ++A+ +E+LQ+EEC+R++  G+   L++ + 
Sbjct  367  SIAKFCPSLRQLYLRKCSQLSDGLLKDFAESAKVLENLQIEECNRVTLMGILAFLLNCSP  426

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K KAL+   C G+KD+      LP C SLRSL+I +C GF DASL V+  +CP+L +++L
Sbjct  427  KFKALSLVKCIGIKDICSAPAQLPVCKSLRSLTIKDCPGFTDASLAVVGMICPHLENVDL  486

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP ++S ++GL+ V+L+GC N+TD +ISA+ K HG +L  L+L GC  +
Sbjct  487  SGLAAVTDNGLLPLIKSSESGLIHVDLNGCENLTDASISALVKAHGNSLTHLSLEGCSKI  546

Query  542  TDASLAAIADYCSVLRDLDIS  604
            +DASL AI++ C  L +LD+S
Sbjct  547  SDASLFAISESCCELAELDLS  567


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 104/206 (50%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP++++L +  C L++D G+ +  +    +++L +E C  ++  G+  I      K
Sbjct  210  IAAGCPSLEKLDITGCPLITDKGLAAVAQGCPELKTLTIEACSGVANEGLRAI-GRCCPK  268

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A+  +NC  + D   GV  L  C+S  SL+     G    DASL V+      + +LN
Sbjct  269  LQAVNIKNCAHVGDQ--GVSGL-ICSSTASLAKVCLQGLSITDASLAVIGYYGKAITNLN  325

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +   GL K   ++++ C  VT+  + +IAK    +L  L L  
Sbjct  326  LARLPMVGERGF--WVMANALGLQKLRCMSVTSCPGVTELALVSIAKFC-PSLRQLYLRK  382

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            C  ++D  L   A+   VL +L I +
Sbjct  383  CSQLSDGLLKDFAESAKVLENLQIEE  408


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 101/230 (44%), Gaps = 32/230 (14%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFV--------------------------KAAES  103
            A+ + CP ++ + ++ C  + D GV   +                             ++
Sbjct  261  AIGRCCPKLQAVNIKNCAHVGDQGVSGLICSSTASLAKVCLQGLSITDASLAVIGYYGKA  320

Query  104  IESLQLEECHRISQAGVFGILVHSAG--KLKALAFENCFGMKDLAFGVPALPPCNSLRSL  277
            I +L L     + + G F ++ ++ G  KL+ ++  +C G+ +LA  V     C SLR L
Sbjct  321  ITNLNLARLPMVGERG-FWVMANALGLQKLRCMSVTSCPGVTELAL-VSIAKFCPSLRQL  378

Query  278  SICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCIN  457
             +  C+   D  L   +     L +L +   N VT  G+L F+ +C      ++L  CI 
Sbjct  379  YLRKCSQLSDGLLKDFAESAKVLENLQIEECNRVTLMGILAFLLNCSPKFKALSLVKCIG  438

Query  458  VTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + D   SA A+L   ++L  L +  C   TDASLA +   C  L ++D+S
Sbjct  439  IKD-ICSAPAQLPVCKSLRSLTIKDCPGFTDASLAVVGMICPHLENVDLS  487


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 96/213 (45%), Gaps = 36/213 (17%)
 Frame = +2

Query  59   LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG--KLKALAFENCFGMKDLA  232
            ++D+G+ +  + + S+ SL L +  +++ AG+  I   +AG   L+ L    C  + D  
Sbjct  176  VTDSGLSAVARGSPSLRSLALWDVPQVTDAGLAEI---AAGCPSLEKLDITGCPLITDKG  232

Query  233  FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS  412
                A   C  L++L+I  C+G  +  L  + R CP L  +N+     V D G+   + S
Sbjct  233  LAAVA-QGCPELKTLTIEACSGVANEGLRAIGRCCPKLQAVNIKNCAHVGDQGVSGLICS  291

Query  413  CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL-----------------------  523
              A L KV L G +++TD +++ I   +G+ +  LNL                       
Sbjct  292  STASLAKVCLQG-LSITDASLAVIG-YYGKAITNLNLARLPMVGERGFWVMANALGLQKL  349

Query  524  -----NGCGCVTDASLAAIADYCSVLRDLDISK  607
                   C  VT+ +L +IA +C  LR L + K
Sbjct  350  RCMSVTSCPGVTELALVSIAKFCPSLRQLYLRK  382


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/192 (27%), Positives = 85/192 (44%), Gaps = 4/192 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E++ L     ++  G+  ++  S   L  +
Sbjct  452  CKSLRSLTIKDCPGFTDASLAVVGMICPHLENVDLSGLAAVTDNGLLPLIKSSESGLIHV  511

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D +         NSL  LS+  C+   DASL  +S  C  L  L+LS    
Sbjct  512  DLNGCENLTDASISALVKAHGNSLTHLSLEGCSKISDASLFAISESCCELAELDLSNCM-  570

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL--NGCGCVTDA  550
            V+DYG+     +    L  ++LSGC  VT K++  +  +   +LE LNL  N  G    A
Sbjct  571  VSDYGVAVLASAGQLKLRVLSLSGCFKVTQKSVPFLGSMP-VSLEGLNLQFNFIGNHNIA  629

Query  551  SLAAIADYCSVL  586
            SL     +C +L
Sbjct  630  SLEKQLWWCDIL  641



>gb|AFW66152.1| hypothetical protein ZEAMMB73_923849 [Zea mays]
Length=754

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CPN+KQL LRKC  +SD G+ +F ++A+  E+L LEEC+R+S  G+   L++   
Sbjct  478  SIAKFCPNLKQLYLRKCGYVSDAGLKAFTESAKVFENLHLEECNRVSLVGILAFLLNCRE  537

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   C G+KD+      LP C SLR L+I +C GF DASL  +  +CP L  ++L
Sbjct  538  KFRALSLVKCMGIKDICSAPAQLPLCRSLRFLTIKDCPGFTDASLAAVGMICPQLEQVDL  597

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP +QS +AGLVKV+LSGC N+TD  +S++ K HG++L+ +NL GC  +
Sbjct  598  SGLGEVTDNGLLPLIQSSEAGLVKVDLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKI  657

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDA L  +++ C+ L +L++S
Sbjct  658  TDAILFTMSESCTELAELNLS  678


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 108/206 (52%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP++++L + +C L++D G+V+  +   ++ SL +E C  ++  G+  I   S  K
Sbjct  321  IAAGCPSLERLDICRCPLITDKGLVAVAQGCPNLVSLTIEACPGVANEGLRAI-GRSCVK  379

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A+  +NC  + D   G+ +L  C++  +L+     G    DASL V+      +  L 
Sbjct  380  LQAVNIKNCPLVGDQ--GISSL-VCSATAALTKIRLQGLNITDASLAVIGYYGKAITDLT  436

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +  AGL     ++++ C  VTD  +++IAK     L+ L L  
Sbjct  437  LTRLAAVGERGF--WVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFC-PNLKQLYLRK  493

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            CG V+DA L A  +   V  +L + +
Sbjct  494  CGYVSDAGLKAFTESAKVFENLHLEE  519


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 82/183 (45%), Gaps = 30/183 (16%)
 Frame = +2

Query  59   LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG  238
            ++D G+ +  + + ++ SL L +   I+ AG                      + ++A G
Sbjct  287  VTDQGLSAVARGSPNLSSLALWDVPLITDAG----------------------LAEIAAG  324

Query  239  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD  418
                  C SL  L IC C    D  LV +++ CPNLV L +    GV + GL    +SC 
Sbjct  325  ------CPSLERLDICRCPLITDKGLVAVAQGCPNLVSLTIEACPGVANEGLRAIGRSC-  377

Query  419  AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD  598
              L  VN+  C  V D+ IS++       L  + L G   +TDASLA I  Y   + DL 
Sbjct  378  VKLQAVNIKNCPLVGDQGISSLVCSATAALTKIRLQGLN-ITDASLAVIGYYGKAITDLT  436

Query  599  ISK  607
            +++
Sbjct  437  LTR  439


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 106/254 (42%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCPN+  L +  C  +++ G+ +  ++   ++++ ++ C  +   G+  ++  +  
Sbjct  346  AVAQGCPNLVSLTIEACPGVANEGLRAIGRSCVKLQAVNIKNCPLVGDQGISSLVCSATA  405

Query  182  KLK------------ALAFENCFG--MKDL-----------AFGVPA-LPPCNSLRSLSI  283
             L             +LA    +G  + DL            F V A      +LR +S+
Sbjct  406  ALTKIRLQGLNITDASLAVIGYYGKAITDLTLTRLAAVGERGFWVMANAAGLQNLRCMSV  465

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D +L  +++ CPNL  L L     V+D GL  F +S                 
Sbjct  466  TSCPGVTDLALASIAKFCPNLKQLYLRKCGYVSDAGLKAFTESAKVFENLHLEECNRVSL  525

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAA  562
                     C      ++L  C+ + D   SA A+L    +L  L +  C   TDASLAA
Sbjct  526  VGILAFLLNCREKFRALSLVKCMGIKD-ICSAPAQLPLCRSLRFLTIKDCPGFTDASLAA  584

Query  563  IADYCSVLRDLDIS  604
            +   C  L  +D+S
Sbjct  585  VGMICPQLEQVDLS  598


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 90/193 (47%), Gaps = 5/193 (3%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  + +       +E + L     ++  G+  ++  S   L  +
Sbjct  563  CRSLRFLTIKDCPGFTDASLAAVGMICPQLEQVDLSGLGEVTDNGLLPLIQSSEAGLVKV  622

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D+A          SL+ +++  C+   DA L  +S  C  L  LNLS    
Sbjct  623  DLSGCKNITDVAVSSLVKGHGKSLKKINLEGCSKITDAILFTMSESCTELAELNLSNCM-  681

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            V+DYG+     +    L  ++LSGC  VT K++  +  L G+++E LNL  C  + + ++
Sbjct  682  VSDYGVAILASARHLKLRVLSLSGCSKVTQKSVLFLGNL-GQSIEGLNLQFCDMIGNHNI  740

Query  557  AAIAD---YCSVL  586
            A++     +C +L
Sbjct  741  ASLEKKLWWCDIL  753



>dbj|BAD35544.1| putative F-box protein Fbl2 [Oryza sativa Japonica Group]
 dbj|BAG89384.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP++KQL L+KC  +SD  +  F ++A+ +ESLQ+EEC++++  G+   L++ + 
Sbjct  352  SIAKFCPSLKQLNLKKCGQVSDGRLKDFAESAKVLESLQIEECNKVTLMGILAFLLNCSP  411

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K KAL+   C G+KD+      LP C SLRSL+I +C GF DASL V+  +CP L +++L
Sbjct  412  KFKALSLVKCNGIKDICSAPAQLPLCKSLRSLTIKDCPGFTDASLAVVGMICPQLENVDL  471

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP ++S ++GLV V+L+GC N+TD T+SA+ K HG +L  L+L GC  +
Sbjct  472  SGLGAVTDNGLLPLIKSSESGLVHVDLNGCENLTDATVSALVKAHGSSLARLSLEGCSRI  531

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL AI++ C+ L +LD+S
Sbjct  532  TDASLFAISEGCTDLAELDLS  552


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 58/253 (23%), Positives = 106/253 (42%), Gaps = 54/253 (21%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG-  181
            V +GCP++K + +  C  ++D G+ +  +    ++S+ ++ C  +   GV G++  +A  
Sbjct  221  VPQGCPDLKVVTVEACPGVADEGLKAIGRCCAKLQSVNIKNCAHVGDQGVSGLVCSAAAS  280

Query  182  ----KLKALAFENC-------FGMKDLAFGVPALPPC--------------NSLRSLSIC  286
                +L+ L+  +        +G       +  LP                  LR +S+ 
Sbjct  281  LAKVRLQGLSITDASLSVIGYYGKAITDLTLARLPAVGERGFWVMANALGLQKLRFMSVS  340

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTD--------------------------Y  388
            +C G  D +L  +++ CP+L  LNL     V+D                           
Sbjct  341  SCPGVTDLALASIAKFCPSLKQLNLKKCGQVSDGRLKDFAESAKVLESLQIEECNKVTLM  400

Query  389  GLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAI  565
            G+L F+ +C      ++L  C  + D   SA A+L   ++L  L +  C   TDASLA +
Sbjct  401  GILAFLLNCSPKFKALSLVKCNGIKD-ICSAPAQLPLCKSLRSLTIKDCPGFTDASLAVV  459

Query  566  ADYCSVLRDLDIS  604
               C  L ++D+S
Sbjct  460  GMICPQLENVDLS  472


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 86/192 (45%), Gaps = 4/192 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E++ L     ++  G+  ++  S   L  +
Sbjct  437  CKSLRSLTIKDCPGFTDASLAVVGMICPQLENVDLSGLGAVTDNGLLPLIKSSESGLVHV  496

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D           +SL  LS+  C+   DASL  +S  C +L  L+LS    
Sbjct  497  DLNGCENLTDATVSALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCM-  555

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL--NGCGCVTDA  550
            V+DYG+     +    L  ++LSGC+ VT K++  +  +   +LE LNL  N  G    A
Sbjct  556  VSDYGVAVLASARQLKLRVLSLSGCLKVTQKSVPFLGSMSA-SLEGLNLQFNFIGNHNIA  614

Query  551  SLAAIADYCSVL  586
            SL     +C +L
Sbjct  615  SLEKQLWWCDIL  626



>ref|XP_006287278.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
 gb|EOA20176.1| hypothetical protein CARUB_v10000473mg [Capsella rubella]
Length=621

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 139/204 (68%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+V+  K+A  +E+L+LEECHRI+Q G+ G L++S  
Sbjct  343  AVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALLLETLKLEECHRINQFGLLGFLMNSGL  402

Query  182  KLKALAFENCFGMKDLAFGVP-ALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            KLKA +  NC G+ D+    P   P C+SLRSLSI  C GFGDASL  L   C  L  + 
Sbjct  403  KLKAFSLANCLGISDINAESPLPAPSCSSLRSLSIRCCPGFGDASLAFLGNFCHQLQDVE  462

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            L GLNGVTD G+   +QS + GLVKVNLSGCINV+D T+SA++  HG TLE LNL+GC  
Sbjct  463  LCGLNGVTDAGVRELLQSNNVGLVKVNLSGCINVSDNTVSAVSVCHGHTLESLNLDGCKN  522

Query  539  VTDASLAAIADYCSVLRDLDISKS  610
            +TD SL A+A  C  + DLDIS +
Sbjct  523  ITDTSLVAVAKNCYSVNDLDISNT  546


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/255 (22%), Positives = 105/255 (41%), Gaps = 57/255 (22%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++ C N+  L +  C+ + + G+ +  +   ++ S+ +  C RI   GV         
Sbjct  211  AIAENCVNLSDLTIDSCSGVGNEGLRAIARRCTNLRSISIRSCPRIGDQGVAFLLAQAGS  270

Query  155  ----------------FGILVHSAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSI  283
                              +L H    +  L  +   G+ +  F V         L+SLS+
Sbjct  271  YLTRVKLQMLNVTGMSLAVLGHYGAAVTDLVLQGLQGVNEKGFWVMGNAKGLKKLKSLSV  330

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLS--------GL------------------NGVTD  385
             +C G  D  L  +   CP+L H++L+        GL                  + +  
Sbjct  331  VSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALLLETLKLEECHRINQ  390

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG---ETLELLNLNGCGCVTDASL  556
            +GLL F+ +    L   +L+ C+ ++D  I+A + L      +L  L++  C    DASL
Sbjct  391  FGLLGFLMNSGLKLKAFSLANCLGISD--INAESPLPAPSCSSLRSLSIRCCPGFGDASL  448

Query  557  AAIADYCSVLRDLDI  601
            A + ++C  L+D+++
Sbjct  449  AFLGNFCHQLQDVEL  463


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 2/99 (2%)
 Frame = +2

Query  305  DASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI  484
            DA L  ++  CP+L  L+L  L  V+D GL    +SC   + K++LS C  +TD  + AI
Sbjct  154  DAGLGAIAHGCPSLRVLSLWNLPAVSDMGLSEIARSCPM-IEKLDLSRCPGITDSALVAI  212

Query  485  AKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            A+ +   L  L ++ C  V +  L AIA  C+ LR + I
Sbjct  213  AE-NCVNLSDLTIDSCSGVGNEGLRAIARRCTNLRSISI  250



>gb|EAZ01599.1| hypothetical protein OsI_23635 [Oryza sativa Indica Group]
 gb|EAZ37582.1| hypothetical protein OsJ_21915 [Oryza sativa Japonica Group]
Length=664

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP++KQL L+KC  +SD  +  F ++A+ +ESLQ+EEC++++  G+   L++ + 
Sbjct  389  SIAKFCPSLKQLNLKKCGQVSDGRLKDFAESAKVLESLQIEECNKVTLMGILAFLLNCSP  448

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K KAL+   C G+KD+      LP C SLRSL+I +C GF DASL V+  +CP L +++L
Sbjct  449  KFKALSLVKCNGIKDICSAPAQLPLCKSLRSLTIKDCPGFTDASLAVVGMICPQLENVDL  508

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP ++S ++GLV V+L+GC N+TD T+SA+ K HG +L  L+L GC  +
Sbjct  509  SGLGAVTDNGLLPLIKSSESGLVHVDLNGCENLTDATVSALVKAHGSSLARLSLEGCSRI  568

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL AI++ C+ L +LD+S
Sbjct  569  TDASLFAISEGCTDLAELDLS  589


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 103/206 (50%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP++ +L +  C L++D G+ +  +    ++ + +E C  ++  G+  I      K
Sbjct  232  IAAGCPSLARLDITGCPLITDKGLAAIAQGCPDLKVVTVEACPGVADEGLKAI-GRCCAK  290

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+++  +NC  + D   GV  L  C++  SL+     G    DASL V+      +  L 
Sbjct  291  LQSVNIKNCAHVGDQ--GVSGL-VCSAAASLAKVRLQGLSITDASLSVIGYYGKAITDLT  347

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +   GL K   +++S C  VTD  +++IAK    +L+ LNL  
Sbjct  348  LARLPAVGERGF--WVMANALGLQKLRFMSVSSCPGVTDLALASIAKFC-PSLKQLNLKK  404

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            CG V+D  L   A+   VL  L I +
Sbjct  405  CGQVSDGRLKDFAESAKVLESLQIEE  430


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 86/192 (45%), Gaps = 4/192 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E++ L     ++  G+  ++  S   L  +
Sbjct  474  CKSLRSLTIKDCPGFTDASLAVVGMICPQLENVDLSGLGAVTDNGLLPLIKSSESGLVHV  533

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D           +SL  LS+  C+   DASL  +S  C +L  L+LS    
Sbjct  534  DLNGCENLTDATVSALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAELDLSNCM-  592

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL--NGCGCVTDA  550
            V+DYG+     +    L  ++LSGC+ VT K++  +  +   +LE LNL  N  G    A
Sbjct  593  VSDYGVAVLASARQLKLRVLSLSGCLKVTQKSVPFLGSMSA-SLEGLNLQFNFIGNHNIA  651

Query  551  SLAAIADYCSVL  586
            SL     +C +L
Sbjct  652  SLEKQLWWCDIL  663


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 62/142 (44%), Gaps = 26/142 (18%)
 Frame = +2

Query  257  CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD------  418
            C SL SL++ +     DA L  ++  CP+L  L+++G   +TD GL    Q C       
Sbjct  210  CPSLLSLALWHVPQVTDAGLAEIAAGCPSLARLDITGCPLITDKGLAAIAQGCPDLKVVT  269

Query  419  -------------------AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                               A L  VN+  C +V D+ +S +      +L  + L G   +
Sbjct  270  VEACPGVADEGLKAIGRCCAKLQSVNIKNCAHVGDQGVSGLVCSAAASLAKVRLQGLS-I  328

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL+ I  Y   + DL +++
Sbjct  329  TDASLSVIGYYGKAITDLTLAR  350



>ref|NP_197917.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 sp|Q708Y0.1|EBF2_ARATH RecName: Full=EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 gb|AAR27072.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
 emb|CAE75865.1| F-box protein [Arabidopsis thaliana]
 dbj|BAE99835.1| leucine-rich repeats containing protein [Arabidopsis thaliana]
 gb|AED93429.1| EIN3-binding F-box protein 2 [Arabidopsis thaliana]
Length=623

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 139/204 (68%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+V+  K+A S+ESL+LEECHRI+Q G+ G L++   
Sbjct  345  AVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQFGLMGFLMNCGS  404

Query  182  KLKALAFENCFGMKDL-AFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            KLKA +  NC G+ D  +      P C+SLRSLSI  C GFGDASL  L + C  L  + 
Sbjct  405  KLKAFSLANCLGISDFNSESSLPSPSCSSLRSLSIRCCPGFGDASLAFLGKFCHQLQDVE  464

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            L GLNGVTD G+   +QS + GLVKVNLS CINV+D T+SAI+  HG TLE LNL+GC  
Sbjct  465  LCGLNGVTDAGVRELLQSNNVGLVKVNLSECINVSDNTVSAISVCHGRTLESLNLDGCKN  524

Query  539  VTDASLAAIADYCSVLRDLDISKS  610
            +T+ASL A+A  C  + DLDIS +
Sbjct  525  ITNASLVAVAKNCYSVNDLDISNT  548


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/253 (21%), Positives = 104/253 (41%), Gaps = 53/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++ C N+  L +  C+ + + G+ +  +   ++ S+ +  C RI   GV         
Sbjct  213  AIAENCVNLSDLTIDSCSGVGNEGLRAIARRCVNLRSISIRSCPRIGDQGVAFLLAQAGS  272

Query  155  ----------------FGILVHSAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSI  283
                              ++ H    +  L      G+ +  F V         L+SLS+
Sbjct  273  YLTKVKLQMLNVSGLSLAVIGHYGAAVTDLVLHGLQGVNEKGFWVMGNAKGLKKLKSLSV  332

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLS--------GL------------------NGVTD  385
             +C G  D  L  +   CP+L H++L+        GL                  + +  
Sbjct  333  MSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQ  392

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTD-KTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
            +GL+ F+ +C + L   +L+ C+ ++D  + S++      +L  L++  C    DASLA 
Sbjct  393  FGLMGFLMNCGSKLKAFSLANCLGISDFNSESSLPSPSCSSLRSLSIRCCPGFGDASLAF  452

Query  563  IADYCSVLRDLDI  601
            +  +C  L+D+++
Sbjct  453  LGKFCHQLQDVEL  465



>gb|ABK25485.1| unknown [Picea sitchensis]
Length=535

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 129/202 (64%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ +GCP+VK +  RKC  LSD G+ +F K A S+ESLQLEEC+ IS  G+   L   +G
Sbjct  259  SIGQGCPSVKLVSFRKCEFLSDKGLKAFTKVAISLESLQLEECNMISHLGLIDALGSCSG  318

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK L    C G+K+   G   +P C SL+SLSI +C   G+  L +L R CP +  ++ 
Sbjct  319  KLKVLTLVKCTGIKESGLGEVPVPTCESLKSLSIRSCPSLGNGCLALLGRACPQVQSIDF  378

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL G++D GL     SC   LVK+NLSGCI VTD+ +  I  L G+TL  LNL GC  V
Sbjct  379  SGLAGISDDGLFALFGSCKTSLVKLNLSGCIEVTDRAVFVIVNLFGKTLLSLNLEGCRKV  438

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TD SL  IA YC++L++LDISK
Sbjct  439  TDQSLGFIAHYCAILQELDISK  460


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 86/186 (46%), Gaps = 2/186 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C ++K L +R C  L +  +    +A   ++S+       IS  G+F +       L  L
Sbjct  344  CESLKSLSIRSCPSLGNGCLALLGRACPQVQSIDFSGLAGISDDGLFALFGSCKTSLVKL  403

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A  V       +L SL++  C    D SL  ++  C  L  L++S   G
Sbjct  404  NLSGCIEVTDRAVFVIVNLFGKTLLSLNLEGCRKVTDQSLGFIAHYCAILQELDISKC-G  462

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            +TD GL+    +    L  ++LSGC+ +TDK +  I K+ GETL  LNL  C  ++  + 
Sbjct  463  ITDNGLVSLASAASYCLQILSLSGCMQITDKGLPFIGKI-GETLIGLNLQQCRGISSRAR  521

Query  557  AAIADY  574
              +A +
Sbjct  522  DLLATH  527



>emb|CDX80503.1| BnaC07g29410D [Brassica napus]
Length=621

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 139/203 (68%), Gaps = 2/203 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K +CL KC L+S  G+V+  K+A S+ESL+LEECHR++Q G  G L++   
Sbjct  346  AVGNGCPDLKHVCLNKCLLVSGKGLVALAKSASSLESLKLEECHRVNQFGFLGFLMNCGS  405

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             +K+ +  NC G+ +     P+   C+SLRSLSI +C GFGDASL  L +LC  L  + L
Sbjct  406  TMKSFSMANCLGISEAPL--PSSTSCSSLRSLSIRHCPGFGDASLSFLGKLCHQLQDIEL  463

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GLNGVTD G+   VQS   GLVKVNLSGCINV+D  +SAI+  HG TLE LN++GC  +
Sbjct  464  CGLNGVTDAGVFELVQSNSVGLVKVNLSGCINVSDNAVSAISVCHGRTLESLNVDGCKNI  523

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDASL A+A  C  + DLD+S +
Sbjct  524  TDASLVAVAKNCYSVNDLDVSNT  546


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 100/207 (48%), Gaps = 14/207 (7%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++ CP +++L L +C  ++D G+V+  +  +++  L ++ C  +   G+  +     G 
Sbjct  189  IARSCPLIEKLDLSRCPGITDKGLVAIAENCKNLSELTIDSCSGVGNEGLRAV-ARGCGN  247

Query  185  LKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            L++++ ++C   G + ++F +       +   L + N TG    SL VL      +  L 
Sbjct  248  LRSISIKSCPRIGDQGVSFLLAQAGSYLTKVKLQMVNVTGL---SLAVLGHYGSGVTDLV  304

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHG-ETLELLNLN  526
            L GL GV + G   +V     G+ K   ++++ C  +TD  + A+   +G   L+ + LN
Sbjct  305  LHGLQGVNEKGF--WVMGNAKGMKKLKSLSVTSCRGMTDVGLEAVG--NGCPDLKHVCLN  360

Query  527  GCGCVTDASLAAIADYCSVLRDLDISK  607
             C  V+   L A+A   S L  L + +
Sbjct  361  KCLLVSGKGLVALAKSASSLESLKLEE  387


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 90/179 (50%), Gaps = 3/179 (2%)
 Frame = +2

Query  41   LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM  220
            +R C    D  +    K    ++ ++L   + ++ AGVF ++  ++  L  +    C  +
Sbjct  437  IRHCPGFGDASLSFLGKLCHQLQDIELCGLNGVTDAGVFELVQSNSVGLVKVNLSGCINV  496

Query  221  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP  400
             D A    ++    +L SL++  C    DASLV +++ C ++  L++S    V+D G+  
Sbjct  497  SDNAVSAISVCHGRTLESLNVDGCKNITDASLVAVAKNCYSVNDLDVSN-TLVSDQGVKA  555

Query  401  FVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADY  574
               S +   L  +++ GC  +TDK+ + I KL G TL  LN+  CG ++ +++  + ++
Sbjct  556  LASSPNHLNLQVLSVGGCSAITDKSKACIQKL-GRTLLGLNIQRCGRISSSTVDNLLEH  613


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/252 (19%), Positives = 98/252 (39%), Gaps = 54/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            A+++ C N+ +L +  C+ + + G+ +  +   ++ S+ ++ C RI   GV         
Sbjct  214  AIAENCKNLSELTIDSCSGVGNEGLRAVARGCGNLRSISIKSCPRIGDQGVSFLLAQAGS  273

Query  155  ----------------FGILVHSAGKLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSI  283
                              +L H    +  L      G+ +  F V         L+SLS+
Sbjct  274  YLTKVKLQMVNVTGLSLAVLGHYGSGVTDLVLHGLQGVNEKGFWVMGNAKGMKKLKSLSV  333

Query  284  CNCTGFGDASLVVLSRLCPNLVH--------------------------LNLSGLNGVTD  385
             +C G  D  L  +   CP+L H                          L L   + V  
Sbjct  334  TSCRGMTDVGLEAVGNGCPDLKHVCLNKCLLVSGKGLVALAKSASSLESLKLEECHRVNQ  393

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G L F+ +C + +   +++ C+ +++  + +       +L  L++  C    DASL+ +
Sbjct  394  FGFLGFLMNCGSTMKSFSMANCLGISEAPLPSSTSC--SSLRSLSIRHCPGFGDASLSFL  451

Query  566  ADYCSVLRDLDI  601
               C  L+D+++
Sbjct  452  GKLCHQLQDIEL  463



>gb|ACR35519.1| unknown [Zea mays]
Length=520

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 144/201 (72%), Gaps = 2/201 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP++K+L LRKC  +SD G+ +F ++A+  E+LQLEEC+R++  G+   L + + 
Sbjct  246  SIAKFCPSLKKLYLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVTLVGILAFL-NCSQ  304

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   C G+KD+   VP LP C SLR L+I +C GF +ASL V+  +CP L  ++L
Sbjct  305  KFRALSLVKCMGIKDIC-SVPQLPFCRSLRFLTIKDCPGFTNASLAVVGMICPQLEQVDL  363

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP +QS ++GL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +
Sbjct  364  SGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKI  423

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL  +++ C+ L +LD+S
Sbjct  424  TDASLFTMSESCTELAELDLS  444


 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 107/206 (52%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L + +C L++D G+ +F +    + SL +E C  +   G+  I   S  K
Sbjct  89   IAAGCPLLERLDISRCPLITDKGLAAFAQGCPDLVSLTIEACSSVGDEGLRAI-GRSCMK  147

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A+  +NC  + D   G+ +L  C++  SL+     G    DASL V+      +  L+
Sbjct  148  LQAVNIKNCPLVGDQ--GISSL-VCSATASLAKIRLQGLNITDASLAVIGYYGKAITDLS  204

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +  AGL     ++++ C  VTD  +++IAK    +L+ L L  
Sbjct  205  LTRLATVGERGF--WVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFC-PSLKKLYLRK  261

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            CG V+DA L A  +   V  +L + +
Sbjct  262  CGHVSDAGLKAFTESAKVFENLQLEE  287


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 92/194 (47%), Gaps = 33/194 (17%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAES-IESLQLEECHRISQAGVFGILVHSAGKLKA  193
            CP ++Q+ L     ++DNG++  ++++ES +  + L  C  I+   V   LV   GK   
Sbjct  355  CPQLEQVDLSGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSS-LVKRHGK---  410

Query  194  LAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN  373
                                   SL+ +S+  C+   DASL  +S  C  L  L+LS   
Sbjct  411  -----------------------SLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCM  447

Query  374  GVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  553
             V+DYG+     +    L  ++LSGC  VT K++  +  L G++LE LNL  C  + + +
Sbjct  448  -VSDYGVAMLASARHLKLRVLSLSGCSKVTQKSVPFLGNL-GQSLEGLNLQFCNMIGNHN  505

Query  554  LAAIAD---YCSVL  586
            +A++     +C +L
Sbjct  506  IASLEKKLWWCDIL  519


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/253 (22%), Positives = 105/253 (42%), Gaps = 54/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A ++GCP++  L +  C+ + D G+ +  ++   ++++ ++ C  +   G+  ++  +  
Sbjct  114  AFAQGCPDLVSLTIEACSSVGDEGLRAIGRSCMKLQAVNIKNCPLVGDQGISSLVCSATA  173

Query  182  KL------------KALAFENCFG--MKDLA-----------FGVPA-LPPCNSLRSLSI  283
             L             +LA    +G  + DL+           F V A      +LR +S+
Sbjct  174  SLAKIRLQGLNITDASLAVIGYYGKAITDLSLTRLATVGERGFWVMANAAGLQNLRCMSV  233

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D +L  +++ CP+L  L L     V+D GL  F +S                 
Sbjct  234  TSCPGVTDLALASIAKFCPSLKKLYLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVTL  293

Query  413  --------CDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAI  565
                    C      ++L  C+ + D  I ++ +L    +L  L +  C   T+ASLA +
Sbjct  294  VGILAFLNCSQKFRALSLVKCMGIKD--ICSVPQLPFCRSLRFLTIKDCPGFTNASLAVV  351

Query  566  ADYCSVLRDLDIS  604
               C  L  +D+S
Sbjct  352  GMICPQLEQVDLS  364



>gb|KCW80001.1| hypothetical protein EUGRSUZ_C01334 [Eucalyptus grandis]
Length=584

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 143/238 (60%), Gaps = 36/238 (15%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNG------------------------------------  73
            A+ + CP ++ + ++ C L+ D+G                                    
Sbjct  272  AIGRCCPRLQSISIKDCPLVGDHGVASLVSSASSVLSKIKLQGLNITDFSLAVIGHFGLA  331

Query  74   VVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALP  253
            V +F  A  S+E LQ+EE  RIS  GV G++ +   KLK+L+   C G+KDL  G   L 
Sbjct  332  VTTFSGAVSSLEYLQVEELDRISMRGVIGVISNCEMKLKSLSIAKCMGIKDLLEGSLMLS  391

Query  254  PCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVK  433
             C SLRSLSI NC GFG ASL ++ +LCP+L H++L  L G+TD GL P +++ +AGLVK
Sbjct  392  SCTSLRSLSIRNCPGFGSASLAMVGKLCPHLEHIDLISLCGLTDAGLSPLLENSEAGLVK  451

Query  434  VNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            VNLS C+N+TD+ +S + +LHG TLELLNL+GC  V+DASL AIAD C +L DLD+SK
Sbjct  452  VNLSNCLNITDEAVSTLVRLHGGTLELLNLDGCRKVSDASLVAIADNCLLLNDLDMSK  509


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 76/164 (46%), Gaps = 29/164 (18%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP+++ L L   + + D+G+V   K    ++ L L +C  +S  G+  I      
Sbjct  194  AIARGCPSLRALSLWNLSSIGDDGLVEIAKECRLLKKLDLSQCPFVSNKGLIAI------  247

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                   ENC   +DL              SL+I +C   G+  L  + R CP L  +++
Sbjct  248  ------AENC---RDLI-------------SLNIESCPKIGNEGLEAIGRCCPRLQSISI  285

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL  493
                 V D+G+   V S  + L K+ L G +N+TD +++ I   
Sbjct  286  KDCPLVGDHGVASLVSSASSVLSKIKLQG-LNITDFSLAVIGHF  328



>ref|XP_002437255.1| hypothetical protein SORBIDRAFT_10g023670 [Sorghum bicolor]
 gb|EER88622.1| hypothetical protein SORBIDRAFT_10g023670 [Sorghum bicolor]
Length=303

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 138/201 (69%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V+K  P++K + L+KC+ +SD  +  F ++++ +E+LQ+EEC +++  G+   L + + 
Sbjct  28   SVAKFSPSLKLVNLKKCSKVSDGCLKDFAESSKVLENLQIEECSKVTLMGILAFLPNCSP  87

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K KAL+   C G+KD+      LP C SLRSL+I +C GF DASL V+  +CP L ++NL
Sbjct  88   KFKALSLSKCIGIKDICSAPAQLPVCKSLRSLTIKDCPGFTDASLAVVGMICPQLENVNL  147

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD G LP ++S ++GLV V+L+GC N+TD  +SA+ K HG +L  L+L GC  +
Sbjct  148  SGLGAVTDNGFLPLLKSSESGLVNVDLNGCENLTDAAVSALVKAHGASLAHLSLEGCSKI  207

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL AI++ CS L +LD+S
Sbjct  208  TDASLFAISESCSQLAELDLS  228


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 83/192 (43%), Gaps = 4/192 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E++ L     ++  G   +L  S   L  +
Sbjct  113  CKSLRSLTIKDCPGFTDASLAVVGMICPQLENVNLSGLGAVTDNGFLPLLKSSESGLVNV  172

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A          SL  LS+  C+   DASL  +S  C  L  L+LS    
Sbjct  173  DLNGCENLTDAAVSALVKAHGASLAHLSLEGCSKITDASLFAISESCSQLAELDLSNCM-  231

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL--NGCGCVTDA  550
            V+DYG+     +    L  ++LSGC+ VT K++  +  +   +LE LNL  N  G    A
Sbjct  232  VSDYGVAVLAAAKQLKLRILSLSGCMKVTQKSVPFLGSMS-SSLEGLNLQFNFIGNRNIA  290

Query  551  SLAAIADYCSVL  586
            SL      C +L
Sbjct  291  SLEKQLWRCDIL  302



>ref|XP_008681226.1| PREDICTED: F-box family member isoform X1 [Zea mays]
 gb|AFW70693.1| F-box family member [Zea mays]
Length=643

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 144/201 (72%), Gaps = 2/201 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K CP++K+L LRKC  +SD G+ +F ++A+  E+LQLEEC+R++  G+   L + + 
Sbjct  369  SIAKFCPSLKKLYLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVTLVGILAFL-NCSQ  427

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K +AL+   C G+KD+   VP LP C SLR L+I +C GF +ASL V+  +CP L  ++L
Sbjct  428  KFRALSLVKCMGIKDIC-SVPQLPFCRSLRFLTIKDCPGFTNASLAVVGMICPQLEQVDL  486

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP +QS ++GL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +
Sbjct  487  SGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKI  546

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL  +++ C+ L +LD+S
Sbjct  547  TDASLFTMSESCTELAELDLS  567


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/206 (30%), Positives = 107/206 (52%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L + +C L++D G+ +F +    + SL +E C  +   G+  I   S  K
Sbjct  212  IAAGCPLLERLDISRCPLITDKGLAAFAQGCPDLVSLTIEACSSVGDEGLRAI-GRSCMK  270

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A+  +NC  + D   G+ +L  C++  SL+     G    DASL V+      +  L+
Sbjct  271  LQAVNIKNCPLVGDQ--GISSL-VCSATASLAKIRLQGLNITDASLAVIGYYGKAITDLS  327

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +  AGL     ++++ C  VTD  +++IAK    +L+ L L  
Sbjct  328  LTRLATVGERGF--WVMANAAGLQNLRCMSVTSCPGVTDLALASIAKFC-PSLKKLYLRK  384

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            CG V+DA L A  +   V  +L + +
Sbjct  385  CGHVSDAGLKAFTESAKVFENLQLEE  410


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 92/194 (47%), Gaps = 33/194 (17%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAES-IESLQLEECHRISQAGVFGILVHSAGKLKA  193
            CP ++Q+ L     ++DNG++  ++++ES +  + L  C  I+   V   LV   GK   
Sbjct  478  CPQLEQVDLSGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSS-LVKRHGK---  533

Query  194  LAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN  373
                                   SL+ +S+  C+   DASL  +S  C  L  L+LS   
Sbjct  534  -----------------------SLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCM  570

Query  374  GVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  553
             V+DYG+     +    L  ++LSGC  VT K++  +  L G++LE LNL  C  + + +
Sbjct  571  -VSDYGVAMLASARHLKLRVLSLSGCSKVTQKSVPFLGNL-GQSLEGLNLQFCNMIGNHN  628

Query  554  LAAIAD---YCSVL  586
            +A++     +C +L
Sbjct  629  IASLEKKLWWCDIL  642


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/253 (22%), Positives = 105/253 (42%), Gaps = 54/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A ++GCP++  L +  C+ + D G+ +  ++   ++++ ++ C  +   G+  ++  +  
Sbjct  237  AFAQGCPDLVSLTIEACSSVGDEGLRAIGRSCMKLQAVNIKNCPLVGDQGISSLVCSATA  296

Query  182  KL------------KALAFENCFG--MKDLA-----------FGVPA-LPPCNSLRSLSI  283
             L             +LA    +G  + DL+           F V A      +LR +S+
Sbjct  297  SLAKIRLQGLNITDASLAVIGYYGKAITDLSLTRLATVGERGFWVMANAAGLQNLRCMSV  356

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D +L  +++ CP+L  L L     V+D GL  F +S                 
Sbjct  357  TSCPGVTDLALASIAKFCPSLKKLYLRKCGHVSDAGLKAFTESAKVFENLQLEECNRVTL  416

Query  413  --------CDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAI  565
                    C      ++L  C+ + D  I ++ +L    +L  L +  C   T+ASLA +
Sbjct  417  VGILAFLNCSQKFRALSLVKCMGIKD--ICSVPQLPFCRSLRFLTIKDCPGFTNASLAVV  474

Query  566  ADYCSVLRDLDIS  604
               C  L  +D+S
Sbjct  475  GMICPQLEQVDLS  487



>ref|NP_001046222.1| Os02g0200900 [Oryza sativa Japonica Group]
 dbj|BAD15850.1| putative F-box protein [Oryza sativa Japonica Group]
 dbj|BAF08136.1| Os02g0200900 [Oryza sativa Japonica Group]
Length=511

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 138/202 (68%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++K CP+++QL  RKC  ++D G+ +F ++A  +ESLQLEEC+ ++  G+   LV+   
Sbjct  235  AIAKFCPSLRQLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVTLVGILDFLVNCGP  294

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K ++L+   C G+KD+      LP C SL+ L+I +C  F DASL V+  +CP L  ++L
Sbjct  295  KFRSLSLVKCMGIKDICSTPAQLPLCKSLQFLTIKDCPDFTDASLAVVGMVCPYLEQVDL  354

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP + S + GLVKV+LSGC N+TD  +S + K HG++L+ ++L GC  +
Sbjct  355  SGLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSTLVKGHGKSLKQVSLEGCSKI  414

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AI++ C+ L +LD+SK
Sbjct  415  TDASLFAISENCTELAELDLSK  436


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 103/254 (41%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV---------  154
            AV+ GCPN+  L +  C+ + ++G+ +  ++   I++L ++ C RI   G+         
Sbjct  103  AVAHGCPNLLSLTVESCSGVGNDGLRAIGRSCSKIQALNIKNCARIGDQGISSLVCSATA  162

Query  155  ------------------------------------------FGILVHSAG--KLKALAF  202
                                                      F ++ ++AG   L+ ++ 
Sbjct  163  SLTKIRLQGLNITDASLALIGYYGKAVTDLTLVRLPVVAERGFWVMANAAGLQNLRCMSV  222

Query  203  ENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVT  382
             +C G+ +LA    A   C SLR LS   C    DA L   +     L  L L   NGVT
Sbjct  223  TSCPGVTNLALAAIA-KFCPSLRQLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVT  281

Query  383  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
              G+L F+ +C      ++L  C+ + D   +       ++L+ L +  C   TDASLA 
Sbjct  282  LVGILDFLVNCGPKFRSLSLVKCMGIKDICSTPAQLPLCKSLQFLTIKDCPDFTDASLAV  341

Query  563  IADYCSVLRDLDIS  604
            +   C  L  +D+S
Sbjct  342  VGMVCPYLEQVDLS  355


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 91/226 (40%), Gaps = 56/226 (25%)
 Frame = +2

Query  11   KGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLK  190
            +G PN+  L L    L++D G+        S+E L +  C  I+  G+  +         
Sbjct  54   RGSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITRCPLITDKGLAAV---------  104

Query  191  ALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGL  370
                         A G P      +L SL++ +C+G G+  L  + R C  +  LN+   
Sbjct  105  -------------AHGCP------NLLSLTVESCSGVGNDGLRAIGRSCSKIQALNIKNC  145

Query  371  NGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI----------------------  484
              + D G+   V S  A L K+ L G +N+TD +++ I                      
Sbjct  146  ARIGDQGISSLVCSATASLTKIRLQG-LNITDASLALIGYYGKAVTDLTLVRLPVVAERG  204

Query  485  ----AKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                A   G + L  +++  C  VT+ +LAAIA +C  LR L   K
Sbjct  205  FWVMANAAGLQNLRCMSVTSCPGVTNLALAAIAKFCPSLRQLSFRK  250



>gb|AEK81539.1| EIN3 binding F-box 1 [Dianthus caryophyllus]
Length=625

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC  +KQ+ LR C+LLSDNG+ +F  +A S+ES+ LE C+ I+ +G+  +L + + 
Sbjct  348  ALGKGCSILKQISLRNCSLLSDNGLSAFSNSALSLESMHLEHCNAITLSGLKSMLSNCSS  407

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K ++L+   C G+KD+A       PC SLRSLSI NC  FG ASL +L ++CPNL  ++L
Sbjct  408  KFRSLSLVKCMGLKDIAIENNLQNPCVSLRSLSIKNCPAFGSASLEILGKMCPNLRQVDL  467

Query  362  SGLNGVTDYGLLPFVQSCDAGLV-KVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            +GL G+TD G+L  +++C  G++ K+NL+ CIN++D ++ AI +LHGE+++ L+L+GC  
Sbjct  468  TGLYGMTDDGILALLENCQPGIITKLNLNSCINLSDASVLAIVRLHGESVKELSLDGCRK  527

Query  539  VTDASLAAIADYCSVLRDLDIS  604
            +TD SL AIA  C +L DLD+S
Sbjct  528  ITDTSLFAIAGNCPLLNDLDVS  549


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 98/206 (48%), Gaps = 15/206 (7%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP++K L +   + +SD G+V        +E L L  C  I+  G+  I      
Sbjct  165  AVARGCPSLKSLSIWNVSSVSDEGLVEIANECNLLERLDLCLCPSITNKGLIAI-AERCP  223

Query  182  KLKALAFENCF-----GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNL  346
             L +L+ E+C      GM+ +A G P       L S+ I +C   GD ++  L  L   L
Sbjct  224  NLVSLSVESCPNIGNDGMQAIAQGCPK------LESILIKDCPLVGDQAVASLLSLLTAL  277

Query  347  VHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNL  523
              + L  LN ++++  L  +      +  + LS   NV++K    +    G ++L  L++
Sbjct  278  SKVKLQSLN-ISEFS-LAVIGHYGKSVTNLTLSNLRNVSEKGFWVMGNAQGLKSLVSLSI  335

Query  524  NGCGCVTDASLAAIADYCSVLRDLDI  601
            + C  VT  SL A+   CS+L+ + +
Sbjct  336  SSCLGVTGLSLEALGKGCSILKQISL  361



>emb|CBI28209.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 143/217 (66%), Gaps = 28/217 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGCPN+KQ+CLRKC  +SDNG+++F KAA S+E LQLEEC+R++Q GV G L +   
Sbjct  322  AMGKGCPNLKQMCLRKCCFVSDNGLIAFAKAAGSLEGLQLEECNRVTQLGVIGSLSNCGS  381

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+L+   C G+KD+A G P L PC+SLRSLSI NC GFG ASL ++ +LCP L H++L
Sbjct  382  KLKSLSLVKCMGIKDIAVGTPMLSPCHSLRSLSIRNCPGFGSASLAMVGKLCPQLHHVDL  441

Query  362  SGLNGVTDYGLLPFVQS----------------CDAGLV------KVNL-----SGCINV  460
            SGL+G+TD GLLP ++S                 D+G+       K+NL     SGC  V
Sbjct  442  SGLDGMTDAGLLPLLESYNCLLLNDLDLSKCAITDSGIAALSCGEKLNLQILSVSGCSKV  501

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD  571
            ++K++ ++ KL G+TL  LNL  C  ++ +S+  + +
Sbjct  502  SNKSMPSLCKL-GKTLLGLNLQHCNKISSSSVELLME  537


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 93/228 (41%), Gaps = 28/228 (12%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+   CP ++ + ++ C L+ D GV   + +A SI S    +   I+      ++ H   
Sbjct  216  AIGSLCPKLQSISIKDCPLVGDQGVAGLLSSATSILSRVKLQSLNITDFS-LAVVGHYGK  274

Query  182  KLKALAFENCFGMKDLAFGVPA-LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHL-  355
             + +L       + +  F V        +L SL+I +C G  D SL  + + CPNL  + 
Sbjct  275  AITSLTLSGLQNVSEKGFWVMGNAMGLQTLISLTITSCRGITDVSLEAMGKGCPNLKQMC  334

Query  356  --------------------NLSGL-----NGVTDYGLLPFVQSCDAGLVKVNLSGCINV  460
                                +L GL     N VT  G++  + +C + L  ++L  C+ +
Sbjct  335  LRKCCFVSDNGLIAFAKAAGSLEGLQLEECNRVTQLGVIGSLSNCGSKLKSLSLVKCMGI  394

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             D  +         +L  L++  C     ASLA +   C  L  +D+S
Sbjct  395  KDIAVGTPMLSPCHSLRSLSIRNCPGFGSASLAMVGKLCPQLHHVDLS  442



>dbj|BAD15849.1| putative F-box protein [Oryza sativa Japonica Group]
 gb|EAZ22129.1| hypothetical protein OsJ_05792 [Oryza sativa Japonica Group]
Length=660

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 138/202 (68%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++K CP+++QL  RKC  ++D G+ +F ++A  +ESLQLEEC+ ++  G+   LV+   
Sbjct  384  AIAKFCPSLRQLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVTLVGILDFLVNCGP  443

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K ++L+   C G+KD+      LP C SL+ L+I +C  F DASL V+  +CP L  ++L
Sbjct  444  KFRSLSLVKCMGIKDICSTPAQLPLCKSLQFLTIKDCPDFTDASLAVVGMVCPYLEQVDL  503

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD GLLP + S + GLVKV+LSGC N+TD  +S + K HG++L+ ++L GC  +
Sbjct  504  SGLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSTLVKGHGKSLKQVSLEGCSKI  563

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AI++ C+ L +LD+SK
Sbjct  564  TDASLFAISENCTELAELDLSK  585


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 57/253 (23%), Positives = 106/253 (42%), Gaps = 52/253 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCPN+  L +  C+ + ++G+ +  ++   I++L ++ C RI   G+  ++  +  
Sbjct  252  AVAHGCPNLLSLTVESCSGVGNDGLRAIGRSCSKIQALNIKNCARIGDQGISSLVCSATA  311

Query  182  KLK------------ALAFENCFGMKDLAFGVPALPPC--------------NSLRSLSI  283
             L             +LA    +G       +  LP                 +LR +S+
Sbjct  312  SLTKIRLQGLNITDASLALIGYYGKAVTDLTLVRLPVVAERGFWVMANAAGLQNLRCMSV  371

Query  284  CNCTGFGDASLVVLSRLCPNLV--------HLNLSGL------------------NGVTD  385
             +C G  + +L  +++ CP+L         H+  +GL                  NGVT 
Sbjct  372  TSCPGVTNLALAAIAKFCPSLRQLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVTL  431

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
             G+L F+ +C      ++L  C+ + D   +       ++L+ L +  C   TDASLA +
Sbjct  432  VGILDFLVNCGPKFRSLSLVKCMGIKDICSTPAQLPLCKSLQFLTIKDCPDFTDASLAVV  491

Query  566  ADYCSVLRDLDIS  604
               C  L  +D+S
Sbjct  492  GMVCPYLEQVDLS  504


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 56/229 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++G PN+  L L    L++D G+        S+E L +  C  I+  G+  +      
Sbjct  200  AVARGSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITRCPLITDKGLAAV------  253

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                            A G      C +L SL++ +C+G G+  L  + R C  +  LN+
Sbjct  254  ----------------AHG------CPNLLSLTVESCSGVGNDGLRAIGRSCSKIQALNI  291

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI-------------------  484
                 + D G+   V S  A L K+ L G +N+TD +++ I                   
Sbjct  292  KNCARIGDQGISSLVCSATASLTKIRLQG-LNITDASLALIGYYGKAVTDLTLVRLPVVA  350

Query  485  -------AKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                   A   G + L  +++  C  VT+ +LAAIA +C  LR L   K
Sbjct  351  ERGFWVMANAAGLQNLRCMSVTSCPGVTNLALAAIAKFCPSLRQLSFRK  399



>gb|EMT19526.1| hypothetical protein F775_07091 [Aegilops tauschii]
Length=939

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 140/200 (70%), Gaps = 0/200 (0%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++K CP +KQLCLRKC  +SD G+ +F ++A+ +E+LQLEEC+R++  GV   L++ + K
Sbjct  665  IAKFCPGLKQLCLRKCGHVSDAGLKAFTESAKVMENLQLEECNRVTLVGVLACLINCSQK  724

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
             +AL+   C G+KD+      LP C SLR L+I +C GF DASL V+  +CP L  ++LS
Sbjct  725  FRALSLVKCTGVKDVCSAPAQLPVCKSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDLS  784

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            GL  VTD GLL  ++S +  LVKV+LSGC N+TD  +S++ K HG++++ ++L GC  +T
Sbjct  785  GLGEVTDNGLLLLIKSSEGSLVKVDLSGCKNITDVAVSSLVKAHGKSVKQVSLEGCSKIT  844

Query  545  DASLAAIADYCSVLRDLDIS  604
            DASL  I++ C+ L +LD+S
Sbjct  845  DASLFCISENCTELAELDLS  864


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 8/131 (6%)
 Frame = +2

Query  215  GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL  394
            G+ ++A G      C SL  L I +C    D  L  +++ CPNLV L +   +GV + GL
Sbjct  503  GLAEIAAG------CPSLERLDITSCPLITDKGLAAIAQGCPNLVSLTIEACSGVGNEGL  556

Query  395  LPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADY  574
                + C   L  V++  C++V D+ IS++      +L  + L G   +TDASLA I  Y
Sbjct  557  RAIGRCC-LKLQAVSIKNCVHVGDQGISSLVCSASASLAKIRLQGLN-ITDASLAVIGYY  614

Query  575  CSVLRDLDISK  607
               + DL +++
Sbjct  615  GKAVTDLTLAR  625


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/254 (23%), Positives = 103/254 (41%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCPN+  L +  C+ + + G+ +  +    ++++ ++ C  +   G+  ++  ++ 
Sbjct  532  AIAQGCPNLVSLTIEACSGVGNEGLRAIGRCCLKLQAVSIKNCVHVGDQGISSLVCSASA  591

Query  182  KLK------------ALAFENCFG--MKDLA-----------FGVPA-LPPCNSLRSLSI  283
             L             +LA    +G  + DL            F V A       LR +S+
Sbjct  592  SLAKIRLQGLNITDASLAVIGYYGKAVTDLTLARLAAVGERGFWVMANAAGLQKLRCMSV  651

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C G  D ++  +++ CP L  L L     V+D GL  F +S                 
Sbjct  652  TSCLGVTDLAITCIAKFCPGLKQLCLRKCGHVSDAGLKAFTESAKVMENLQLEECNRVTL  711

Query  413  ---------CDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAA  562
                     C      ++L  C  V D   SA A+L   ++L  L +  C   TDASLA 
Sbjct  712  VGVLACLINCSQKFRALSLVKCTGVKD-VCSAPAQLPVCKSLRFLTIKDCPGFTDASLAV  770

Query  563  IADYCSVLRDLDIS  604
            +   C  L  +D+S
Sbjct  771  VGMICPQLEQVDLS  784


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 92/229 (40%), Gaps = 56/229 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ G PN+  L L    L++D G+        S+E L +  C  I+  G+  I      
Sbjct  480  AVACGSPNLCSLSLWDVPLVTDAGLAEIAAGCPSLERLDITSCPLITDKGLAAI------  533

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                            A G      C +L SL+I  C+G G+  L  + R C  L  +++
Sbjct  534  ----------------AQG------CPNLVSLTIEACSGVGNEGLRAIGRCCLKLQAVSI  571

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI------------AKLHG--  499
                 V D G+   V S  A L K+ L G +N+TD +++ I            A+L    
Sbjct  572  KNCVHVGDQGISSLVCSASASLAKIRLQG-LNITDASLAVIGYYGKAVTDLTLARLAAVG  630

Query  500  -------------ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                         + L  +++  C  VTD ++  IA +C  L+ L + K
Sbjct  631  ERGFWVMANAAGLQKLRCMSVTSCLGVTDLAITCIAKFCPGLKQLCLRK  679



>gb|AFA36487.1| EIN3-binding F-box protein, partial [Lolium perenne]
Length=263

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 131/188 (70%), Gaps = 0/188 (0%)
 Frame = +2

Query  41   LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM  220
            LRKC+ +SD  +  F ++A+ +ESLQ+EEC+R++  G+   L++ + K KAL+   C G+
Sbjct  1    LRKCSQISDVLLKDFAESAKVLESLQVEECNRVTLVGILAFLLNCSPKFKALSLVKCVGI  60

Query  221  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP  400
            KD+      LP C SLRSL+I +C GF DASL V+  +CP+L +L+LSGL  VTD GLLP
Sbjct  61   KDICSAPAQLPVCKSLRSLTIKHCPGFTDASLAVVGMICPHLENLDLSGLGAVTDNGLLP  120

Query  401  FVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCS  580
             ++S ++GLV V+L+GC N+TD  ISA+ K HG +L  L+L  C  +TDASL AI++ C 
Sbjct  121  LIRSSESGLVNVDLNGCENLTDAAISALVKAHGGSLAHLSLESCSKITDASLFAISESCY  180

Query  581  VLRDLDIS  604
             L +LD+S
Sbjct  181  ELAELDLS  188


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 86/192 (45%), Gaps = 4/192 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E+L L     ++  G+  ++  S   L  +
Sbjct  73   CKSLRSLTIKHCPGFTDASLAVVGMICPHLENLDLSGLGAVTDNGLLPLIRSSESGLVNV  132

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A          SL  LS+ +C+   DASL  +S  C  L  L+LS    
Sbjct  133  DLNGCENLTDAAISALVKAHGGSLAHLSLESCSKITDASLFAISESCYELAELDLSNCM-  191

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL--NGCGCVTDA  550
            V+DYG+     +    L  ++LSGC+ VT K++  +  +   +LE LNL  N  G    A
Sbjct  192  VSDYGVAVLASAAGLKLRILSLSGCLKVTQKSVPFLGSMPA-SLEGLNLQFNFIGNHNIA  250

Query  551  SLAAIADYCSVL  586
            SL     +C +L
Sbjct  251  SLEKQLWWCDIL  262



>ref|XP_009397481.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 137/201 (68%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++KG P +K L + KC  LSD+G+ +F + A ++ESL LE+C+RI+  GV  +L  ++ 
Sbjct  377  AIAKGSPFLKHLSVHKCYYLSDDGLKAFAETARALESLHLEDCNRITLMGVTALLACNS-  435

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            +LK+LA   C G+KDLAF    LP C SL SL+I +C G   ASL V+ R+C  L  ++L
Sbjct  436  ELKSLALVRCLGLKDLAFSPTRLPSCVSLTSLTIRDCPGVTGASLQVVGRICSQLQKIDL  495

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SG  GVTD  L+  + S + G V+VNL GC+++TD  ++ + K HG TL++LNLNGC  +
Sbjct  496  SGQAGVTDASLIQLIGSSEVGFVEVNLCGCVDLTDDLVTLLVKAHGSTLKMLNLNGCKKI  555

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD SL A+AD CS+L DLD+S
Sbjct  556  TDRSLLAVADSCSMLDDLDLS  576


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 101/203 (50%), Gaps = 8/203 (4%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L L +C L+SD G+++  +   ++ SL ++ C  I   G   ++     K
Sbjct  220  IADGCPLLERLDLCRCPLISDKGLMAVAQKCPNLMSLTIDSCSSIGNEG-LQVIGRCCPK  278

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            LK+++ ++C  + D           +SL  L + +     D SL V+     N++ L+L+
Sbjct  279  LKSVSIKDCLHVGDRGIASLVSSASSSLERLKL-HTLNISDISLAVIGNYGKNVIELSLT  337

Query  365  GLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
            GL  V + G   +V     GL K   + ++ C  +TD+ + AIAK     L+ L+++ C 
Sbjct  338  GLQNVGEKGF--WVMGNTLGLQKLRSITITCCGKLTDRGLEAIAK-GSPFLKHLSVHKCY  394

Query  536  CVTDASLAAIADYCSVLRDLDIS  604
             ++D  L A A+    L  L + 
Sbjct  395  YLSDDGLKAFAETARALESLHLE  417



>ref|XP_002874252.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50511.1| ein3-binding F box protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=590

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 130/204 (64%), Gaps = 1/204 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+V+  K+A S+ESL+LEECHRI+Q G+ G L++   
Sbjct  312  AVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEECHRINQVGLMGFLMNCGS  371

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNC-TGFGDASLVVLSRLCPNLVHLN  358
            KLKA +  NC G+ D     P   P  S        C  GFGDASL  L + C  L  + 
Sbjct  372  KLKAFSLANCLGISDFNLESPLSSPSCSSLRSLSIRCCPGFGDASLAFLGKFCHQLQDVE  431

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            L GLNGVTD G+   +QS + GLVKVNLS CINV+D T+SAI+  HG TLE LNL+GC  
Sbjct  432  LCGLNGVTDAGVRELLQSNNVGLVKVNLSECINVSDNTVSAISVCHGRTLESLNLDGCKN  491

Query  539  VTDASLAAIADYCSVLRDLDISKS  610
            +TD SL A+A  C  + DLDIS +
Sbjct  492  ITDTSLVAVAKNCYSVNDLDISNT  515



>emb|CDX88173.1| BnaA06g27640D [Brassica napus]
Length=622

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GC ++K + L KC L+S  G+V+  K+A S+ESL+LEECHRI+Q G  G L++   
Sbjct  346  AVGNGCTDLKHVSLNKCLLVSGKGLVALAKSASSLESLKLEECHRINQFGFLGFLMNCGV  405

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+ +  NC G+ + A    +   C+SLRSLSI +C GFGDASL  L +LC  L  + L
Sbjct  406  KLKSFSLTNCLGISE-APLPSSSTSCSSLRSLSIRHCPGFGDASLSFLGKLCHQLQDIEL  464

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GLNGVTD G+   VQS   GLVKVNLSGCINV+D T+SA++  HG TLE LN++GC  +
Sbjct  465  CGLNGVTDAGVFELVQSNSVGLVKVNLSGCINVSDNTVSAVSVCHGRTLESLNVDGCKNI  524

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDASL A+A  C  + DLD+S +
Sbjct  525  TDASLVAVAKNCYSVNDLDVSNT  547


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/207 (25%), Positives = 102/207 (49%), Gaps = 14/207 (7%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++ CP +++L L +C  ++D G+V+  +  +++  L ++ C  +   G+  +     G 
Sbjct  189  IARSCPMIEKLDLSRCPGITDKGLVAIAENCKNLSELTIDSCSGVGNEGLRAV-ARGCGN  247

Query  185  LKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            L++++ ++C   G + ++F +       +   L + N TG    SL VL      +  L 
Sbjct  248  LRSISIKSCPRIGDQGVSFLLAQAGSYLTKVKLQMVNVTGL---SLAVLGHYGAAVTDLV  304

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGET-LELLNLN  526
            L GL GV + G   +V     G+ K   ++++ C  +TD  + A+   +G T L+ ++LN
Sbjct  305  LHGLQGVNEKGF--WVMGNAKGMKKLKSLSVTACRGMTDVGLEAVG--NGCTDLKHVSLN  360

Query  527  GCGCVTDASLAAIADYCSVLRDLDISK  607
             C  V+   L A+A   S L  L + +
Sbjct  361  KCLLVSGKGLVALAKSASSLESLKLEE  387


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 89/179 (50%), Gaps = 3/179 (2%)
 Frame = +2

Query  41   LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM  220
            +R C    D  +    K    ++ ++L   + ++ AGVF ++  ++  L  +    C  +
Sbjct  438  IRHCPGFGDASLSFLGKLCHQLQDIELCGLNGVTDAGVFELVQSNSVGLVKVNLSGCINV  497

Query  221  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP  400
             D      ++    +L SL++  C    DASLV +++ C ++  L++S    V+D G+  
Sbjct  498  SDNTVSAVSVCHGRTLESLNVDGCKNITDASLVAVAKNCYSVNDLDVSN-TLVSDQGVKA  556

Query  401  FVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADY  574
               S +   L  +++ GC  VTDK+ + I KL G TL  LN+  CG ++ +++  + ++
Sbjct  557  LASSPNHLNLQVLSIGGCSGVTDKSKACIQKL-GRTLLGLNIQRCGRISSSTVDNLLEH  614



>gb|EAY84905.1| hypothetical protein OsI_06273 [Oryza sativa Indica Group]
Length=653

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 137/202 (68%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++K CP+++QL  RKC  ++D G+ +F ++A  +ESLQLEEC+ ++  G+   LV+   
Sbjct  377  AIAKFCPSLRQLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVTLVGILDFLVNCGP  436

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K ++L+   C G+KD+      LP C SL+ L+I +C  F DASL V+  +CP L  ++L
Sbjct  437  KFRSLSLVKCMGIKDICSTPARLPLCKSLQFLTIKDCPDFTDASLAVVGMVCPYLEQVDL  496

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            S L  VTD GLLP + S + GLVKV+LSGC N+TD  +S + K HG++L+ ++L GC  +
Sbjct  497  SRLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVSTLVKGHGKSLKQVSLEGCSKI  556

Query  542  TDASLAAIADYCSVLRDLDISK  607
            TDASL AI++ C+ L +LD+SK
Sbjct  557  TDASLFAISENCTELAELDLSK  578


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/255 (24%), Positives = 110/255 (43%), Gaps = 54/255 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+ GCPN+  L +  C+ + ++G+ +  ++   I++L ++ C RI   G+  ++  +  
Sbjct  245  AVAHGCPNLLSLTVESCSGVGNDGLRAIGRSCSKIQALNIKNCARIGDQGISSLVCSATA  304

Query  182  KLK------------ALAFENCFGMKDLAFGVPALPPC--------------NSLRSLSI  283
             L             +LA    +G       +  LP                 +LR +S+
Sbjct  305  SLTKIRLQGLNITDASLAVIGYYGKAVTDLTLVRLPVVAERGFWVMANAAGLQNLRCMSV  364

Query  284  CNCTGFGDASLVVLSRLCPNLV--------HLNLSGL------------------NGVTD  385
             +C G  + +L  +++ CP+L         H+  +GL                  NGVT 
Sbjct  365  TSCPGVTNLALAAIAKFCPSLRQLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVTL  424

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLH-GETLELLNLNGCGCVTDASLAA  562
             G+L F+ +C      ++L  C+ + D   S  A+L   ++L+ L +  C   TDASLA 
Sbjct  425  VGILDFLVNCGPKFRSLSLVKCMGIKD-ICSTPARLPLCKSLQFLTIKDCPDFTDASLAV  483

Query  563  IADYCSVLRDLDISK  607
            +   C  L  +D+S+
Sbjct  484  VGMVCPYLEQVDLSR  498


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 94/229 (41%), Gaps = 56/229 (24%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++G PN+  L L    L++D G+        S+E L +  C  I+  G+  +      
Sbjct  193  AVARGSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITRCPLITDKGLAAV------  246

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                            A G      C +L SL++ +C+G G+  L  + R C  +  LN+
Sbjct  247  ----------------AHG------CPNLLSLTVESCSGVGNDGLRAIGRSCSKIQALNI  284

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAI-------------------  484
                 + D G+   V S  A L K+ L G +N+TD +++ I                   
Sbjct  285  KNCARIGDQGISSLVCSATASLTKIRLQG-LNITDASLAVIGYYGKAVTDLTLVRLPVVA  343

Query  485  -------AKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                   A   G + L  +++  C  VT+ +LAAIA +C  LR L   K
Sbjct  344  ERGFWVMANAAGLQNLRCMSVTSCPGVTNLALAAIAKFCPSLRQLSFRK  392



>ref|XP_004965933.1| PREDICTED: EIN3-binding F-box protein 1-like [Setaria italica]
Length=628

 Score =   181 bits (459),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 139/201 (69%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V+K  P++K + L+KC+ +SD  +  F ++A  +E+LQ+EEC++++  G+   L++ + 
Sbjct  353  SVAKFSPSLKLVNLKKCSKVSDGCLKEFAESARVLENLQIEECNKVTLMGILAFLLNCSP  412

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K KAL+   C G+KD+      LP C SLRSL+I +C GF DASL ++  +CP L ++NL
Sbjct  413  KFKALSLVKCIGIKDICSAPAQLPVCKSLRSLTIKDCPGFTDASLAMVGMICPQLENVNL  472

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  VTD G LP ++S ++GLV V+L+GC N+TD  +SA+ K HG +L  L+L GC  +
Sbjct  473  SGLGAVTDNGFLPLIKSSESGLVNVDLNGCENLTDAAVSALVKAHGASLAHLSLEGCSRI  532

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL AI++ CS L +LD+S
Sbjct  533  TDASLFAISESCSQLAELDLS  553


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 103/206 (50%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++  C  +++L +  C L++D  +++  +    ++SL +E C  ++  G+  I   S  K
Sbjct  196  IAAECHALERLDVTGCPLVTDKALIAVAQGCPELKSLTIEACSGVANEGLKAI-GRSCTK  254

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A+  +NC  + D   GV  L  C++  SL+     G    DASL V+      +  L 
Sbjct  255  LQAVNIKNCAHVDDQ--GVSGL-VCSATASLAKVRLQGLSITDASLAVIGYYGKAITDLT  311

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +   GL K   + ++ C  +TD  ++++AK    +L+L+NL  
Sbjct  312  LARLPAVGERGF--WVMANAMGLQKLRCMTVTSCPGLTDLALASVAKFS-PSLKLVNLKK  368

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            C  V+D  L   A+   VL +L I +
Sbjct  369  CSKVSDGCLKEFAESARVLENLQIEE  394


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/254 (22%), Positives = 107/254 (42%), Gaps = 54/254 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GCP +K L +  C+ +++ G+ +  ++   ++++ ++ C  +   GV G++  +  
Sbjct  221  AVAQGCPELKSLTIEACSGVANEGLKAIGRSCTKLQAVNIKNCAHVDDQGVSGLVCSATA  280

Query  182  KLK------------ALAFENCFGMKDLAFGVPALPPC--------------NSLRSLSI  283
             L             +LA    +G       +  LP                  LR +++
Sbjct  281  SLAKVRLQGLSITDASLAVIGYYGKAITDLTLARLPAVGERGFWVMANAMGLQKLRCMTV  340

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTD--------------------------  385
             +C G  D +L  +++  P+L  +NL   + V+D                          
Sbjct  341  TSCPGLTDLALASVAKFSPSLKLVNLKKCSKVSDGCLKEFAESARVLENLQIEECNKVTL  400

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAA  562
             G+L F+ +C      ++L  CI + D   SA A+L   ++L  L +  C   TDASLA 
Sbjct  401  MGILAFLLNCSPKFKALSLVKCIGIKD-ICSAPAQLPVCKSLRSLTIKDCPGFTDASLAM  459

Query  563  IADYCSVLRDLDIS  604
            +   C  L ++++S
Sbjct  460  VGMICPQLENVNLS  473


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (55%), Gaps = 2/102 (2%)
 Frame = +2

Query  296  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI  475
            G  DA +  L+R CP L  L+L  +  VTD GL      C A L +++++GC  VTDK +
Sbjct  161  GVTDAGVSALARGCPALRSLSLWDVPQVTDAGLAEIAAECHA-LERLDVTGCPLVTDKAL  219

Query  476  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
             A+A+   E L+ L +  C  V +  L AI   C+ L+ ++I
Sbjct  220  IAVAQGCPE-LKSLTIEACSGVANEGLKAIGRSCTKLQAVNI  260


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 75/170 (44%), Gaps = 2/170 (1%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E++ L     ++  G   ++  S   L  +
Sbjct  438  CKSLRSLTIKDCPGFTDASLAMVGMICPQLENVNLSGLGAVTDNGFLPLIKSSESGLVNV  497

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + D A          SL  LS+  C+   DASL  +S  C  L  L+LS    
Sbjct  498  DLNGCENLTDAAVSALVKAHGASLAHLSLEGCSRITDASLFAISESCSQLAELDLSNCM-  556

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLN  526
            V+DYG+     +    L  ++LSGC+ VT K++  +  +   +LE LNL 
Sbjct  557  VSDYGVAVLAAAKQLKLRILSLSGCMKVTQKSVPFLGSMS-SSLEGLNLQ  605


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 92/210 (44%), Gaps = 30/210 (14%)
 Frame = +2

Query  59   LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG  238
            ++D GV +  +   ++ SL L +  +++ AG+  I       L+ L    C  + D A  
Sbjct  162  VTDAGVSALARGCPALRSLSLWDVPQVTDAGLAEIAAECHA-LERLDVTGCPLVTDKAL-  219

Query  239  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD  418
            +     C  L+SL+I  C+G  +  L  + R C  L  +N+     V D G+   V S  
Sbjct  220  IAVAQGCPELKSLTIEACSGVANEGLKAIGRSCTKLQAVNIKNCAHVDDQGVSGLVCSAT  279

Query  419  AGLVKVNLSGCINVTDKTISAI------------AKLHG---------------ETLELL  517
            A L KV L G +++TD +++ I            A+L                 + L  +
Sbjct  280  ASLAKVRLQG-LSITDASLAVIGYYGKAITDLTLARLPAVGERGFWVMANAMGLQKLRCM  338

Query  518  NLNGCGCVTDASLAAIADYCSVLRDLDISK  607
             +  C  +TD +LA++A +   L+ +++ K
Sbjct  339  TVTSCPGLTDLALASVAKFSPSLKLVNLKK  368



>ref|NP_001147557.1| LOC100281166 [Zea mays]
 gb|ACG27917.1| EIN3-binding F-box protein 1 [Zea mays]
 gb|AFW76402.1| EIN3-binding F-box protein 1 [Zea mays]
Length=626

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V+K  P+++ + L++C+ +SD  +  F ++++ +E+LQ+EEC R++  G+   L++ + 
Sbjct  351  SVAKFSPSLRLVNLKRCSKVSDGCLKEFAESSKVLENLQIEECSRVTLTGILAFLLNCSP  410

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K K+L+   C G+KD+      LP C SLRSL+I +C GF DASL V+  +CP L ++NL
Sbjct  411  KFKSLSLSKCVGIKDICSAPAQLPVCKSLRSLAIKDCPGFTDASLAVVGMICPQLENVNL  470

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL+ VTD G LP ++S ++GLV V+L+GC N+TD  +SA+ K HG +L  L+L GC  +
Sbjct  471  SGLSAVTDSGFLPLIKSSNSGLVNVDLNGCENLTDAAVSALVKAHGASLAHLSLEGCSKI  530

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL AI++ CS L +LD+S
Sbjct  531  TDASLFAISESCSQLAELDLS  551


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 102/206 (50%), Gaps = 11/206 (5%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V+  C ++++L +  C +++D G+ +  +    ++SL +E C  ++  G+  +    A K
Sbjct  193  VAAECHSLERLDISGCPMITDKGLAAVAQGCPELKSLTIEGCSGVANEGLKAVGRFCA-K  251

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A++ +NC  + D   GV  L    +  SL+     G    DASL V+     ++  L 
Sbjct  252  LQAVSIKNCALVDDQ--GVSGLVCSATASSLTKVRLQGLNITDASLAVIGYYGKSIKDLT  309

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            LS L  V + G   +V +   GL K   + +  C  +TD  ++++AK    +L L+NL  
Sbjct  310  LSRLPAVGERGF--WVMANALGLQKLRRMTVVSCPGLTDLALASVAKFS-PSLRLVNLKR  366

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            C  V+D  L   A+   VL +L I +
Sbjct  367  CSKVSDGCLKEFAESSKVLENLQIEE  392


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 2/102 (2%)
 Frame = +2

Query  296  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI  475
            G  DA +  L+R CP L  L L  +  VTD GL      C + L ++++SGC  +TDK +
Sbjct  158  GVTDAGISALARGCPELRSLTLWDVPQVTDAGLAEVAAECHS-LERLDISGCPMITDKGL  216

Query  476  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            +A+A+   E L+ L + GC  V +  L A+  +C+ L+ + I
Sbjct  217  AAVAQGCPE-LKSLTIEGCSGVANEGLKAVGRFCAKLQAVSI  257


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/232 (26%), Positives = 104/232 (45%), Gaps = 35/232 (15%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAA---------------------------E  100
            AV + C  ++ + ++ C L+ D GV   V +A                           +
Sbjct  244  AVGRFCAKLQAVSIKNCALVDDQGVSGLVCSATASSLTKVRLQGLNITDASLAVIGYYGK  303

Query  101  SIESLQLEECHRISQAGVFGILVHSAG--KLKALAFENCFGMKDLAFG-VPALPPCNSLR  271
            SI+ L L     + + G F ++ ++ G  KL+ +   +C G+ DLA   V    P  SLR
Sbjct  304  SIKDLTLSRLPAVGERG-FWVMANALGLQKLRRMTVVSCPGLTDLALASVAKFSP--SLR  360

Query  272  SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC  451
             +++  C+   D  L   +     L +L +   + VT  G+L F+ +C      ++LS C
Sbjct  361  LVNLKRCSKVSDGCLKEFAESSKVLENLQIEECSRVTLTGILAFLLNCSPKFKSLSLSKC  420

Query  452  INVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + + D   SA A+L   ++L  L +  C   TDASLA +   C  L ++++S
Sbjct  421  VGIKD-ICSAPAQLPVCKSLRSLAIKDCPGFTDASLAVVGMICPQLENVNLS  471


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 74/158 (47%), Gaps = 5/158 (3%)
 Frame = +2

Query  137  ISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASL  316
            ++ AG+   L     +L++L   +   + D      A   C+SL  L I  C    D  L
Sbjct  159  VTDAGI-SALARGCPELRSLTLWDVPQVTDAGLAEVA-AECHSLERLDISGCPMITDKGL  216

Query  317  VVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIA-KL  493
              +++ CP L  L + G +GV + GL    + C A L  V++  C  V D+ +S +    
Sbjct  217  AAVAQGCPELKSLTIEGCSGVANEGLKAVGRFC-AKLQAVSIKNCALVDDQGVSGLVCSA  275

Query  494  HGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
               +L  + L G   +TDASLA I  Y   ++DL +S+
Sbjct  276  TASSLTKVRLQGLN-ITDASLAVIGYYGKSIKDLTLSR  312



>ref|XP_003571400.1| PREDICTED: EIN3-binding F-box protein 1-like [Brachypodium distachyon]
Length=655

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++K C ++KQLCL+K   +SD G+ +F ++A+ +E+LQLEEC+R++  GV   L++ + 
Sbjct  380  SIAKFCSSLKQLCLKKSGHVSDAGLKAFAESAKLLENLQLEECNRVTLVGVLACLINCSQ  439

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K + L+   C G+KD+      LP C SLR L+I +C GF DASL V+  +CP L  ++L
Sbjct  440  KFRTLSLVKCLGVKDICSAPAQLPVCKSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDL  499

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SGL  +TD GLLP + S +   VKV+LSGC N+TD  +S++ K+HG++++ ++L GC  +
Sbjct  500  SGLGEITDNGLLPLIGSSEGAFVKVDLSGCKNITDLAVSSLVKVHGKSVKQVSLEGCSKI  559

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TDASL +I++ C+ L +LD+S
Sbjct  560  TDASLFSISENCTELAELDLS  580


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 109/206 (53%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCP +++L +  C L++D G+ +  +   ++ SL +E C  ++  G+  I      K
Sbjct  223  IAAGCPLLERLDITSCPLITDKGLTAVAQGCPNLVSLTIEACSGVANEGLRAI-GRCCSK  281

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A++ +NC  + D   G+ +L  C++  SL+     G    DASL V+     ++  L 
Sbjct  282  LQAVSIKNCARVGDQ--GISSL-VCSASASLAKIRLQGLNITDASLAVIGYYGKSVTDLT  338

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +  +GL K   ++++ C  +TD  +++IAK    +L+ L L  
Sbjct  339  LARLAAVGERGF--WVMANASGLQKLRCISVNSCPGITDLALASIAKFC-SSLKQLCLKK  395

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
             G V+DA L A A+   +L +L + +
Sbjct  396  SGHVSDAGLKAFAESAKLLENLQLEE  421


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 99/206 (48%), Gaps = 8/206 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++G PN+  L L    L++D+ +         +E L +  C  I+  G+  +      
Sbjct  196  AVARGSPNLCSLALWDVPLVTDSALAEIAAGCPLLERLDITSCPLITDKGLTAV-AQGCP  254

Query  182  KLKALAFENCFGMKDLAFGVPALPPC-NSLRSLSICNCTGFGDASLVVLS-RLCPNLVHL  355
             L +L  E C G+ +   G+ A+  C + L+++SI NC   GD  +  L      +L  +
Sbjct  255  NLVSLTIEACSGVAN--EGLRAIGRCCSKLQAVSIKNCARVGDQGISSLVCSASASLAKI  312

Query  356  NLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGC  532
             L GLN +TD  L   +      +  + L+    V ++    +A   G + L  +++N C
Sbjct  313  RLQGLN-ITDASL-AVIGYYGKSVTDLTLARLAAVGERGFWVMANASGLQKLRCISVNSC  370

Query  533  GCVTDASLAAIADYCSVLRDLDISKS  610
              +TD +LA+IA +CS L+ L + KS
Sbjct  371  PGITDLALASIAKFCSSLKQLCLKKS  396


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 87/193 (45%), Gaps = 6/193 (3%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C +++ L ++ C   +D  +         +E + L     I+  G+  ++  S G    +
Sbjct  465  CKSLRFLTIKDCPGFTDASLAVVGMICPQLEQVDLSGLGEITDNGLLPLIGSSEGAFVKV  524

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
                C  + DLA          S++ +S+  C+   DASL  +S  C  L  L+LS    
Sbjct  525  DLSGCKNITDLAVSSLVKVHGKSVKQVSLEGCSKITDASLFSISENCTELAELDLSNCM-  583

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASL  556
            V+D G+     + +  L  ++L GC NVT +++  +  +    LE LN+  C  + + ++
Sbjct  584  VSDSGVASLASTSNFKLRVLSLFGCSNVTQRSVPFLGNMG--KLEGLNIQFCNMIGNHNI  641

Query  557  AAIAD---YCSVL  586
            A++     +C +L
Sbjct  642  ASLEKQLWWCDIL  654



>emb|CDX87090.1| BnaC09g04050D [Brassica napus]
Length=616

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 130/203 (64%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+VS  K+A ++ESL+LEECHRI+  G  G L+    
Sbjct  340  AVGSGCPDLKHVSLNKCLLVSGKGLVSLAKSALALESLKLEECHRINHFGFLGFLMSCGS  399

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DL          +       C C GFGDASL  L + C  L  + L
Sbjct  400  KLKAFSLVNCLGIQDLNSESHLTSTSSLRSLSVRC-CPGFGDASLTFLGKFCHQLQDVEL  458

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GLNGVTD G+L  +QS + GLVK+NL+GC+NVTD T+SA++  HG TLE L+L+GC  +
Sbjct  459  CGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNVTDNTVSAVSFSHGSTLESLSLDGCKNI  518

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDASL  +A  C  + DLD+S +
Sbjct  519  TDASLVTVAKNCYSVNDLDVSNT  541


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 88/178 (49%), Gaps = 3/178 (2%)
 Frame = +2

Query  41   LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM  220
            +R C    D  +    K    ++ ++L   + ++ AGV  +L  +   L  L    C  +
Sbjct  432  VRCCPGFGDASLTFLGKFCHQLQDVELCGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNV  491

Query  221  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP  400
             D      +    ++L SLS+  C    DASLV +++ C ++  L++S    V+D+G+  
Sbjct  492  TDNTVSAVSFSHGSTLESLSLDGCKNITDASLVTVAKNCYSVNDLDVSN-TLVSDHGIKA  550

Query  401  FVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD  571
               S +   L  ++L GC  +TDK+ + I KL G TL  LN+  CG ++ +++ ++ +
Sbjct  551  LASSPNHLSLQVLSLGGCSGITDKSKACIQKL-GRTLLGLNIQRCGRISSSTVDSLLE  607



>ref|XP_009151059.1| PREDICTED: EIN3-binding F-box protein 2 [Brassica rapa]
Length=622

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 137/203 (67%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GC ++K + L KC L+S  G+V+  K+A S+ESL+LEECHRI+Q G  G L++   
Sbjct  346  AVGNGCTDLKHVSLNKCLLVSGKGLVALAKSASSLESLKLEECHRINQFGFLGFLMNCGV  405

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLK+ +  NC G+ + A    +   C+SLRSLSI +C GFGDASL  L +LC  L  + L
Sbjct  406  KLKSFSLTNCLGISE-APLPSSSTSCSSLRSLSIRHCPGFGDASLSFLGKLCHQLQDIEL  464

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GLNGVTD G+   VQS   GLVKV LSGCINV D T+SA++  HG TLE LN++GC  +
Sbjct  465  CGLNGVTDAGVFELVQSNSVGLVKVKLSGCINVADNTVSAVSVCHGRTLESLNVDGCKNI  524

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDASL A+A  C  + DLD+S +
Sbjct  525  TDASLVAVAKNCYSVNDLDVSNT  547


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 102/207 (49%), Gaps = 14/207 (7%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++ CP +++L L +C  ++D G+V+  +  +++  L ++ C  +   G+  +     G 
Sbjct  189  IARSCPMIEKLDLSRCPGITDKGLVAIAENCKNLSDLTIDSCSGVGNEGLRAV-ARGCGN  247

Query  185  LKALAFENC--FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            L++++ ++C   G + ++F +       +   L + N +G    SL VL      +  L 
Sbjct  248  LRSISIKSCPRIGDQGVSFLLAQAGSYLTKVKLQMVNVSGL---SLAVLGHYGAAVTDLV  304

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGET-LELLNLN  526
            L GL GV + G   +V     G+ K   ++++ C  +TD  + A+   +G T L+ ++LN
Sbjct  305  LHGLQGVNEKGF--WVMGNAKGMKKLKSLSVTACRGMTDVGLEAVG--NGCTDLKHVSLN  360

Query  527  GCGCVTDASLAAIADYCSVLRDLDISK  607
             C  V+   L A+A   S L  L + +
Sbjct  361  KCLLVSGKGLVALAKSASSLESLKLEE  387


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/179 (25%), Positives = 88/179 (49%), Gaps = 3/179 (2%)
 Frame = +2

Query  41   LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM  220
            +R C    D  +    K    ++ ++L   + ++ AGVF ++  ++  L  +    C  +
Sbjct  438  IRHCPGFGDASLSFLGKLCHQLQDIELCGLNGVTDAGVFELVQSNSVGLVKVKLSGCINV  497

Query  221  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP  400
             D      ++    +L SL++  C    DASLV +++ C ++  L++S    V+D G+  
Sbjct  498  ADNTVSAVSVCHGRTLESLNVDGCKNITDASLVAVAKNCYSVNDLDVSN-TLVSDQGVKA  556

Query  401  FVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADY  574
               S +   L  +++ GC  VTDK+ + I KL G  L  LN+  CG ++ +++  + ++
Sbjct  557  LASSPNHLNLQVLSIGGCSGVTDKSKACIQKL-GRALLGLNIQRCGRISSSTVDNLLEH  614



>ref|XP_009111664.1| PREDICTED: EIN3-binding F-box protein 2-like [Brassica rapa]
Length=616

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 130/203 (64%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+VS  K+A ++ESL+LEECHRI+  G  G L++   
Sbjct  340  AVGSGCPDLKHVSLNKCLLVSGKGLVSLAKSALALESLKLEECHRINHFGFLGFLMNCGE  399

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DL          +       C C GFGDASL  L + C  L  + L
Sbjct  400  KLKAFSLVNCLGIQDLNSESHLTSTSSLRSLSVRC-CPGFGDASLTFLGKFCHQLQDVEL  458

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GLNGVTD G+L  +QS + GLVK+NL+GC+NV+D  +SA++  HG TLE L+L+GC  +
Sbjct  459  CGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNVSDNAVSAVSFSHGSTLESLSLDGCKNI  518

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDASL  ++  C  + DLD+S +
Sbjct  519  TDASLVTVSKNCYSVNDLDVSNT  541


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 89/178 (50%), Gaps = 3/178 (2%)
 Frame = +2

Query  41   LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM  220
            +R C    D  +    K    ++ ++L   + ++ AGV  +L  +   L  L    C  +
Sbjct  432  VRCCPGFGDASLTFLGKFCHQLQDVELCGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNV  491

Query  221  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP  400
             D A    +    ++L SLS+  C    DASLV +S+ C ++  L++S    V+D+G+  
Sbjct  492  SDNAVSAVSFSHGSTLESLSLDGCKNITDASLVTVSKNCYSVNDLDVSN-TLVSDHGIKA  550

Query  401  FVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD  571
               S +   L  ++L GC  +TDK+ + I KL G TL  LN+  CG ++ +++ ++ +
Sbjct  551  LASSPNHLNLQVLSLGGCSGITDKSKACIQKL-GRTLLGLNIQRCGRISSSTVDSLLE  607


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 50/92 (54%), Gaps = 7/92 (8%)
 Frame = +2

Query  215  GMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGL  394
            G++ +A+G P      SL+SLS+ N     D  L  ++R CP L  L+LS   GVTD GL
Sbjct  153  GIESIAYGCP------SLKSLSLWNLPAVSDKGLSEIARCCPMLERLDLSRCPGVTDKGL  206

Query  395  LPFVQSCDAGLVKVNLSGCINVTDKTISAIAK  490
            +   +SC   L  + +  C  V ++ + A+A+
Sbjct  207  VAVAESC-RNLNDLTIDSCSGVGNEGLRAVAR  237



>emb|CDX76980.1| BnaC04g37750D [Brassica napus]
Length=599

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 136/230 (59%), Gaps = 31/230 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V KGCPN+K+  + K  LLSDNG+VSF K + S+ES+QLEECHR++Q G FG L++   
Sbjct  350  SVGKGCPNMKKALISKSPLLSDNGLVSFAKGSLSLESIQLEECHRVTQFGFFGSLLNCGA  409

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DLA G+PA    + LRSLS+ NC GFGDA+L  L +LCP L  + L
Sbjct  410  KLKAFSMVNCLGIRDLATGLPASSHRSGLRSLSVRNCPGFGDANLAALGKLCPQLEDIEL  469

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE-------------  502
             GL GVT+ G L  +Q+    LVKVN SGC  +TD+ +SAI+  +               
Sbjct  470  CGLKGVTESGFLHLLQN---SLVKVNFSGCSGLTDRVVSAISARNANCQILSDLDLSKCS  526

Query  503  ---------------TLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                            L++L++ GC  VTD SL +I    S L  L++ +
Sbjct  527  VSDFGIQALASSEKLKLQILSMAGCAMVTDKSLPSIVKLGSTLLGLNLQQ  576


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 89/169 (53%), Gaps = 15/169 (9%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GCP +++L L +C  ++D  +V+  K+  ++  L LE C  I   G+  +   S  K
Sbjct  193  IAEGCPQLEKLDLSRCPAITDKCLVAIAKSCPNLSELTLEACSSIGDEGLQAV-ARSCSK  251

Query  185  LKALAFENCFGMKDLAFGVPAL---PPCNSLR-SLSICNCTGFGDASLVVLSRLCPNLVH  352
            LK+++ +NC  ++D   G+ AL     C+  +  L + N T   D SL V+     ++  
Sbjct  252  LKSVSIKNCPLVRDQ--GIAALLSNTTCSLTKLKLQMVNVT---DVSLAVVGHYGFSVTE  306

Query  353  LNLSGLNGVTDYGLLPFVQSCDAGLVKVN---LSGCINVTDKTISAIAK  490
            L L+GL+ VT+ G   +V     GL K+N   ++ C  VTD  + ++ K
Sbjct  307  LVLAGLSHVTEKGF--WVMGNGIGLQKLNSLTITACQGVTDAGLESVGK  353


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/252 (23%), Positives = 98/252 (39%), Gaps = 52/252 (21%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH---  172
            A++K CPN+ +L L  C+ + D G+ +  ++   ++S+ ++ C  +   G+  +L +   
Sbjct  218  AIAKSCPNLSELTLEACSSIGDEGLQAVARSCSKLKSVSIKNCPLVRDQGIAALLSNTTC  277

Query  173  SAGKLK---------ALAFENCFGMKDLAFGVPALPPC--------------NSLRSLSI  283
            S  KLK         +LA    +G       +  L                   L SL+I
Sbjct  278  SLTKLKLQMVNVTDVSLAVVGHYGFSVTELVLAGLSHVTEKGFWVMGNGIGLQKLNSLTI  337

Query  284  CNCTGFGDASLVVLSRLCPN--------------------------LVHLNLSGLNGVTD  385
              C G  DA L  + + CPN                          L  + L   + VT 
Sbjct  338  TACQGVTDAGLESVGKGCPNMKKALISKSPLLSDNGLVSFAKGSLSLESIQLEECHRVTQ  397

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
            +G    + +C A L   ++  C+ + D      A  H   L  L++  C    DA+LAA+
Sbjct  398  FGFFGSLLNCGAKLKAFSMVNCLGIRDLATGLPASSHRSGLRSLSVRNCPGFGDANLAAL  457

Query  566  ADYCSVLRDLDI  601
               C  L D+++
Sbjct  458  GKLCPQLEDIEL  469



>gb|AFW87207.1| hypothetical protein ZEAMMB73_795948 [Zea mays]
Length=626

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 136/202 (67%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +V+K  P++K + L+KC+ +SD  +  F +++  +ESLQ+EEC +++  G+   L++   
Sbjct  350  SVAKFSPSLKTVNLKKCSKVSDGCLKEFAESSRVLESLQIEECSKVTLVGILAFLLNCNP  409

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K KAL+   C G+KD+      LP C SLRSL+I +C GF DASL V+  +CP L  ++L
Sbjct  410  KFKALSLSKCIGIKDICSAPAQLPVCKSLRSLTIKDCPGFTDASLAVVGMICPQLESIDL  469

Query  362  SGLNGVTDYGLLPFVQS-CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            SGL  VTD G LP ++   ++GLV+V L+GC ++TD  +SA+AK HG +L  L+L GC  
Sbjct  470  SGLGAVTDNGFLPLMKKGSESGLVRVGLNGCESLTDAAVSALAKAHGASLAHLSLEGCSK  529

Query  539  VTDASLAAIADYCSVLRDLDIS  604
            +TDASL AI++ CS L +LD+S
Sbjct  530  ITDASLFAISESCSQLAELDLS  551


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 103/206 (50%), Gaps = 12/206 (6%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++  C ++++L +  C +++D G+V+  +    ++SL +E C  ++  G+  I      K
Sbjct  193  IAAECHSLERLDITGCPMITDKGLVAVAQGCPELKSLTIEACSGVANEGLKAI-GRCCAK  251

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFG--DASLVVLSRLCPNLVHLN  358
            L+A++ +NC  + D   GV  L  C++  SL+     G    DASL V+     ++  L 
Sbjct  252  LQAVSVKNCAHVDDQ--GVSGL-VCSATASLAKVRLQGLNITDASLAVIGYYGKSIKDLT  308

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVK---VNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
            L+ L  V + G   +V +   GL K   + +  C  +TD  ++++AK    +L+ +NL  
Sbjct  309  LARLPAVGERGF--WVMANALGLQKLRCMTVVSCPGLTDLALASVAKFS-PSLKTVNLKK  365

Query  530  CGCVTDASLAAIADYCSVLRDLDISK  607
            C  V+D  L   A+   VL  L I +
Sbjct  366  CSKVSDGCLKEFAESSRVLESLQIEE  391


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/174 (26%), Positives = 77/174 (44%), Gaps = 30/174 (17%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+++GCP ++ L L     ++D G+        S+E L +  C  I+  G+  +      
Sbjct  166  ALARGCPELRSLTLWDVPQVTDAGLAEIAAECHSLERLDITGCPMITDKGLVAV------  219

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
                            A G P       L+SL+I  C+G  +  L  + R C  L  +++
Sbjct  220  ----------------AQGCP------ELKSLTIEACSGVANEGLKAIGRCCAKLQAVSV  257

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNL  523
                 V D G+   V S  A L KV L G +N+TD +++ I   +G++++ L L
Sbjct  258  KNCAHVDDQGVSGLVCSATASLAKVRLQG-LNITDASLAVIG-YYGKSIKDLTL  309


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/171 (27%), Positives = 76/171 (44%), Gaps = 3/171 (2%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH-SAGKLKA  193
            C +++ L ++ C   +D  +         +ES+ L     ++  G   ++   S   L  
Sbjct  435  CKSLRSLTIKDCPGFTDASLAVVGMICPQLESIDLSGLGAVTDNGFLPLMKKGSESGLVR  494

Query  194  LAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN  373
            +    C  + D A    A     SL  LS+  C+   DASL  +S  C  L  L+LS   
Sbjct  495  VGLNGCESLTDAAVSALAKAHGASLAHLSLEGCSKITDASLFAISESCSQLAELDLSNCM  554

Query  374  GVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLN  526
             V+DYG+     +    L  ++LSGC+ VT K++  +  +   +LE LNL 
Sbjct  555  -VSDYGVAVLAAARQLKLRVLSLSGCMKVTQKSVPFLGSMS-SSLEALNLQ  603


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (53%), Gaps = 2/102 (2%)
 Frame = +2

Query  296  GFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI  475
            G  DA +  L+R CP L  L L  +  VTD GL      C + L +++++GC  +TDK +
Sbjct  158  GVTDAGVCALARGCPELRSLTLWDVPQVTDAGLAEIAAECHS-LERLDITGCPMITDKGL  216

Query  476  SAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
             A+A+   E L+ L +  C  V +  L AI   C+ L+ + +
Sbjct  217  VAVAQGCPE-LKSLTIEACSGVANEGLKAIGRCCAKLQAVSV  257



>ref|XP_009381112.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=650

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 134/201 (67%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+SKG P++KQL + K   LSD G+ +F + A ++E+L LE+C++++  GV  +L     
Sbjct  375  AISKGSPSLKQLFICKSEYLSDAGLRAFAETARALENLHLEDCNQVTLVGVSSLL-KCNP  433

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            +LK+LA   C G+KD+      +P C SLRSL+I +C G  DASL  + ++CP L +++L
Sbjct  434  ELKSLALARCLGIKDITLCPTQMPSCVSLRSLTIHDCPGVTDASLQTVGKICPQLQNVDL  493

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            SG  GVTD  L+P + +   G V+VNLS C+NVTD  ++ + K HG TL++ NL+GC  +
Sbjct  494  SGQIGVTDASLIPLIGNSKGGFVEVNLSNCVNVTDVLVAMLVKSHGGTLKVFNLDGCKQI  553

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD SL AIAD CS L +LD+S
Sbjct  554  TDRSLLAIADGCSELDNLDLS  574


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/252 (21%), Positives = 103/252 (41%), Gaps = 51/252 (20%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAG----------  151
            AV++ CPN+  L +  C+ + + G+ +  +   +++S+ +++C R+   G          
Sbjct  243  AVAQKCPNLTSLTIESCSSIHNEGLQAIGRCCPNLKSVTVKDCMRVGDQGIASLVSSASS  302

Query  152  ---------------VFGILVHSAGKLKALAFENCFGMKDLAFGVPALP-PCNSLRSLSI  283
                           V  ++ H    +  LA  +   + +  F V         LRS+SI
Sbjct  303  SLQRIKLQTLNISDLVLAVIGHYGKNVIDLALIDLQKVNEKGFWVMGKTLGLQRLRSISI  362

Query  284  CNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS-----------------  412
             +C+G  D  L  +S+  P+L  L +     ++D GL  F ++                 
Sbjct  363  TSCSGLTDLGLQAISKGSPSLKQLFICKSEYLSDAGLRAFAETARALENLHLEDCNQVTL  422

Query  413  --------CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIA  568
                    C+  L  + L+ C+ + D T+         +L  L ++ C  VTDASL  + 
Sbjct  423  VGVSSLLKCNPELKSLALARCLGIKDITLCPTQMPSCVSLRSLTIHDCPGVTDASLQTVG  482

Query  569  DYCSVLRDLDIS  604
              C  L+++D+S
Sbjct  483  KICPQLQNVDLS  494



>emb|CDY19807.1| BnaA09g04600D [Brassica napus]
Length=616

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 128/203 (63%), Gaps = 1/203 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV  GCP++K + L KC L+S  G+V   K+A ++ESL+LEECHRI+  G    L+    
Sbjct  340  AVGSGCPDLKHVSLNKCLLVSGKGLVGLAKSALALESLKLEECHRINHFGFLRFLMSCGE  399

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KLKA +  NC G++DL          +       C C GFGDASL  L + C  L  + L
Sbjct  400  KLKAFSLVNCLGIQDLNSESHLTSTSSLRSLSVRC-CPGFGDASLTFLGKFCHQLQDVEL  458

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             GLNGVTD G+L  +QS + GLVK+NL+GC+NV+D T+SA++  HG TLE L+L+GC  +
Sbjct  459  CGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNVSDNTVSAVSFSHGSTLESLSLDGCKNI  518

Query  542  TDASLAAIADYCSVLRDLDISKS  610
            TDAS+  ++  C  + DLD+S +
Sbjct  519  TDASVVTVSKNCYSVNDLDVSNT  541


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 88/178 (49%), Gaps = 3/178 (2%)
 Frame = +2

Query  41   LRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGM  220
            +R C    D  +    K    ++ ++L   + ++ AGV  +L  +   L  L    C  +
Sbjct  432  VRCCPGFGDASLTFLGKFCHQLQDVELCGLNGVTDAGVLSLLQSNNVGLVKLNLNGCVNV  491

Query  221  KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLP  400
             D      +    ++L SLS+  C    DAS+V +S+ C ++  L++S    V+D+G+  
Sbjct  492  SDNTVSAVSFSHGSTLESLSLDGCKNITDASVVTVSKNCYSVNDLDVSN-TLVSDHGIKA  550

Query  401  FVQSCDA-GLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD  571
               S +   L  ++L GC  +TDK+ + I KL G TL  LN+  CG ++ +++ ++ +
Sbjct  551  LASSPNHLNLQVLSLGGCSGITDKSKACIQKL-GRTLLGLNIQRCGRISSSTVDSLLE  607



>gb|ACF81449.1| unknown [Zea mays]
Length=206

 Score =   130 bits (328),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 95/131 (73%), Gaps = 1/131 (1%)
 Frame = +2

Query  212  FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYG  391
             G+KD+   VP LP C SLR L+I +C GF +ASL V+  +CP L  ++LSGL  VTD G
Sbjct  1    MGIKDIC-SVPQLPFCRSLRFLTIKDCPGFTNASLAVVGMICPQLEQVDLSGLGEVTDNG  59

Query  392  LLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIAD  571
            LLP +QS ++GL+KV+LSGC N+TD  +S++ K HG++L+ ++L GC  +TDASL  +++
Sbjct  60   LLPLIQSSESGLIKVDLSGCKNITDVAVSSLVKRHGKSLKKVSLEGCSKITDASLFTMSE  119

Query  572  YCSVLRDLDIS  604
             C+ L +LD+S
Sbjct  120  SCTELAELDLS  130


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 92/194 (47%), Gaps = 33/194 (17%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAES-IESLQLEECHRISQAGVFGILVHSAGKLKA  193
            CP ++Q+ L     ++DNG++  ++++ES +  + L  C  I+   V   LV   GK   
Sbjct  41   CPQLEQVDLSGLGEVTDNGLLPLIQSSESGLIKVDLSGCKNITDVAVSS-LVKRHGK---  96

Query  194  LAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN  373
                                   SL+ +S+  C+   DASL  +S  C  L  L+LS   
Sbjct  97   -----------------------SLKKVSLEGCSKITDASLFTMSESCTELAELDLSNCM  133

Query  374  GVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  553
             V+DYG+     +    L  ++LSGC  VT K++  +  L G++LE LNL  C  + + +
Sbjct  134  -VSDYGVAMLASARHLKLRVLSLSGCSKVTQKSVPFLGNL-GQSLEGLNLQFCNMIGNHN  191

Query  554  LAAIAD---YCSVL  586
            +A++     +C +L
Sbjct  192  IASLEKKLWWCDIL  205



>tpg|DAA44558.1| TPA: hypothetical protein ZEAMMB73_857721 [Zea mays]
Length=222

 Score =   123 bits (309),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 91/140 (65%), Gaps = 2/140 (1%)
 Frame = +2

Query  95   AESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPPCNSLRS  274
            A S+ESLQ+EEC +++  G+    ++ + K K+L+   C  +KD+      LP C SLRS
Sbjct  34   AVSLESLQIEECSKVTLTGILAFFLNCSPKFKSLSLSKCIEIKDICSASAQLPVCKSLRS  93

Query  275  LSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCI  454
            L+I +C+GF D SL ++   CP L ++NLSGL+ VTD G LP ++S D+GLV ++L+ C 
Sbjct  94   LAIKDCSGFTDTSLPMVGMFCPQLENINLSGLSAVTDNGFLPLMKSSDSGLVDIDLNSCE  153

Query  455  N--VTDKTISAIAKLHGETL  508
            N  VTD  +SA+ K H  +L
Sbjct  154  NLTVTDAAVSALVKDHDASL  173



>ref|XP_006849175.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
 gb|ERN10756.1| hypothetical protein AMTR_s00027p00189050 [Amborella trichopoda]
Length=620

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/202 (33%), Positives = 112/202 (55%), Gaps = 0/202 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ +GC N++ + +  C  L D+G+    + +  I+++++E C  ++  G   +L +   
Sbjct  344  AIGRGCLNLESVTINYCPPLDDSGLWGLTQTSSCIKTVRIEGCDTVTWGGAAALLSNLHH  403

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             ++ L+   C G+KD     P LP C  L SL+I NCT  GD+ L  +    P +  L+L
Sbjct  404  TIRFLSISRCNGIKDPPPRAPKLPFCPRLLSLAIRNCTALGDSFLSWIRDASPAIKRLDL  463

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +GL  VT+ G++  +        +V+LSGC  V+D ++ A+    G  +  L+L+GC  V
Sbjct  464  TGLTMVTNLGIMALLDVRKEVWTEVSLSGCARVSDDSVVALCNGCGGGIRTLSLDGCVQV  523

Query  542  TDASLAAIADYCSVLRDLDISK  607
             DASL AIA  C+ + DLD+S+
Sbjct  524  GDASLEAIARLCTCINDLDLSQ  545


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 95/208 (46%), Gaps = 30/208 (14%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ GC  +++L LR C L++D G+V+  K + ++ SL LE C  +    +       + 
Sbjct  215  AIAMGCTLLRKLDLRNCPLVTDKGLVAIAKTSSNLSSLTLEACPNVGDPALEAT-SKCSN  273

Query  182  KLKALAFENC-----FGMK--------------------DLAFGVPALPPCNSLRSLSIC  286
             +K+L+  NC      G++                    D AF   A   C+SL SL++ 
Sbjct  274  NIKSLSLNNCPCIGDEGLRSMVSRLQKLKKLKLTRLKLSDKAFEAIA-KYCSSLTSLTLT  332

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
               G  ++S + + R C NL  + ++    + D GL    Q+    +  V + GC  VT 
Sbjct  333  GILGIHESSFLAIGRGCLNLESVTINYCPPLDDSGLWGLTQTSSC-IKTVRIEGCDTVTW  391

Query  467  KTISA-IAKLHGETLELLNLNGCGCVTD  547
               +A ++ LH  T+  L+++ C  + D
Sbjct  392  GGAAALLSNLH-HTIRFLSISRCNGIKD  418



>ref|XP_001775242.1| predicted protein [Physcomitrella patens]
 gb|EDQ59978.1| predicted protein [Physcomitrella patens]
Length=619

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 108/201 (54%), Gaps = 2/201 (1%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V K C +++   L +C  ++D G+   ++    ++SLQLE CH I+ AGV   L    G 
Sbjct  342  VGKVCQDLETCVLTQCQSITDRGLQGLMQCCIRLDSLQLERCHAITNAGVLAALARGKGN  401

Query  185  LKALAFENCFGMKDLAFGVPALP-PCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            L+ L    C    +       LP  C SL++L++  C   G   +V +   CP+L +L+L
Sbjct  402  LRKLNLSKCDSFWNGGKRAEELPLRCLSLKTLNVTECKNVGVEPIVTMGLCCPSLENLDL  461

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            S L  + D  ++  ++ C   LV +NL+ C N+TD  ++AIA   G+ LE L L+GC  V
Sbjct  462  SQLTDLNDEAIISIIEVCGEHLVNLNLTNCKNITDVAVAAIASRCGD-LERLILDGCYQV  520

Query  542  TDASLAAIADYCSVLRDLDIS  604
             D  L  +A  C +L++LD+S
Sbjct  521  GDNGLQTLATECPLLKELDLS  541



>ref|XP_002981899.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
 gb|EFJ16992.1| hypothetical protein SELMODRAFT_233861 [Selaginella moellendorffii]
Length=595

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 117/201 (58%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ K C  + +L L  C  ++D G+ +FV   + +  L +E+C  I+ AG+  +L  +A 
Sbjct  318  SLGKSCSYLNRLLLIDCDNITDQGLCAFVDGCQRLRGLHIEKCRSITYAGLASVLTTTAE  377

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G++D +    A   C+ L+SL + +  G G+  L +   + P + HL+L
Sbjct  378  TLKSLQVCKCSGIQDSSLTASASFKCSGLKSLVVNHSEGIGNRCLEMAGFVFPAVQHLDL  437

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G++ ++D GLL F+++  + LV +NLS C+ +TDK I  +++   E L+ + L+GC  V
Sbjct  438  CGISKLSDTGLLAFLETSGSSLVFLNLSDCVELTDKAIVGVSRKCFE-LQTVILDGCVKV  496

Query  542  TDASLAAIADYCSVLRDLDIS  604
            +D S+  +A  C  L++LD+S
Sbjct  497  SDKSVGVLASQCRSLQELDVS  517


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 92/203 (45%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++++GC  ++ L L KC  +SD G+ +  +    + +L +E C  I  AG+  I   S  
Sbjct  162  SIARGCRLLQSLDLLKCPNVSDAGLEAVSRGCLRLSNLSIESCDGIGNAGIKAI-AKSCC  220

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L+ L+   C  +   A        C +L+ L +    G  D  L  L+  C +L  L  
Sbjct  221  YLQTLSLSRCSNINSHAI-TSVSKHCVALKKLKL-EKIGINDRGLAFLTHHCKSLTKLVF  278

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKV-NLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            SGL+ VT  G +          +KV  L+ C  VTD+ +S++ K     L  L L  C  
Sbjct  279  SGLD-VTQEGFISLALPDGLKYLKVIVLNACHGVTDQFLSSLGK-SCSYLNRLLLIDCDN  336

Query  539  VTDASLAAIADYCSVLRDLDISK  607
            +TD  L A  D C  LR L I K
Sbjct  337  ITDQGLCAFVDGCQRLRGLHIEK  359


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 76/149 (51%), Gaps = 4/149 (3%)
 Frame = +2

Query  20   PNVKQLCLRKCTLLSDNGVVSFVKAA-ESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            P V+ L L   + LSD G+++F++ +  S+  L L +C  ++   + G+      +L+ +
Sbjct  430  PAVQHLDLCGISKLSDTGLLAFLETSGSSLVFLNLSDCVELTDKAIVGV-SRKCFELQTV  488

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
              + C  + D + GV A   C SL+ L + NC+   D  + V+  + P L  L+LSG + 
Sbjct  489  ILDGCVKVSDKSVGVLA-SQCRSLQELDVSNCSITDDGIVAVVISVGPTLKTLSLSGCSR  547

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
            VTD  L    + CD+ L  +NL  C   T
Sbjct  548  VTDESLPTIQKMCDS-LTALNLKNCSGFT  575



>ref|XP_002986021.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
 gb|EFJ12840.1| hypothetical protein SELMODRAFT_123441 [Selaginella moellendorffii]
Length=647

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 117/201 (58%), Gaps = 1/201 (0%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ K C  + +L L  C  ++D G+ +FV   + +  L +E+C  I+ AG+  +L  +A 
Sbjct  370  SLGKSCSYLNRLLLIDCDNITDQGLCAFVDGCQRLRGLHIEKCRSITYAGLASVLTTTAE  429

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             LK+L    C G++D +    A   C+ L+SL + +  G G+  L +   + P + HL+L
Sbjct  430  TLKSLQVCKCSGIQDSSLTASASFKCSGLKSLVVNHSEGIGNRCLEMAGFVFPAVQHLDL  489

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G++ ++D GLL F+++  + LV +NLS C+ +TDK I  +++   E L+ + L+GC  V
Sbjct  490  CGISKLSDTGLLAFLETSGSSLVFLNLSDCVELTDKAIVGVSRKCFE-LQTVILDGCVKV  548

Query  542  TDASLAAIADYCSVLRDLDIS  604
            +D S+  +A  C  L++LD+S
Sbjct  549  SDKSVGVLASQCRSLQELDVS  569


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 92/203 (45%), Gaps = 6/203 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++++GC  ++ L L KC  +SD G+ +  +    + +L +E C  I  AG+  I   S  
Sbjct  214  SIARGCRLLQSLDLLKCPNVSDAGLEAVSRGCLRLSNLSIESCDGIGNAGIKAI-AKSCC  272

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L+ L+   C  +   A        C +L+ L +    G  D  L  L+  C +L  L  
Sbjct  273  YLQTLSLSRCSNINSHAI-TSVSKHCVALKKLKL-EKIGINDRGLAFLTHHCKSLTKLVF  330

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKV-NLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            SGL+ VT  G +          +KV  L+ C  VTD+ +S++ K     L  L L  C  
Sbjct  331  SGLD-VTQEGFISLALPDGLKYLKVIVLNACHGVTDQFLSSLGK-SCSYLNRLLLIDCDN  388

Query  539  VTDASLAAIADYCSVLRDLDISK  607
            +TD  L A  D C  LR L I K
Sbjct  389  ITDQGLCAFVDGCQRLRGLHIEK  411


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 76/149 (51%), Gaps = 4/149 (3%)
 Frame = +2

Query  20   PNVKQLCLRKCTLLSDNGVVSFVKAA-ESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            P V+ L L   + LSD G+++F++ +  S+  L L +C  ++   + G+      +L+ +
Sbjct  482  PAVQHLDLCGISKLSDTGLLAFLETSGSSLVFLNLSDCVELTDKAIVGV-SRKCFELQTV  540

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
              + C  + D + GV A   C SL+ L + NC+   D  + V+  + P L  L+LSG + 
Sbjct  541  ILDGCVKVSDKSVGVLA-SQCRSLQELDVSNCSITDDGIVAVVISVGPTLKTLSLSGCSR  599

Query  377  VTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
            VTD  L    + CD+ L  +NL  C   T
Sbjct  600  VTDESLPTIQKMCDS-LTALNLKNCSGFT  627



>ref|XP_001783097.1| predicted protein [Physcomitrella patens]
 gb|EDQ52100.1| predicted protein [Physcomitrella patens]
Length=633

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 109/201 (54%), Gaps = 2/201 (1%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V K C ++K   L +C  ++D G+ SF++    ++SLQLE CH I+  GV   LV   G 
Sbjct  352  VGKVCQDLKLCVLSQCQSVTDKGLQSFLQCCVCLDSLQLERCHAITNGGVLTALVQGKGN  411

Query  185  LKALAFENCFGMKDLAFGVPALP-PCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            L+ L    C G+ +       +   C SL++L++  C   G   +V +   CP L +L+L
Sbjct  412  LRTLNLSKCHGLWNEEKRANEVSLECLSLKTLNVTGCKNVGVEPVVKMCLRCPLLENLDL  471

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            S +  + D  ++  ++ C   LV +NL+ C N+TD  ++AIA  H   LE L L+GC  V
Sbjct  472  SQMVDLNDEAIISVIEGCGEHLVSLNLTNCKNITDVVVAAIAS-HCGDLERLILDGCYQV  530

Query  542  TDASLAAIADYCSVLRDLDIS  604
             D+ L  +A  C  L++LD+S
Sbjct  531  GDSGLQMLAAACPSLKELDLS  551



>ref|XP_010251723.1| PREDICTED: EIN3-binding F-box protein 1-like [Nelumbo nucifera]
Length=655

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 114/210 (54%), Gaps = 12/210 (6%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S G   +K++ +RKC  L+D+G+    K    +ESL+LEECH ++  G+  +  + + 
Sbjct  373  AISDGFVGLKKISMRKCKSLTDDGLKWLTKTTPLLESLELEECHSVTWHGLIEVFRNRSE  432

Query  182  KLKALAFENCFGMKDL------AFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPN  343
             LKAL+   C G+ D+      A  +P  P    L SL +  C G GD  L  + R C  
Sbjct  433  TLKALSLIKCRGIADVDPSNCKAISLPKYP---CLHSLVLKKCDGVGDTFLAWMGRACLQ  489

Query  344  LVHLNLSGLNGVTDYGLLPFVQSCDA---GLVKVNLSGCINVTDKTISAIAKLHGETLEL  514
            + HL L+GL  +TD G+   +++ +      + V+LSGC  +TD ++  I  L G+ L  
Sbjct  490  VKHLTLTGLKSITDQGVENLIRALETEQNRRISVDLSGCSRITDWSVFVITSLIGDKLRS  549

Query  515  LNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            L L+ C  +TD SL  IA+ C+ L DL +S
Sbjct  550  LMLDWCEKLTDLSLKMIAERCACLLDLGLS  579



>ref|XP_010264613.1| PREDICTED: EIN3-binding F-box protein 2-like [Nelumbo nucifera]
Length=645

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 106/201 (53%), Gaps = 6/201 (3%)
 Frame = +2

Query  23   NVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAF  202
             + Q+ +RKC  L+D G+    K+   +ESL LEEC  I+  G+  + ++ +  LK L+ 
Sbjct  369  RLTQISVRKCNSLTDKGLKELSKSTSLLESLVLEECRSITWNGLIQVFINCSATLKTLSL  428

Query  203  ENCFGMKDLAFGVPA--LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
              C G+ D    +    LP    L SL++  C   GD  L  +   C  + HL L GL  
Sbjct  429  VRCRGIADDISNLQRTCLPKYPRLHSLTLKKCHRIGDLFLAWIGHACIQVKHLTLVGLKL  488

Query  377  VTDYGLLPFVQSCDAG----LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            +TD G++  +Q+ +      LV V++SG   +TD ++ AI  + GE L  L L+GC  ++
Sbjct  489  ITDQGVINLIQTLNTNTVHRLVSVDMSGSSGITDLSVYAITSIVGEKLRCLILDGCERLS  548

Query  545  DASLAAIADYCSVLRDLDISK  607
            D SL  I++ C  L DL +S+
Sbjct  549  DLSLKMISERCPCLIDLGLSR  569



>gb|KHM99176.1| EIN3-binding F-box protein 1 [Glycine soja]
Length=161

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +2

Query  374  GVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  553
            G+T+ GLLP +Q+C+AGLV VNL GC N+    +SA+ K+HG TLELLNL+GC  +TDAS
Sbjct  9    GITNVGLLPLLQNCEAGLVNVNLIGCWNLIANIVSALVKIHGGTLELLNLDGCWKITDAS  68

Query  554  LAAIADYCSVLRDLDISK  607
              AIA    V+ DLD+SK
Sbjct  69   SVAIAKNFIVINDLDVSK  86



>ref|WP_032114111.1| hypothetical protein [Candidatus Paracaedibacter symbiosus]
Length=591

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 101/199 (51%), Gaps = 4/199 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++ CPN+  L L  C L++D  ++   +   ++ SL L  C +++ A +  +   S   
Sbjct  294  LAQKCPNLTSLDLGWCGLITDAALIKVAEKCPNLTSLNLWGCEKVTDAALIKV-AESCSN  352

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L +L    C  + D A  +     C +L SL +  C    DA+L+ ++  CPNL  LNL 
Sbjct  353  LASLTLMGCKQITDAAL-IKVAEKCRNLTSLDLGGCEHITDAALIKVAEKCPNLASLNLG  411

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
                +TD  L+   +SC + L  +NL GC  +TD  +  +A+     L  L+L GC  +T
Sbjct  412  WCQQITDVALIKVAESC-SNLTSLNLWGCELITDAALIKVAE-KCRNLTSLDLGGCELIT  469

Query  545  DASLAAIADYCSVLRDLDI  601
            DA+L  +A+ C  L  LD+
Sbjct  470  DAALIKVAEKCRNLTSLDL  488


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 96/195 (49%), Gaps = 4/195 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V++ CPN+  L L  C  ++D  ++   ++  ++ SL L  C  I+ A +  +       
Sbjct  398  VAEKCPNLASLNLGWCQQITDVALIKVAESCSNLTSLNLWGCELITDAALIKV-AEKCRN  456

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L +L    C  + D A  +     C +L SL +  C    D +L+ ++  CPNL  LNL 
Sbjct  457  LTSLDLGGCELITDAAL-IKVAEKCRNLTSLDLGGCKHITDTALIKVAEKCPNLASLNLR  515

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
                +TD   +   +SC + L  ++L GC  +TD  +  +A++  + L  L+L  C  +T
Sbjct  516  WCQHITDVAPIKLAESC-SNLTSLDLGGCELITDAALIKVAQMCPK-LTWLSLPKCEHIT  573

Query  545  DASLAAIADYCSVLR  589
            DA+L  +A+ C  L+
Sbjct  574  DAALIKVAEMCLHLK  588


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 94/201 (47%), Gaps = 4/201 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V++ C N+  L L  C  ++D  ++   +   ++ SL L  C +I+   +  +   S   
Sbjct  372  VAEKCRNLTSLDLGGCEHITDAALIKVAEKCPNLASLNLGWCQQITDVALIKV-AESCSN  430

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L +L    C  + D A  +     C +L SL +  C    DA+L+ ++  C NL  L+L 
Sbjct  431  LTSLNLWGCELITDAAL-IKVAEKCRNLTSLDLGGCELITDAALIKVAEKCRNLTSLDLG  489

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            G   +TD  L+   + C   L  +NL  C ++TD     +A+     L  L+L GC  +T
Sbjct  490  GCKHITDTALIKVAEKC-PNLASLNLRWCQHITDVAPIKLAE-SCSNLTSLDLGGCELIT  547

Query  545  DASLAAIADYCSVLRDLDISK  607
            DA+L  +A  C  L  L + K
Sbjct  548  DAALIKVAQMCPKLTWLSLPK  568


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 87/193 (45%), Gaps = 30/193 (16%)
 Frame = +2

Query  23   NVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAF  202
            N+ +  LR    ++D  ++  V   E + SL L  C +++ A +  +             
Sbjct  170  NLTRRHLRVNDSITDEKLIKLVTKYEHLTSLNLWGCEKVTDAALIKVA------------  217

Query  203  ENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVT  382
                              C++L SL++  C    DA+L+ ++  C NL  LNL     +T
Sbjct  218  ----------------ESCSNLASLTLMECEHITDAALIKVAEKCRNLTSLNLRWCQHIT  261

Query  383  DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAA  562
            D  L+  V+SC + L  ++L  C  +TD  I  +A+     L  L+L  CG +TDA+L  
Sbjct  262  DAALIKVVESC-SNLTSLDLGWCRQITDTAIIKLAQ-KCPNLTSLDLGWCGLITDAALIK  319

Query  563  IADYCSVLRDLDI  601
            +A+ C  L  L++
Sbjct  320  VAEKCPNLTSLNL  332



>ref|XP_002682758.1| predicted protein [Naegleria gruberi]
 gb|EFC50014.1| predicted protein [Naegleria gruberi]
Length=255

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/229 (29%), Positives = 108/229 (47%), Gaps = 32/229 (14%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            ++ + CP +  L L+ C+ L D+ +   V     I++L +  CH ++   +  I  H   
Sbjct  16   SIGEYCPRLNSLNLQHCSQLRDSTIRIIVNGCSDIQNLNIGMCHLVTDESLVEIFTH-CR  74

Query  182  KLKALAFENCFGMK-DLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
            KL+ L+  +C  +  +L+F +    P   L  L I  CT F D +L  LS  C  L HL+
Sbjct  75   KLRVLSVHSCEMITGELSFRMTKNTP--FLEVLDISFCTKFSDIALQFLSEYCTRLKHLD  132

Query  359  LSGLNGVTDYGLLPFVQSCDA---------------------------GLVKVNLSGCIN  457
            +SG   + D GLL   + C                              L  + LSG   
Sbjct  133  VSGCPLIQDEGLLSICKHCPQIVTMRTTILSQPTITSDSLSFLTNYARNLEVLELSGIFQ  192

Query  458  VTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            + D+++  I K +G+ LE L+L+GC  +TD S+ AI+D+C  LR L+++
Sbjct  193  IKDESVVEICK-YGQRLEFLSLSGCPNITDDSINAISDHCQNLRCLEVA  240



>ref|WP_032113191.1| hypothetical protein, partial [Candidatus Paracaedibacter symbiosus]
Length=196

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 97/199 (49%), Gaps = 4/199 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++ CPN+  L L  C  ++D  ++   +  +++  L L  C +I  A +  +       
Sbjct  1    MAESCPNLTSLDLSGCRKIADAAIIKVAEKCKNLTKLDLWGCRKIKDAAIIKV-AEKCKN  59

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L  L    C  +KD A  +       +L SL++       DA+L+ ++  C NL  L L 
Sbjct  60   LTKLDLWGCREIKDAAL-IKVAESYPNLTSLTLSAWPQIKDATLIKVAEKCTNLTSLTLE  118

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            G   + D  L+   +SC + L  +NL GC  +TD  I  +A+     L  LNL GCG +T
Sbjct  119  GCWQIKDAALIKLAESC-SNLTSLNLRGCEKITDTAIIKLAE-SCSNLASLNLRGCGKIT  176

Query  545  DASLAAIADYCSVLRDLDI  601
            DA++  +A+ CS L  L++
Sbjct  177  DAAIIKLAESCSNLTSLNL  195



>ref|XP_010521976.1| PREDICTED: LOW QUALITY PROTEIN: F-box/LRR-repeat protein 4 [Tarenaya 
hassleriana]
Length=508

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 103/202 (51%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV+KGC ++K L L  C  +SD  + S  +    +E+L L++C  I+ +     LV    
Sbjct  144  AVAKGCRDLKTLHLAGCRSVSDELLKSLSENCRDLEALGLQDCRNITDSTGLNDLVKGCR  203

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K+K L    C  + D      A    +SL++L + +C    D S++ L++ C NLV L +
Sbjct  204  KIKYLDINKCHNIGDAGVSSVAEVCASSLKTLKLMDCYKVRDKSILSLAKFCKNLVTLII  263

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G   ++D  + P   SC   L  + +  C+++TD ++S I   H + LE L++  C  +
Sbjct  264  GGCRNISDKSIKPLSGSCRDSLKNLRMDWCLSITDSSLSCILT-HCKNLEALDIGNCEEI  322

Query  542  TDASLAAIAD-YCSVLRDLDIS  604
            TDA+   + + Y S L+   +S
Sbjct  323  TDATFWYLGNGYLSGLKVFKVS  344



>ref|WP_032112559.1| hypothetical protein [Candidatus Paracaedibacter symbiosus]
Length=246

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 99/201 (49%), Gaps = 4/201 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V++ C N+ +L L  C  + D  ++   +  +++  L L  C  I  A +  +   S   
Sbjct  27   VAEKCKNLTKLDLWGCRKIKDAAIIKVAEKCKNLTKLDLWGCREIKDAALIKV-AESYPN  85

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L +L       +KD A  +     C +L SL++  C    DA+L+ L+  C NL  LNL 
Sbjct  86   LTSLTLSAWPQIKD-ATLIKVAEKCTNLTSLTLEGCWQIKDAALIKLAESCSNLTSLNLR  144

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            G   +TD  ++   +SC + L  +NL GC  +TD  I  +A+     L  LNL  C  +T
Sbjct  145  GCEKITDTAIIKLAESC-SNLASLNLRGCGKITDAAIIKLAE-SCSNLTSLNLRECEKIT  202

Query  545  DASLAAIADYCSVLRDLDISK  607
            DA++  +A+ CS L  L++ +
Sbjct  203  DAAIIKLAESCSNLTSLNLRE  223


 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 63/137 (46%), Gaps = 2/137 (1%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V++ C N+  L L  C  + D  ++   ++  ++ SL L  C +I+   +   L  S   
Sbjct  105  VAEKCTNLTSLTLEGCWQIKDAALIKLAESCSNLTSLNLRGCEKITDTAIIK-LAESCSN  163

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L +L    C  + D A  +     C++L SL++  C    DA+++ L+  C NL  LNL 
Sbjct  164  LASLNLRGCGKITDAAI-IKLAESCSNLTSLNLRECEKITDAAIIKLAESCSNLTSLNLR  222

Query  365  GLNGVTDYGLLPFVQSC  415
                +T   L+   Q C
Sbjct  223  ECEKITHAALIKVAQMC  239


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 59/114 (52%), Gaps = 2/114 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++ C N+  L LR C  ++D  ++   ++  ++ SL L  C +I+ A +   L  S   
Sbjct  131  LAESCSNLTSLNLRGCEKITDTAIIKLAESCSNLASLNLRGCGKITDAAIIK-LAESCSN  189

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNL  346
            L +L    C  + D A  +     C++L SL++  C     A+L+ ++++CP+L
Sbjct  190  LTSLNLRECEKITDAAI-IKLAESCSNLTSLNLRECEKITHAALIKVAQMCPHL  242


 Score = 48.9 bits (115),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 49/94 (52%), Gaps = 2/94 (2%)
 Frame = +2

Query  323  LSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE  502
            ++  CPNL  L+LSG   + D  ++   + C   L K++L GC  + D  I  +A+   +
Sbjct  1    MAESCPNLTSLDLSGCRKIADAAIIKVAEKCK-NLTKLDLWGCRKIKDAAIIKVAE-KCK  58

Query  503  TLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             L  L+L GC  + DA+L  +A+    L  L +S
Sbjct  59   NLTKLDLWGCREIKDAALIKVAESYPNLTSLTLS  92



>gb|KJE94442.1| hypothetical protein, variant [Capsaspora owczarzaki ATCC 30864]
Length=1571

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 56/200 (28%), Positives = 101/200 (51%), Gaps = 5/200 (3%)
 Frame = +2

Query  17    CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
             CPN++ L +  C  ++D+ ++    +  +I  L+L  C  IS A +  +L   +  L+ L
Sbjct  1326  CPNIQYLDISNCRKITDDSLIQLTASCSTIRWLELSYCKNISDAAMVEVLGTCSNTLQHL  1385

Query  197   AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
               + C  +   AF    + P   L  L + +     D ++  ++  CP L HL++S   G
Sbjct  1386  NLQRCTRLTKEAFAPLRVTPALRLTKLILSDLFALDDQTVADIAAGCPQLQHLDMSFCFG  1445

Query  377   VTDYGLLPFVQSCDAGLVKVNLSGCIN-VTDKTISAIAKLHGE---TLELLNLNGCGCVT  544
             +T+  L    + C A LV ++L+ C   VTD ++ A+     E   TL+ LNL  C  +T
Sbjct  1446  LTEAALSHLARHCKA-LVHLDLASCAGAVTDASVDALVASPSELRVTLQWLNLRNCSSIT  1504

Query  545   DASLAAIADYCSVLRDLDIS  604
             D +L  + + C+VL+ +++S
Sbjct  1505  DDALRCLNENCAVLQHVNLS  1524


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 42/159 (26%), Positives = 73/159 (46%), Gaps = 3/159 (2%)
 Frame = +2

Query  92    AAESIESLQLEECHRISQAGVFGILVHSAG-KLKALAFENCFGMKDLAFGVPALPPCNSL  268
             A E + ++ L   H+     V   L    G  ++ L+  NC+ + D    +  +  C  L
Sbjct  1245  APEVVSTIDLSSVHKKVTDTVLDNLTEKLGDSVRKLSLHNCWLITDNGLRI-VVERCPKL  1303

Query  269   RSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSG  448
               LS+ +C      SL++L   CPN+ +L++S    +TD  L+    SC   +  + LS 
Sbjct  1304  EYLSLFSCWDITTESLILLGSHCPNIQYLDISNCRKITDDSLIQLTASCST-IRWLELSY  1362

Query  449   CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
             C N++D  +  +      TL+ LNL  C  +T  + A +
Sbjct  1363  CKNISDAAMVEVLGTCSNTLQHLNLQRCTRLTKEAFAPL  1401



>ref|XP_004346768.1| hypothetical protein CAOG_05083 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94441.1| hypothetical protein CAOG_005083 [Capsaspora owczarzaki ATCC 
30864]
Length=1890

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 56/200 (28%), Positives = 101/200 (51%), Gaps = 5/200 (3%)
 Frame = +2

Query  17    CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
             CPN++ L +  C  ++D+ ++    +  +I  L+L  C  IS A +  +L   +  L+ L
Sbjct  1645  CPNIQYLDISNCRKITDDSLIQLTASCSTIRWLELSYCKNISDAAMVEVLGTCSNTLQHL  1704

Query  197   AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
               + C  +   AF    + P   L  L + +     D ++  ++  CP L HL++S   G
Sbjct  1705  NLQRCTRLTKEAFAPLRVTPALRLTKLILSDLFALDDQTVADIAAGCPQLQHLDMSFCFG  1764

Query  377   VTDYGLLPFVQSCDAGLVKVNLSGCIN-VTDKTISAIAKLHGE---TLELLNLNGCGCVT  544
             +T+  L    + C A LV ++L+ C   VTD ++ A+     E   TL+ LNL  C  +T
Sbjct  1765  LTEAALSHLARHCKA-LVHLDLASCAGAVTDASVDALVASPSELRVTLQWLNLRNCSSIT  1823

Query  545   DASLAAIADYCSVLRDLDIS  604
             D +L  + + C+VL+ +++S
Sbjct  1824  DDALRCLNENCAVLQHVNLS  1843


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 42/159 (26%), Positives = 73/159 (46%), Gaps = 3/159 (2%)
 Frame = +2

Query  92    AAESIESLQLEECHRISQAGVFGILVHSAG-KLKALAFENCFGMKDLAFGVPALPPCNSL  268
             A E + ++ L   H+     V   L    G  ++ L+  NC+ + D    +  +  C  L
Sbjct  1564  APEVVSTIDLSSVHKKVTDTVLDNLTEKLGDSVRKLSLHNCWLITDNGLRI-VVERCPKL  1622

Query  269   RSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSG  448
               LS+ +C      SL++L   CPN+ +L++S    +TD  L+    SC   +  + LS 
Sbjct  1623  EYLSLFSCWDITTESLILLGSHCPNIQYLDISNCRKITDDSLIQLTASCST-IRWLELSY  1681

Query  449   CINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
             C N++D  +  +      TL+ LNL  C  +T  + A +
Sbjct  1682  CKNISDAAMVEVLGTCSNTLQHLNLQRCTRLTKEAFAPL  1720



>ref|XP_010908612.1| PREDICTED: EIN3-binding F-box protein 1-like [Elaeis guineensis]
Length=569

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/221 (28%), Positives = 112/221 (51%), Gaps = 29/221 (13%)
 Frame = +2

Query  26   VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE  205
            +K++ ++ C  L+D+G+V   ++A+S++S+ LE+  RI+ +G+   L + +  LK L+  
Sbjct  328  LKKIAIKNCRSLTDDGLVELTRSAKSLKSITLEKLDRITSSGLVEALSNCSRTLKELSLL  387

Query  206  NCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTD  385
             C  ++  A  +P   P    +++++  C G GD  LV +   C  +  + L  ++ +TD
Sbjct  388  KCNLIQSDAHPLPRHFPL--FKAVTLNQCHGVGDGFLVRMGWACKKVEEIRLVCMDSITD  445

Query  386  YGLLPFVQS--CDAGLVKVNLSGCINVTDKTISAIAKLHGETLEL---------------  514
             G+L F+        + K++LSGC  VTD+++ AIA+   E  EL               
Sbjct  446  SGILGFLYQLGSRTNITKLDLSGCRLVTDRSLRAIAQRCQELEELDLSGCRISDQGVECL  505

Query  515  ----------LNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                      L+L GC  +TD SL A+   C  L  L++++
Sbjct  506  ASEGPSWLQALSLAGCAEITDKSLEALQTLCVSLESLNVTR  546


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 78/156 (50%), Gaps = 5/156 (3%)
 Frame = +2

Query  137  ISQAGVFGILVHSAGKLKALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDAS  313
            I   GV   L  SA  L +L F +  G +   +G+  +   C +LRSL++ NCT  G+  
Sbjct  104  IPYQGVLTELAISAS-LPSLPFSS-RGDQMTDYGLSIISQVCLNLRSLTLWNCTKVGNKG  161

Query  314  LVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKL  493
            +  L+  C +L   +LS    +TD GLL   + C   L  + L+ C ++ ++++ A AK 
Sbjct  162  IASLANCCTSLEKFSLSNSPSITDDGLLLIAKGC-PDLSSLILNSCWSIGNRSLDAFAK-  219

Query  494  HGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            H   L+L  L  C  V D+++ ++      LR L I
Sbjct  220  HSNKLKLFILERCPVVKDSAIISMLTNLQELRMLKI  255



>gb|KHN29896.1| Putative methyltransferase PMT2 [Glycine soja]
Length=308

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 1/93 (1%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +SKGC N+KQLCLR+C  +SDNG+V+F K   S+ESL LEE +R +Q+G+   L +   K
Sbjct  215  ISKGCINLKQLCLRRCCFVSDNGLVAFAKVVVSLESLMLEEHNRFTQSGIIVALTNIKIK  274

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSI  283
              +L+   C G+KD+   V  L PC SLR L I
Sbjct  275  F-SLSLVKCMGVKDIDMEVSMLSPCESLRPLVI  306



>ref|XP_009150869.1| PREDICTED: F-box/LRR-repeat protein 2 [Brassica rapa]
Length=405

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GC +++ L L  C  ++D  + S  +    +E+L L+ C  I+ +G    LV    
Sbjct  144  AVAQGCHDLRALHLAGCRFITDETLKSLSERCRDLEALGLQGCTNITDSG-LADLVKGCR  202

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K+KAL    C  + D      A    +SL++L + +C   GD S+  L++ C NL  L +
Sbjct  203  KIKALDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGDESVSSLAQFCKNLETLII  262

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G   ++D  ++    SC  GL  + +  C+NVTD +++ + K   ++LE L++  C  V
Sbjct  263  GGCRDISDESIVLLADSCRDGLKNLRMDWCLNVTDSSLTCVLK-QCKSLEALDIGCCEEV  321

Query  542  TD  547
            TD
Sbjct  322  TD  323


 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/191 (25%), Positives = 92/191 (48%), Gaps = 3/191 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++G   ++ L L  C  ++D G+ S  +    ++ L +  C ++S  G+  +       
Sbjct  93   IAQGFKCLRVLNLHTCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAV-AQGCHD  151

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L+AL    C  + D      +   C  L +L +  CT   D+ L  L + C  +  L+++
Sbjct  152  LRALHLAGCRFITDETLKSLS-ERCRDLEALGLQGCTNITDSGLADLVKGCRKIKALDIN  210

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
              + V D G+    ++C + L  + L  C  V D+++S++A+   + LE L + GC  ++
Sbjct  211  KCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGDESVSSLAQF-CKNLETLIIGGCRDIS  269

Query  545  DASLAAIADYC  577
            D S+  +AD C
Sbjct  270  DESIVLLADSC  280


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (54%), Gaps = 2/114 (2%)
 Frame = +2

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
            LR L++  C G  D  L  + R    L  L++S    ++D GL    Q C   L  ++L+
Sbjct  100  LRVLNLHTCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAQGC-HDLRALHLA  158

Query  446  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            GC  +TD+T+ ++++     LE L L GC  +TD+ LA +   C  ++ LDI+K
Sbjct  159  GCRFITDETLKSLSE-RCRDLEALGLQGCTNITDSGLADLVKGCRKIKALDINK  211


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 86/182 (47%), Gaps = 7/182 (4%)
 Frame = +2

Query  11   KGCPNVKQLCLRKCTLLSDNGVVSFVKA-AESIESLQLEECHRISQAGVFGILVHSAGKL  187
            KGC  +K L + KC+ + D GV S  KA A S+++L+L +C+++    V   L      L
Sbjct  199  KGCRKIKALDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGDESVSS-LAQFCKNL  257

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
            + L    C  + D +  + A    + L++L +  C    D+SL  + + C +L  L++  
Sbjct  258  ETLIIGGCRDISDESIVLLADSCRDGLKNLRMDWCLNVTDSSLTCVLKQCKSLEALDIGC  317

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE--TLELLNLNGCGCV  541
               VTD            GL  + +S C  +   T++ I KL  +  +LE L++     V
Sbjct  318  CEEVTDNAFRDLGSEDVLGLKVLKVSNCPKI---TVAGIGKLLEKCSSLEYLDVRSLPHV  374

Query  542  TD  547
            T+
Sbjct  375  TE  376



>emb|CDX88014.1| BnaA06g26050D [Brassica napus]
Length=405

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 95/182 (52%), Gaps = 2/182 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GC +++ L L  C  ++D  + S  +    +E+L L+ C  I+ +G    LV    
Sbjct  144  AVAQGCHDLRALHLAGCRFITDETLKSLSERCRDLEALVLQGCTNITDSG-LADLVKGCR  202

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K+KAL    C  + D      A    +SL++L + +C   GD S+  L++ C NL  L +
Sbjct  203  KIKALDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGDESVSSLAQFCKNLETLII  262

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G   ++D  ++    SC  GL  + +  C+NVTD +++ + K   ++LE L++  C  V
Sbjct  263  GGCRDISDESIVLLADSCRDGLKNLRMDWCLNVTDSSLTCVLK-QCKSLEALDIGCCEEV  321

Query  542  TD  547
            TD
Sbjct  322  TD  323


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/191 (25%), Positives = 92/191 (48%), Gaps = 3/191 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++G   ++ L L  C  ++D G+ S  +    ++ L +  C ++S  G+  +       
Sbjct  93   IAQGFKCLRVLNLHTCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAV-AQGCHD  151

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L+AL    C  + D      +   C  L +L +  CT   D+ L  L + C  +  L+++
Sbjct  152  LRALHLAGCRFITDETLKSLS-ERCRDLEALVLQGCTNITDSGLADLVKGCRKIKALDIN  210

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
              + V D G+    ++C + L  + L  C  V D+++S++A+   + LE L + GC  ++
Sbjct  211  KCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGDESVSSLAQF-CKNLETLIIGGCRDIS  269

Query  545  DASLAAIADYC  577
            D S+  +AD C
Sbjct  270  DESIVLLADSC  280


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (54%), Gaps = 2/114 (2%)
 Frame = +2

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
            LR L++  C G  D  L  + R    L  L++S    ++D GL    Q C   L  ++L+
Sbjct  100  LRVLNLHTCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAQGC-HDLRALHLA  158

Query  446  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            GC  +TD+T+ ++++     LE L L GC  +TD+ LA +   C  ++ LDI+K
Sbjct  159  GCRFITDETLKSLSE-RCRDLEALVLQGCTNITDSGLADLVKGCRKIKALDINK  211


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 86/182 (47%), Gaps = 7/182 (4%)
 Frame = +2

Query  11   KGCPNVKQLCLRKCTLLSDNGVVSFVKA-AESIESLQLEECHRISQAGVFGILVHSAGKL  187
            KGC  +K L + KC+ + D GV S  KA A S+++L+L +C+++    V   L      L
Sbjct  199  KGCRKIKALDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGDESVSS-LAQFCKNL  257

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
            + L    C  + D +  + A    + L++L +  C    D+SL  + + C +L  L++  
Sbjct  258  ETLIIGGCRDISDESIVLLADSCRDGLKNLRMDWCLNVTDSSLTCVLKQCKSLEALDIGC  317

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE--TLELLNLNGCGCV  541
               VTD            GL  + +S C  +   T++ I KL  +  +LE L++     V
Sbjct  318  CEEVTDNAFRDLGSEDVLGLKVLKVSNCPKI---TVAGIGKLLEKCSSLEYLDVRSLPHV  374

Query  542  TD  547
            T+
Sbjct  375  TE  376



>emb|CDY45764.1| BnaC02g42180D [Brassica napus]
Length=583

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 98/188 (52%), Gaps = 2/188 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GC +++ L L  C  ++D  + S  +    +E+L L+ C  I+ +G+   LV    
Sbjct  322  AVAEGCHDLRALHLAGCRFITDETLKSLSQRCRDLEALGLQGCTNITDSGL-ADLVKGCR  380

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K+KAL    C  + D      A    +SL++L + +C   GD S+  LS+ C NL  L +
Sbjct  381  KIKALDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGDESVSSLSQFCKNLETLII  440

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G   ++D  ++    SC  GL  + +  C+NVTD +++ + K   ++LE L++  C  V
Sbjct  441  GGCRDISDESIVLLADSCRDGLKNLRMDWCLNVTDSSLTCVLK-QCKSLEALDIGCCEEV  499

Query  542  TDASLAAI  565
            TD +   +
Sbjct  500  TDNAFQGL  507


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 92/191 (48%), Gaps = 3/191 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++G   ++ L L  C  ++D G+ S  +    ++ L +  C ++S  G+  +       
Sbjct  271  IAEGFKCLRVLNLHTCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAV-AEGCHD  329

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L+AL    C  + D      +   C  L +L +  CT   D+ L  L + C  +  L+++
Sbjct  330  LRALHLAGCRFITDETLKSLS-QRCRDLEALGLQGCTNITDSGLADLVKGCRKIKALDIN  388

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
              + V D G+    ++C + L  + L  C  V D+++S++++   + LE L + GC  ++
Sbjct  389  KCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGDESVSSLSQF-CKNLETLIIGGCRDIS  447

Query  545  DASLAAIADYC  577
            D S+  +AD C
Sbjct  448  DESIVLLADSC  458


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (54%), Gaps = 2/114 (2%)
 Frame = +2

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
            LR L++  C G  D  L  + R    L  L++S    ++D GL    + C   L  ++L+
Sbjct  278  LRVLNLHTCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGCH-DLRALHLA  336

Query  446  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            GC  +TD+T+ ++++     LE L L GC  +TD+ LA +   C  ++ LDI+K
Sbjct  337  GCRFITDETLKSLSQ-RCRDLEALGLQGCTNITDSGLADLVKGCRKIKALDINK  389



>ref|XP_009842087.1| hypothetical protein H257_15620 [Aphanomyces astaci]
 gb|ETV68461.1| hypothetical protein H257_15620 [Aphanomyces astaci]
Length=2928

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 96/210 (46%), Gaps = 13/210 (6%)
 Frame = +2

Query  2     AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
             A+SK CPN+K + + +C L+SD GV +F +A   +  +    C R++   +  +  H+  
Sbjct  2481  ALSKTCPNLKAIHMDRCPLISDVGVEAF-EACRDLREVGFGFCVRVTDDALLSLASHT--  2537

Query  182   KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             +L AL    C  + D       LP   +L SL I  C    D  ++ +   C  L H+NL
Sbjct  2538  RLSALNVSGCLQLSDFVGLANILPASTTLTSLDISGCRRLTDHGIIAIGTRCTKLTHVNL  2597

Query  362   SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTIS---------AIAKLHGETLEL  514
             +  + VTD G+     +C   LV +N+     VTD   S          ++KL    L  
Sbjct  2598  AFCDKVTDRGIWAITHNC-LDLVSLNVQELHLVTDNVFSFDQQGDGRAVVSKLLLAKLRT  2656

Query  515   LNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             + L  C  +TD  +A +      L+ +D+S
Sbjct  2657  VVLADCKLLTDTGIAYLLHRARHLQSMDVS  2686


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 47/200 (24%), Positives = 90/200 (45%), Gaps = 12/200 (6%)
 Frame = +2

Query  26    VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVH------SAGKL  187
             ++ + L  C LL+D G+   +  A  ++S+ +  C+ ++  G+  I         +   L
Sbjct  2654  LRTVVLADCKLLTDTGIAYLLHRARHLQSMDVSGCYHLTNQGLEFITTDIFNGSITGEHL  2713

Query  188   KALAFENCFGMKDLAFGVPAL-PPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
               L    C  +   + GV  +   C  L ++S+  C    DA ++ L + C  + +L L 
Sbjct  2714  TVLDLSYCMSLS--SDGVRFVRERCKQLVTVSLTGCILLQDAEVIELVKACGKIANLGLG  2771

Query  365   GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
                 ++D  +L  +  C   L  + ++ C  +TD  + A+A      L  +NL+ C  VT
Sbjct  2772  FCRELSD-DVLIAISDC-LWLDSLFINRCAKMTDVGVCAVAS-QCTGLLAVNLSSCKRVT  2828

Query  545   DASLAAIADYCSVLRDLDIS  604
             D ++  + D C  L  LD++
Sbjct  2829  DVAVDRLYDNCPKLAHLDVT  2848



>ref|XP_009386195.1| PREDICTED: EIN3-binding F-box protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=604

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 98/197 (50%), Gaps = 5/197 (3%)
 Frame = +2

Query  26   VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE  205
            +++L +  C+LLSD G+     +A  +E++ L  C   +  G+   + + +  LK LA  
Sbjct  332  IRKLAINNCSLLSDWGLFELTSSARELENVLLHSCKSFTYRGLMVAIGNCSQSLKTLALI  391

Query  206  NCFGM---KDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNG  376
             C  +   +D A   P    C  L ++ +  C G GD  ++ +   C  +  ++ + ++ 
Sbjct  392  KCDFLDEQRDQANSFPLAQHCPLLETVKVDQCRGIGDDFILWIGASCKQVTDVSFTRMDS  451

Query  377  VTDYGLLPFVQSCDAG--LVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDA  550
            +TD G+  F+        + +V+L+GC  V + ++ AI +    +L+ L L GCG V D 
Sbjct  452  ITDRGIRCFLSQLKGSNKMARVDLTGCTRVGNWSVWAITRECKASLKRLVLRGCGRVNDR  511

Query  551  SLAAIADYCSVLRDLDI  601
              A IA  C+ L +LD+
Sbjct  512  GAAVIARRCAKLVELDL  528


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 87/192 (45%), Gaps = 3/192 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG-  181
            +++ CP ++ + + +C  + D+ ++    + + +  +       I+  G+   L    G 
Sbjct  408  LAQHCPLLETVKVDQCRGIGDDFILWIGASCKQVTDVSFTRMDSITDRGIRCFLSQLKGS  467

Query  182  -KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             K+  +    C  + + +          SL+ L +  C    D    V++R C  LV L+
Sbjct  468  NKMARVDLTGCTRVGNWSVWAITRECKASLKRLVLRGCGRVNDRGAAVIARRCAKLVELD  527

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            L G + ++D G+    +     L  ++L+GC  +TD+++  + K  G  LE +N+ GC  
Sbjct  528  LGGCD-ISDEGVKKLARDEPIDLEVISLAGCTRITDRSLLVLKKYMGPGLERVNVAGCTG  586

Query  539  VTDASLAAIADY  574
            V+ A +  +  Y
Sbjct  587  VSKAVINWLKLY  598



>ref|XP_005828541.1| hypothetical protein GUITHDRAFT_112273 [Guillardia theta CCMP2712]
 gb|EKX41561.1| hypothetical protein GUITHDRAFT_112273 [Guillardia theta CCMP2712]
Length=1839

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 59/201 (29%), Positives = 101/201 (50%), Gaps = 4/201 (2%)
 Frame = +2

Query  5     VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGV-FGILVHSAG  181
             +++ CPN+K+L L  C  ++D G++        IES+ L EC  ++ A + F +      
Sbjct  1581  IARLCPNLKKLELEACVRITDGGMMEVASGCHLIESVTLNECSELTDASIAFLVNFDLDF  1640

Query  182   KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             +L+ +++       + +FG      C+SL SL +     + D  LV LS  C  L  L+L
Sbjct  1641  RLREISYTGLVKTTEESFG-QICGSCSSLESLQVAGSKLYQDVQLVHLSHTCIQLRKLDL  1699

Query  362   SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             S    +TDYG+    +SC   L  V+L+ C  +T++  S +A  H   +  L+L GC  +
Sbjct  1700  SWCESITDYGISCVARSC-TKLDDVSLAYCDKITNQGFSELAH-HCGGITDLDLTGCFGL  1757

Query  542   TDASLAAIADYCSVLRDLDIS  604
              D +++ I+     L  L+IS
Sbjct  1758  DDLAMSEISRSLFFLSHLNIS  1778


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 59/111 (53%), Gaps = 7/111 (6%)
 Frame = +2

Query  266   LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
             + +L+I  C    D S++ + R  PN+V LNL GL G+TD  L    + C   L K+ L 
Sbjct  1536  MHTLTISRCVKVTDFSVIEIVRSMPNIVCLNLEGLRGLTDNALRHIARLC-PNLKKLELE  1594

Query  446   GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD  598
              C+ +TD  +  +A      +E + LN C  +TDAS+A + ++     DLD
Sbjct  1595  ACVRITDGGMMEVAS-GCHLIESVTLNECSELTDASIAFLVNF-----DLD  1639


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 37/119 (31%), Positives = 57/119 (48%), Gaps = 13/119 (11%)
 Frame = +2

Query  248   LPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGL  427
             +PP + L  + +C   G G            +L HL+L G++ + D      V      L
Sbjct  1014  VPPSDILSVVELCVSEGIG------------SLTHLSLYGMSNMKDGEFAGLVSLLPNSL  1061

Query  428   VKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
               ++L  C+ + DK +  +AK   + LEL NL GC  +TD S+ A+A +C  L  LD S
Sbjct  1062  KSLSLQFCLTLEDKEVIELAKQKTDLLEL-NLRGCEKITDNSILALAHHCLFLEKLDFS  1119


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 58/133 (44%), Gaps = 2/133 (2%)
 Frame = +2

Query  5     VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
             +S  C  +++L L  C  ++D G+    ++   ++ + L  C +I+  G F  L H  G 
Sbjct  1687  LSHTCIQLRKLDLSWCESITDYGISCVARSCTKLDDVSLAYCDKITNQG-FSELAHHCGG  1745

Query  185   LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
             +  L    CFG+ DLA    +      L  L+I NC      SLV +      L  L L 
Sbjct  1746  ITDLDLTGCFGLDDLAMSEIS-RSLFFLSHLNISNCENVTKDSLVHIRDWAEGLTQLELL  1804

Query  365   GLNGVTDYGLLPF  403
             G + +    +L F
Sbjct  1805  GCSAIDRVDMLRF  1817


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 7/125 (6%)
 Frame = +2

Query  107   ESLQLEECHRISQAGVFGIL----VHSAGKLKALAFENCFGMKDLAF-GVPALPPCNSLR  271
             ESL+L+  +++  + +  ++        G L  L+      MKD  F G+ +L P NSL+
Sbjct  1004  ESLKLKADNKVPPSDILSVVELCVSEGIGSLTHLSLYGMSNMKDGEFAGLVSLLP-NSLK  1062

Query  272   SLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGC  451
             SLS+  C    D  ++ L++   +L+ LNL G   +TD  +L     C   L K++ S C
Sbjct  1063  SLSLQFCLTLEDKEVIELAKQKTDLLELNLRGCEKITDNSILALAHHC-LFLEKLDFSYC  1121

Query  452   INVTD  466
               V+D
Sbjct  1122  TQVSD  1126



>ref|XP_009592242.1| PREDICTED: F-box/LRR-repeat protein 2 [Nicotiana tomentosiformis]
Length=412

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 99/189 (52%), Gaps = 4/189 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GC +++ L L  C  +SD+ + +  K   S+E L L+ C  I+ +G+  +LV    
Sbjct  150  AVAEGCRDLRTLHLAGCRFVSDSLLEALSKNCHSLEELGLQGCTNITNSGL-SVLVEGCR  208

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            ++K L    C  + D+     +     +LR+L + +C   GD S++ L+  C NL  L +
Sbjct  209  RIKHLDINKCSNVGDIGISSVSKACSLTLRTLKLLDCYKVGDESILSLASYCKNLETLVI  268

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHG-ETLELLNLNGCGC  538
             G   ++D  +     +C   L K+ +  C+N+TD ++  I  + G + LE+L++  C  
Sbjct  269  GGCRNISDESMKSLAAACSNSLRKLRMDWCLNITDSSLDCI--ISGCKKLEVLDIGCCEE  326

Query  539  VTDASLAAI  565
            VTDA+   +
Sbjct  327  VTDAAFQQL  335


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 62/114 (54%), Gaps = 2/114 (2%)
 Frame = +2

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
            L+ LS+ NC G  D  +  +      L  L++S    +TD GL    + C   L  ++L+
Sbjct  106  LKILSLQNCKGITDNGMAAIGSSLSYLQSLDISYCRKITDKGLSAVAEGC-RDLRTLHLA  164

Query  446  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            GC  V+D  + A++K +  +LE L L GC  +T++ L+ + + C  ++ LDI+K
Sbjct  165  GCRFVSDSLLEALSK-NCHSLEELGLQGCTNITNSGLSVLVEGCRRIKHLDINK  217



>emb|CBJ28117.1| Hypothetical leucine rich repeat calmodulin binding protein [Ectocarpus 
siliculosus]
Length=1536

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 61/238 (26%), Positives = 101/238 (42%), Gaps = 42/238 (18%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGI--LVHSA  178
            +  GC ++K L L  C+ +SD GV    K +  +  L +  C R+ + G   +  L  S 
Sbjct  277  IGGGCWSLKSLSLEGCSHVSDTGVAEIAKLSTGLTYLNISRCERVGEYGDRALIQLGRSC  336

Query  179  GKLKALAFENCF----------------GMKDLAFGVPALPP------------------  256
             +L  L    C                 G+  +A G P L                    
Sbjct  337  HQLTGLDAFGCSHAQVWLLHVGVITLDPGLLSVARGCPKLEKLMLTGCGGITGKSVRALA  396

Query  257  --CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLV  430
              C+ LR LS+  C G G+  L  L+R C +L HLN++    V  +GL    +     L 
Sbjct  397  RGCSKLRDLSLSGCGGVGNGDLKELARGCTSLRHLNIAQCRQVNAHGLAALARGLK-NLT  455

Query  431  KVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            ++++ GC  V D  + A+  ++    + LNL+GC  +T+  +  IA  C+ L  L+++
Sbjct  456  ELDVGGCEKVDDSALRALCSMNA---QFLNLSGCSAITEMGVTGIAMNCTALSSLNVT  510


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 61/214 (29%), Positives = 101/214 (47%), Gaps = 18/214 (8%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V K  P +  L LR C  ++D G+    +   ++  L +  CH ++  G+  + +     
Sbjct  199  VCKLRPEMIGLSLRNCIEVTDVGMWCIARHTTALRELNVGGCHSVTNIGLRSLAI-CCDN  257

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            ++ L F +C  + DL   V     C SL+SLS+  C+   D  +  +++L   L +LN+S
Sbjct  258  MEQLDFTSCTRLTDLGLRVIG-GGCWSLKSLSLEGCSHVSDTGVAEIAKLSTGLTYLNIS  316

Query  365  GLNGVTDYG---LLPFVQSCDAGLVKVNLSGC-----------INVTDKTISAIAKLHGE  502
                V +YG   L+   +SC   L  ++  GC           +   D  + ++A+    
Sbjct  317  RCERVGEYGDRALIQLGRSCHQ-LTGLDAFGCSHAQVWLLHVGVITLDPGLLSVAR-GCP  374

Query  503  TLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             LE L L GCG +T  S+ A+A  CS LRDL +S
Sbjct  375  KLEKLMLTGCGGITGKSVRALARGCSKLRDLSLS  408


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 95/209 (45%), Gaps = 40/209 (19%)
 Frame = +2

Query  17   CPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKAL  196
            C N++QL    CT L+D G+        S++SL LE C  +S  GV  I   S G    L
Sbjct  255  CDNMEQLDFTSCTRLTDLGLRVIGGGCWSLKSLSLEGCSHVSDTGVAEIAKLSTG----L  310

Query  197  AFENCFGMKDLAFGVPALPPCNSLRSLSICNCTG-FGDASLVVLSRLCPNLVHLNLSGLN  373
             + N                      +S C   G +GD +L+ L R C  L  L+  G +
Sbjct  311  TYLN----------------------ISRCERVGEYGDRALIQLGRSCHQLTGLDAFGCS  348

Query  374  ---------GVT--DYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLN  520
                     GV   D GLL   + C   L K+ L+GC  +T K++ A+A+     L  L+
Sbjct  349  HAQVWLLHVGVITLDPGLLSVARGCPK-LEKLMLTGCGGITGKSVRALAR-GCSKLRDLS  406

Query  521  LNGCGCVTDASLAAIADYCSVLRDLDISK  607
            L+GCG V +  L  +A  C+ LR L+I++
Sbjct  407  LSGCGGVGNGDLKELARGCTSLRHLNIAQ  435



>gb|EEC80178.1| hypothetical protein OsI_22033 [Oryza sativa Indica Group]
Length=630

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 105/201 (52%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++KGC N+  L L  C LL+D  +    ++ + +  L++  C  +  A +  I     G
Sbjct  334  SIAKGCKNLTDLILNDCHLLTDRSLEFVARSCKKLARLKINGCQNMETAALEHIGRWCPG  393

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L+ L+   C  ++D AF +     C+ LRSL + +C+   D +L  +++ C NL  L++
Sbjct  394  LLE-LSLIYCPRIRDSAF-LEVGRGCSLLRSLYLVDCSRISDDALCYIAQGCKNLTELSI  451

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 + D  L+ F ++C + L ++ L  C  V+D  ++AIA+  G  L  LNL GC  +
Sbjct  452  RRGYEIGDKALISFAENCKS-LRELTLQFCERVSDAGLTAIAE--GCPLRKLNLCGCQLI  508

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD  L AIA  C  L  LDIS
Sbjct  509  TDNGLTAIARGCPDLVYLDIS  529


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 73/154 (47%), Gaps = 30/154 (19%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC N+ +L +R+   + D  ++SF +  +S+  L L+ C R+S AG+  I       
Sbjct  439  IAQGCKNLTELSIRRGYEIGDKALISFAENCKSLRELTLQFCERVSDAGLTAI-------  491

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
                           A G P       LR L++C C    D  L  ++R CP+LV+L++S
Sbjct  492  ---------------AEGCP-------LRKLNLCGCQLITDNGLTAIARGCPDLVYLDIS  529

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
             L  + D  L    + C + L  + LS C  VTD
Sbjct  530  VLRSIGDMALAEIGEGC-SQLKDIALSHCPEVTD  562


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 99/223 (44%), Gaps = 29/223 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVK-AAESIESLQLEECHRISQAGVFGILVH--  172
            A+ +GC  ++ L LR     SD G++  +K   +S+ SL +  C  ++ A +  +  H  
Sbjct  205  AIGEGCKLLRNLNLRFVEGTSDEGLIGLIKNCGQSLVSLGVATCAWMTDASLHAVGSHCP  264

Query  173  ------------------SAGK----LKALAFENCFGMKDLAFGVPALPPCNSLRSLSIC  286
                              S  K    LK L  + C G  D A     L  C+ L SLS+ 
Sbjct  265  NLEFLSLESDHIKNEGVVSVAKGCRLLKTLKLQ-CMGAGDEALDAIGLF-CSFLESLSLN  322

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
            N   F D SL  +++ C NL  L L+  + +TD  L    +SC   L ++ ++GC N+  
Sbjct  323  NFEKFTDRSLSSIAKGCKNLTDLILNDCHLLTDRSLEFVARSCKK-LARLKINGCQNMET  381

Query  467  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL  595
              +  I +     LE L+L  C  + D++   +   CS+LR L
Sbjct  382  AALEHIGRWCPGLLE-LSLIYCPRIRDSAFLEVGRGCSLLRSL  423


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 81/184 (44%), Gaps = 31/184 (17%)
 Frame = +2

Query  53   TLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA  232
            T L+D G+ S  +  + +E L L  C  I+  G+  I             ENC       
Sbjct  145  TCLTDVGLTSLARGCKGLEKLSLVWCSSITSTGLVRI------------SENC-------  185

Query  233  FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS  412
                      +L SL +  C   GD  L+ +   C  L +LNL  + G +D GL+  +++
Sbjct  186  ---------KNLSSLDLQACY-IGDPGLIAIGEGCKLLRNLNLRFVEGTSDEGLIGLIKN  235

Query  413  CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD  592
            C   LV + ++ C  +TD ++ A+   H   LE L+L     + +  + ++A  C +L+ 
Sbjct  236  CGQSLVSLGVATCAWMTDASLHAVGS-HCPNLEFLSLES-DHIKNEGVVSVAKGCRLLKT  293

Query  593  LDIS  604
            L + 
Sbjct  294  LKLQ  297



>ref|XP_006663624.1| PREDICTED: F-box/LRR-repeat protein 4-like [Oryza brachyantha]
Length=583

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 106/201 (53%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++KGC N+  L L  C LL+D  +    ++ + I  L++  C  +  A +  I     G
Sbjct  287  SIAKGCKNLTDLILNDCHLLTDRSLEFVARSCKKIARLKINGCQNMETAALEHIGRWCPG  346

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L+ L+   C  ++D AF +     C+ LRSL + +C+   D +L  +++ C NL  L++
Sbjct  347  LLE-LSLIYCPRIRDSAF-LEVGRGCSLLRSLYLVDCSRISDDALCYIAQGCKNLTELSI  404

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 + D  L+   ++C   L ++ L  C  V+D  +SAIA+  G +L+ LNL GC  +
Sbjct  405  RRGYEIGDKALISVAENCKL-LRELTLQFCERVSDAGLSAIAE--GCSLQKLNLCGCQLI  461

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD  L AIA  CS L  LDIS
Sbjct  462  TDNGLIAIARGCSDLFFLDIS  482


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 92/201 (46%), Gaps = 31/201 (15%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC N+ +L +R+   + D  ++S  +  + +  L L+ C R+S AG           
Sbjct  392  IAQGCKNLTELSIRRGYEIGDKALISVAENCKLLRELTLQFCERVSDAG-----------  440

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L A+A E C                 SL+ L++C C    D  L+ ++R C +L  L++S
Sbjct  441  LSAIA-EGC-----------------SLQKLNLCGCQLITDNGLIAIARGCSDLFFLDIS  482

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
             L  V D  L    +SC   L +V LS C  VTD  +  + +   + L+   +  C  V+
Sbjct  483  VLRLVGDTALAEIGESCPQ-LKEVALSHCPEVTDVGLGHLVRGCSQ-LQSCQMVYCRRVS  540

Query  545  DASLAAIADYCSVLRDLDISK  607
             + +A +   C  L+ + + +
Sbjct  541  SSGVATVVSSCPKLKKILVEE  561


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 82/184 (45%), Gaps = 31/184 (17%)
 Frame = +2

Query  53   TLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA  232
            T L+D G+ +  +  + +E L L  C  I+  G+  I             ENC       
Sbjct  98   TCLTDVGLTNLARGCKGLEKLSLVWCSSITSTGLVRI------------SENC-------  138

Query  233  FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS  412
                      +L SL +  C   GD  L+ +   C  L +LNL  + G TD GL+  +++
Sbjct  139  ---------KNLSSLDLQACY-IGDPGLIAIGEGCKLLRNLNLRFVEGTTDEGLIGLIKN  188

Query  413  CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD  592
            C   LV + ++ C  +TD ++ A+   +   LE+L+L     + +  + ++A  C +L+ 
Sbjct  189  CGQSLVSLGIATCAWMTDASLHAVGS-YCPNLEILSLES-DHIKNEGVVSVAKGCRLLKT  246

Query  593  LDIS  604
            L + 
Sbjct  247  LKLQ  250


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 99/223 (44%), Gaps = 29/223 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVK-AAESIESLQLEECHRISQAGVFGILVH--  172
            A+ +GC  ++ L LR     +D G++  +K   +S+ SL +  C  ++ A +  +  +  
Sbjct  158  AIGEGCKLLRNLNLRFVEGTTDEGLIGLIKNCGQSLVSLGIATCAWMTDASLHAVGSYCP  217

Query  173  ------------------SAGK----LKALAFENCFGMKDLAFGVPALPPCNSLRSLSIC  286
                              S  K    LK L  + C G  D A     +  C+ L SLS+ 
Sbjct  218  NLEILSLESDHIKNEGVVSVAKGCRLLKTLKLQ-CMGAGDEALDAIGVF-CSLLESLSLN  275

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
            N   F D SL  +++ C NL  L L+  + +TD  L    +SC   + ++ ++GC N+  
Sbjct  276  NFERFTDRSLSSIAKGCKNLTDLILNDCHLLTDRSLEFVARSCKK-IARLKINGCQNMET  334

Query  467  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL  595
              +  I +     LE L+L  C  + D++   +   CS+LR L
Sbjct  335  AALEHIGRWCPGLLE-LSLIYCPRIRDSAFLEVGRGCSLLRSL  376



>ref|XP_010547706.1| PREDICTED: F-box/LRR-repeat protein 2-like [Tarenaya hassleriana]
Length=406

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 96/190 (51%), Gaps = 2/190 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GC +++ L L  C  +SD  + S  ++   +E+L L+ C  I+  G+   LV    
Sbjct  145  AVAEGCRDLRTLHLAGCRFISDKLLKSLSESCRDLEALGLQGCSNITDLGLSD-LVKGCR  203

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K+K L    C  + D      A    +SL +L + +C   GD S++ L++ C NL  L +
Sbjct  204  KIKFLDINKCNNVGDAGVSGVAEACASSLTTLKLLDCYKVGDESILSLAKFCRNLQTLII  263

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G   ++D  + P   SC   L  + +  C+N+TD ++S I  +    LE L++  C  +
Sbjct  264  GGCRDISDKSIKPLAASCRDSLKNLRMDWCLNITDSSLSCIL-MQCINLEALDIGCCEEI  322

Query  542  TDASLAAIAD  571
            TDA+   + +
Sbjct  323  TDAAFQDLGN  332



>ref|XP_008870505.1| hypothetical protein H310_07015 [Aphanomyces invadans]
 ref|XP_008870506.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETW00370.1| hypothetical protein H310_07015 [Aphanomyces invadans]
 gb|ETW00371.1| hypothetical protein, variant [Aphanomyces invadans]
Length=2913

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 59/210 (28%), Positives = 95/210 (45%), Gaps = 14/210 (7%)
 Frame = +2

Query  2     AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
             A+SK CPN+K L + +C L++D+GVV+  K  +  E++    C RI+   +  +  H   
Sbjct  2464  AISKTCPNLKALTMDRCPLITDDGVVALEKCHDLREAV-FSHCARITDDSLLSLATHP--  2520

Query  182   KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             +L  L    C  + D    +  LP   +L SL I  C    D  ++ +   CP L  +NL
Sbjct  2521  RLARLELAFCLQLSDFV-SLSNLPASVTLTSLDISGCRRLTDDGIMAIGTRCPKLTCVNL  2579

Query  362   SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTI---------SAIAKLHGETLEL  514
             +  + +TD G+      C   L  +N+     +TDK           + +AK     LE 
Sbjct  2580  ACCDKLTDRGIWALTHHC-LDLAHLNVQDLHLLTDKVFTFDQEGDGRTVVAKTLLTKLET  2638

Query  515   LNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
             + L  C  +TD  +A +      LR +D S
Sbjct  2639  IVLADCKTLTDTGIAYLMHRARHLRSMDAS  2668


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 50/203 (25%), Positives = 87/203 (43%), Gaps = 18/203 (9%)
 Frame = +2

Query  26    VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGIL------VHSAGKL  187
             ++ + L  C  L+D G+   +  A  + S+    C  ++  G+  I         +   L
Sbjct  2636  LETIVLADCKTLTDTGIAYLMHRARHLRSMDASGCFHLTDQGLRCITSDIFNGTSTGEHL  2695

Query  188   KALAFENCFGMKDLAFGVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
             + L    C  +   + G+  +   C  L ++ +  C    DA ++ L + C  + +L L 
Sbjct  2696  RVLDLSYCMALT--SEGLHHIRERCKHLVTVYLTGCVLLQDAEVIELVKSCGKISNLGLG  2753

Query  365   GLNGVTDYGLLPFVQSC---DAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCG  535
                 +TD  +L  +  C   DA L+    + C  +TD  I AIA      L  LNL+ C 
Sbjct  2754  FCRELTD-DVLIAIADCLWLDALLI----NRCSKMTDVGICAIAS-QCTGLVALNLSSCK  2807

Query  536   CVTDASLAAIADYCSVLRDLDIS  604
              +T+ SL  + D C  L  LD++
Sbjct  2808  RITNVSLDTLFDNCPKLNQLDVT  2830



>ref|XP_002872053.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48312.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=405

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 95/189 (50%), Gaps = 2/189 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GC +++ L L  C  ++D  + S  +    +E+L L+ C  I+ +G    LV    
Sbjct  144  AVAEGCHDLRALHLAGCRFITDESLKSLSERCRDLEALGLQGCTNITDSG-LADLVKGCR  202

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K+K+L    C  + D      A    +SL++L + +C   G+ S++ L++ C NL  L +
Sbjct  203  KIKSLDINKCSNVGDAGVSSLAKACASSLKTLKLLDCYKVGNESILSLAQFCKNLETLII  262

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G   ++D  ++    SC   L  + +  C+N++D ++S I K     LE L++  C  V
Sbjct  263  GGCRDISDESIMLLADSCKDSLKNLRMDWCLNISDSSLSCILK-QCRNLEALDIGCCEEV  321

Query  542  TDASLAAIA  568
            TD +   + 
Sbjct  322  TDTAFRELG  330


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/191 (25%), Positives = 92/191 (48%), Gaps = 3/191 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +S+G   ++ L L  C  ++D G+ S  +    ++ L +  C ++S  G+  +       
Sbjct  93   ISEGFKCLRVLNLHNCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAV-AEGCHD  151

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L+AL    C  + D +    +   C  L +L +  CT   D+ L  L + C  +  L+++
Sbjct  152  LRALHLAGCRFITDESLKSLS-ERCRDLEALGLQGCTNITDSGLADLVKGCRKIKSLDIN  210

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
              + V D G+    ++C + L  + L  C  V +++I ++A+   + LE L + GC  ++
Sbjct  211  KCSNVGDAGVSSLAKACASSLKTLKLLDCYKVGNESILSLAQF-CKNLETLIIGGCRDIS  269

Query  545  DASLAAIADYC  577
            D S+  +AD C
Sbjct  270  DESIMLLADSC  280


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 87/182 (48%), Gaps = 7/182 (4%)
 Frame = +2

Query  11   KGCPNVKQLCLRKCTLLSDNGVVSFVKA-AESIESLQLEECHRISQAGVFGILVHSAGKL  187
            KGC  +K L + KC+ + D GV S  KA A S+++L+L +C+++    +   L      L
Sbjct  199  KGCRKIKSLDINKCSNVGDAGVSSLAKACASSLKTLKLLDCYKVGNESILS-LAQFCKNL  257

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
            + L    C  + D +  + A    +SL++L +  C    D+SL  + + C NL  L++  
Sbjct  258  ETLIIGGCRDISDESIMLLADSCKDSLKNLRMDWCLNISDSSLSCILKQCRNLEALDIGC  317

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE--TLELLNLNGCGCV  541
               VTD            GL  + +S C  +   T++ I K+  +  +LE L++     V
Sbjct  318  CEEVTDTAFRELGSDDVLGLKVLKVSNCTKI---TVTGIGKILDKCSSLEYLDVRSLPHV  374

Query  542  TD  547
            T+
Sbjct  375  TE  376


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 2/114 (2%)
 Frame = +2

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
            LR L++ NC G  D  L  + R    L  L++S    ++D GL    + C   L  ++L+
Sbjct  100  LRVLNLHNCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGC-HDLRALHLA  158

Query  446  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            GC  +TD+++ ++++     LE L L GC  +TD+ LA +   C  ++ LDI+K
Sbjct  159  GCRFITDESLKSLSE-RCRDLEALGLQGCTNITDSGLADLVKGCRKIKSLDINK  211



>ref|NP_741248.1| Protein C02F5.7, isoform b [Caenorhabditis elegans]
 sp|P34284.3|YKK7_CAEEL RecName: Full=Uncharacterized F-box/LRR-repeat protein C02F5.7 
[Caenorhabditis elegans]
 emb|CCD62633.1| C02F5.7, isoform b [Caenorhabditis elegans]
Length=466

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 110/224 (49%), Gaps = 28/224 (13%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +  GCPN+  L +  C  + D GV   +   +S+++L L  C  +++  VFG +    G 
Sbjct  196  IGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTE-NVFGSVEAHMGA  254

Query  185  LKALAFENCFGMKDL-----AFGVPALP-----PCN---------------SLRSLSICN  289
            +K L    CF + D+     A G  AL       CN               +L+ L +  
Sbjct  255  IKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSG  314

Query  290  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK  469
            CT  GD   + L+R C  L  L++   + ++D+ +     +C A L +++LS C  +TD+
Sbjct  315  CTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTA-LRELSLSHCELITDE  373

Query  470  TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            +I  +A  H ETL +L L+ C  +TD++L+ +  +C  L+ +D+
Sbjct  374  SIQNLASKHRETLNVLELDNCPQLTDSTLSHLR-HCKALKRIDL  416



>ref|NP_741249.1| Protein C02F5.7, isoform a [Caenorhabditis elegans]
 emb|CCD62632.1| C02F5.7, isoform a [Caenorhabditis elegans]
Length=461

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 110/224 (49%), Gaps = 28/224 (13%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +  GCPN+  L +  C  + D GV   +   +S+++L L  C  +++  VFG +    G 
Sbjct  196  IGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTE-NVFGSVEAHMGA  254

Query  185  LKALAFENCFGMKDL-----AFGVPALP-----PCN---------------SLRSLSICN  289
            +K L    CF + D+     A G  AL       CN               +L+ L +  
Sbjct  255  IKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSG  314

Query  290  CTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDK  469
            CT  GD   + L+R C  L  L++   + ++D+ +     +C A L +++LS C  +TD+
Sbjct  315  CTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTA-LRELSLSHCELITDE  373

Query  470  TISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDI  601
            +I  +A  H ETL +L L+ C  +TD++L+ +  +C  L+ +D+
Sbjct  374  SIQNLASKHRETLNVLELDNCPQLTDSTLSHLR-HCKALKRIDL  416



>ref|NP_567467.1| F-box/LRR-repeat protein 4 [Arabidopsis thaliana]
 sp|Q9C5D2.1|FBL4_ARATH RecName: Full=F-box/LRR-repeat protein 4; Short=AtFBL4 [Arabidopsis 
thaliana]
 gb|AAK26038.1|AF360328_1 putative F-box protein family, AtFBL4 [Arabidopsis thaliana]
 gb|AAK32821.1|AF361808_1 AT4g15470/dl3775w [Arabidopsis thaliana]
 gb|AAL07187.1| putative F-box protein family protein FBL4 [Arabidopsis thaliana]
 gb|AEE83608.1| F-box/LRR-repeat protein 4 [Arabidopsis thaliana]
Length=610

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 103/201 (51%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KG   +K L L  C  +S  G+ +     + +E +++  CH I   G+  I   S  
Sbjct  314  AIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERVEINGCHNIGTRGIEAI-GKSCP  372

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            +LK LA   C  + + A        C SL  L + +C+G GD ++  +++ C NL  L++
Sbjct  373  RLKELALLYCQRIGNSALQEIG-KGCKSLEILHLVDCSGIGDIAMCSIAKGCRNLKKLHI  431

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 + + G++   + C + L +++L  C  V +K + AI K  G +L+ LN++GC  +
Sbjct  432  RRCYEIGNKGIISIGKHCKS-LTELSLRFCDKVGNKALIAIGK--GCSLQQLNVSGCNQI  488

Query  542  TDASLAAIADYCSVLRDLDIS  604
            +DA + AIA  C  L  LDIS
Sbjct  489  SDAGITAIARGCPQLTHLDIS  509


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 93/202 (46%), Gaps = 31/202 (15%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++KGC N+K+L +R+C  + + G++S  K  +S+  L L  C ++    +  I     G
Sbjct  418  SIAKGCRNLKKLHIRRCYEIGNKGIISIGKHCKSLTELSLRFCDKVGNKALIAI-----G  472

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K        C                 SL+ L++  C    DA +  ++R CP L HL++
Sbjct  473  K-------GC-----------------SLQQLNVSGCNQISDAGITAIARGCPQLTHLDI  508

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            S L  + D  L    + C   L  + LS C ++TD  ++ + +   + LE  ++  C  +
Sbjct  509  SVLQNIGDMPLAELGEGCPM-LKDLVLSHCHHITDNGLNHLVQ-KCKLLETCHMVYCPGI  566

Query  542  TDASLAAIADYCSVLRDLDISK  607
            T A +A +   C  ++ + I K
Sbjct  567  TSAGVATVVSSCPHIKKVLIEK  588


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 77/182 (42%), Gaps = 31/182 (17%)
 Frame = +2

Query  59   LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG  238
            L+D G+ +       IE+L L  C  +S  G           L +LA             
Sbjct  127  LTDTGLTALANGFPRIENLSLIWCPNVSSVG-----------LCSLA-------------  162

Query  239  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD  418
                  C SL+SL +  C   GD  L  + + C  L  LNL    G+TD G++  V  C 
Sbjct  163  ----QKCTSLKSLDLQGCY-VGDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGCS  217

Query  419  AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD  598
              L  + ++    +TD ++ A+   H + LE+L L+    + D  L A+A  C  L++L 
Sbjct  218  KSLKSIGVAASAKITDLSLEAVGS-HCKLLEVLYLDS-EYIHDKGLIAVAQGCHRLKNLK  275

Query  599  IS  604
            + 
Sbjct  276  LQ  277



>ref|XP_009782053.1| PREDICTED: F-box/LRR-repeat protein 4 [Nicotiana sylvestris]
Length=630

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 102/206 (50%), Gaps = 15/206 (7%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC  +K L L  CT LSD G+ +      S+  L++  CH I   G+  I   S  
Sbjct  334  AIGKGCKQLKSLTLNDCTFLSDKGLEAVAVGCSSLTHLEVNGCHNIGTYGLESI-ARSCT  392

Query  182  KLKALAFENC-----FGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNL  346
             L  LA   C     F + ++  G      C  L++L + +C   GD ++  ++R C NL
Sbjct  393  HLSELALLYCQRIGNFALSEIGRG------CKFLQALHLVDCASIGDEAICSIARGCCNL  446

Query  347  VHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLN  526
              L++     V + G++   ++C   L  ++L  C  V D+ + AIA+  G +L  LN++
Sbjct  447  KRLHIRRCYEVGNKGIIAVGENCKF-LTDLSLRFCDRVGDEALVAIAE--GCSLHHLNVS  503

Query  527  GCGCVTDASLAAIADYCSVLRDLDIS  604
            GC  + DA + AIA  C  L  LD+S
Sbjct  504  GCHQIGDAGIIAIARGCPELSYLDVS  529


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/210 (22%), Positives = 92/210 (44%), Gaps = 23/210 (11%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            + +GC  ++ L L  C  + D  + S  +   +++ L +  C+ +   G+  +       
Sbjct  413  IGRGCKFLQALHLVDCASIGDEAICSIARGCCNLKRLHIRRCYEVGNKGIIAV-------  465

Query  185  LKALAFENCFGMKDLAF---------GVPALPPCNSLRSLSICNCTGFGDASLVVLSRLC  337
                  ENC  + DL+           + A+    SL  L++  C   GDA ++ ++R C
Sbjct  466  -----GENCKFLTDLSLRFCDRVGDEALVAIAEGCSLHHLNVSGCHQIGDAGIIAIARGC  520

Query  338  PNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELL  517
            P L +L++S L  + D  ++   + C   L  + LS C  +TD  +S +       LE  
Sbjct  521  PELSYLDVSVLQDLGDTAMVELGEGCPL-LRDIVLSHCRRITDVGLSHLVN-KCTLLETC  578

Query  518  NLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            ++  C  +T   +A +   C+ ++ + + K
Sbjct  579  HMVYCPGITAVGVATVITSCTNMKKVLVEK  608


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 31/182 (17%)
 Frame = +2

Query  59   LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG  238
            LSD G+ +       +E+L L  C  ++  G           L+++A             
Sbjct  147  LSDAGLTAVAAGFTKLENLSLVWCSNVTHVG-----------LRSIA-------------  182

Query  239  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD  418
                  C SL+SL +  C   GD  L  +      L  LNL    G+TD GL+  V  C 
Sbjct  183  ----ERCMSLKSLDLQGCY-VGDQGLAAVGEFSRQLEDLNLRFCEGLTDAGLIKLVAGCG  237

Query  419  AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD  598
              L  ++L+ C  VTD ++  +   H ++LE L+L+    + D  + A+A  C  L+ L 
Sbjct  238  KTLKSISLAACAKVTDTSLETVGS-HCKSLESLSLDS-EYIHDKGVLAVAQGCRQLKFLK  295

Query  599  IS  604
            + 
Sbjct  296  LQ  297



>gb|ABA95013.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
Length=630

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 105/201 (52%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++KGC N+  L L  C LL+D  +    ++ + +  L++  C  +  A +  I     G
Sbjct  334  SIAKGCKNLTDLILNDCHLLTDRSLEFVARSCKKLARLKINGCQNMETAALEHIGRWCPG  393

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L+ L+   C  ++D AF +     C+ LRSL + +C+   D +L  +++ C NL  L++
Sbjct  394  LLE-LSLIYCPRIQDSAF-LEVGRGCSLLRSLYLVDCSRISDDALCYIAQGCKNLTELSI  451

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 + D  L+ F ++C + L ++ L  C  V+D  ++AIA+  G  L  LNL GC  +
Sbjct  452  RRGYEIGDKALISFAENCKS-LRELTLQFCERVSDAGLTAIAE--GCPLRKLNLCGCQLI  508

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD  L AIA  C  L  LDIS
Sbjct  509  TDNGLTAIARGCPDLVYLDIS  529


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 73/154 (47%), Gaps = 30/154 (19%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC N+ +L +R+   + D  ++SF +  +S+  L L+ C R+S AG+  I       
Sbjct  439  IAQGCKNLTELSIRRGYEIGDKALISFAENCKSLRELTLQFCERVSDAGLTAI-------  491

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
                           A G P       LR L++C C    D  L  ++R CP+LV+L++S
Sbjct  492  ---------------AEGCP-------LRKLNLCGCQLITDNGLTAIARGCPDLVYLDIS  529

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
             L  + D  L    + C + L  + LS C  VTD
Sbjct  530  VLRSIGDMALAEIGEGC-SQLKDIALSHCPEVTD  562


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 99/223 (44%), Gaps = 29/223 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVK-AAESIESLQLEECHRISQAGVFGILVH--  172
            A+ +GC  ++ L LR     SD G++  +K   +S+ SL +  C  ++ A +  +  H  
Sbjct  205  AIGEGCKLLRNLNLRFVEGTSDEGLIGLIKNCGQSLVSLGVATCAWMTDASLHAVGSHCP  264

Query  173  ------------------SAGK----LKALAFENCFGMKDLAFGVPALPPCNSLRSLSIC  286
                              S  K    LK L  + C G  D A     L  C+ L SLS+ 
Sbjct  265  NLEFLSLESDHIKNEGVVSVAKGCRLLKTLKLQ-CMGAGDEALDAIGLF-CSFLESLSLN  322

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
            N   F D SL  +++ C NL  L L+  + +TD  L    +SC   L ++ ++GC N+  
Sbjct  323  NFEKFTDRSLSSIAKGCKNLTDLILNDCHLLTDRSLEFVARSCKK-LARLKINGCQNMET  381

Query  467  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL  595
              +  I +     LE L+L  C  + D++   +   CS+LR L
Sbjct  382  AALEHIGRWCPGLLE-LSLIYCPRIQDSAFLEVGRGCSLLRSL  423


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 81/184 (44%), Gaps = 31/184 (17%)
 Frame = +2

Query  53   TLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA  232
            T L+D G+ S  +  + +E L L  C  I+  G+  I             ENC       
Sbjct  145  TCLTDVGLTSLARGCKGLEKLSLVWCSSITSTGLVRI------------SENC-------  185

Query  233  FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS  412
                      +L SL +  C   GD  L+ +   C  L +LNL  + G +D GL+  +++
Sbjct  186  ---------KNLSSLDLQACY-IGDPGLIAIGEGCKLLRNLNLRFVEGTSDEGLIGLIKN  235

Query  413  CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD  592
            C   LV + ++ C  +TD ++ A+   H   LE L+L     + +  + ++A  C +L+ 
Sbjct  236  CGQSLVSLGVATCAWMTDASLHAVGS-HCPNLEFLSLES-DHIKNEGVVSVAKGCRLLKT  293

Query  593  LDIS  604
            L + 
Sbjct  294  LKLQ  297



>gb|EEE52434.1| hypothetical protein OsJ_34572 [Oryza sativa Japonica Group]
Length=630

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 105/201 (52%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            +++KGC N+  L L  C LL+D  +    ++ + +  L++  C  +  A +  I     G
Sbjct  334  SIAKGCKNLTDLILNDCHLLTDRSLEFVARSCKKLARLKINGCQNMETAALEHIGRWCPG  393

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L+ L+   C  ++D AF +     C+ LRSL + +C+   D +L  +++ C NL  L++
Sbjct  394  LLE-LSLIYCPRIQDSAF-LEVGRGCSLLRSLYLVDCSRISDDALCYIAQGCKNLTELSI  451

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 + D  L+ F ++C + L ++ L  C  V+D  ++AIA+  G  L  LNL GC  +
Sbjct  452  RRGYEIGDKALISFAENCKS-LRELTLQFCERVSDAGLTAIAE--GCPLRKLNLCGCQLI  508

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD  L AIA  C  L  LDIS
Sbjct  509  TDNGLTAIARGCPDLVYLDIS  529


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 73/154 (47%), Gaps = 30/154 (19%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +++GC N+ +L +R+   + D  ++SF +  +S+  L L+ C R+S AG+  I       
Sbjct  439  IAQGCKNLTELSIRRGYEIGDKALISFAENCKSLRELTLQFCERVSDAGLTAI-------  491

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
                           A G P       LR L++C C    D  L  ++R CP+LV+L++S
Sbjct  492  ---------------AEGCP-------LRKLNLCGCQLITDNGLTAIARGCPDLVYLDIS  529

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
             L  + D  L    + C + L  + LS C  VTD
Sbjct  530  VLRSIGDMALAEIGEGC-SQLKDIALSHCPEVTD  562


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/223 (28%), Positives = 99/223 (44%), Gaps = 29/223 (13%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVK-AAESIESLQLEECHRISQAGVFGILVH--  172
            A+ +GC  ++ L LR     SD G++  +K   +S+ SL +  C  ++ A +  +  H  
Sbjct  205  AIGEGCKLLRNLNLRFVEGTSDEGLIGLIKNCGQSLVSLGVATCAWMTDASLHAVGSHCP  264

Query  173  ------------------SAGK----LKALAFENCFGMKDLAFGVPALPPCNSLRSLSIC  286
                              S  K    LK L  + C G  D A     L  C+ L SLS+ 
Sbjct  265  NLEFLSLESDHIKNEGVVSVAKGCRLLKTLKLQ-CMGAGDEALDAIGLF-CSFLESLSLN  322

Query  287  NCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTD  466
            N   F D SL  +++ C NL  L L+  + +TD  L    +SC   L ++ ++GC N+  
Sbjct  323  NFEKFTDRSLSSIAKGCKNLTDLILNDCHLLTDRSLEFVARSCKK-LARLKINGCQNMET  381

Query  467  KTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL  595
              +  I +     LE L+L  C  + D++   +   CS+LR L
Sbjct  382  AALEHIGRWCPGLLE-LSLIYCPRIQDSAFLEVGRGCSLLRSL  423


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/184 (26%), Positives = 81/184 (44%), Gaps = 31/184 (17%)
 Frame = +2

Query  53   TLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLA  232
            T L+D G+ S  +  + +E L L  C  I+  G+  I             ENC       
Sbjct  145  TCLTDVGLTSLARGCKGLEKLSLVWCSSITSTGLVRI------------SENC-------  185

Query  233  FGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQS  412
                      +L SL +  C   GD  L+ +   C  L +LNL  + G +D GL+  +++
Sbjct  186  ---------KNLSSLDLQACY-IGDPGLIAIGEGCKLLRNLNLRFVEGTSDEGLIGLIKN  235

Query  413  CDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRD  592
            C   LV + ++ C  +TD ++ A+   H   LE L+L     + +  + ++A  C +L+ 
Sbjct  236  CGQSLVSLGVATCAWMTDASLHAVGS-HCPNLEFLSLES-DHIKNEGVVSVAKGCRLLKT  293

Query  593  LDIS  604
            L + 
Sbjct  294  LKLQ  297



>ref|XP_010424250.1| PREDICTED: F-box/LRR-repeat protein 2-like [Camelina sativa]
Length=366

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 96/185 (52%), Gaps = 2/185 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GC +++ L L  C  ++D  + S  +    +E+L L+ C  I+ +G    LV    
Sbjct  144  AVAEGCHDLRALHLAGCRFITDESLKSLSERCRELEALGLQGCANITDSG-LADLVKGCR  202

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K+K+L    C  + D      A    +SL++L + +C   G+ S++ L++ C NL  L +
Sbjct  203  KIKSLDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGNESILSLAQSCKNLETLII  262

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G   ++D  ++   +SC   L  + +  C+N++D ++S I K   + LE L++  C  +
Sbjct  263  GGCRDISDESIMLLAESCKDSLKNLRMDWCLNISDSSLSCILK-KCKNLEALDIGCCEEI  321

Query  542  TDASL  556
            TD + 
Sbjct  322  TDVAF  326


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 73/152 (48%), Gaps = 2/152 (1%)
 Frame = +2

Query  11   KGCPNVKQLCLRKCTLLSDNGVVSFVKA-AESIESLQLEECHRISQAGVFGILVHSAGKL  187
            KGC  +K L + KC+ + D GV S  KA A S+++L+L +C+++    +   L  S   L
Sbjct  199  KGCRKIKSLDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGNESILS-LAQSCKNL  257

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
            + L    C  + D +  + A    +SL++L +  C    D+SL  + + C NL  L++  
Sbjct  258  ETLIIGGCRDISDESIMLLAESCKDSLKNLRMDWCLNISDSSLSCILKKCKNLEALDIGC  317

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVT  463
               +TD            GL  + +S C  +T
Sbjct  318  CEEITDVAFRDLGSDDVLGLKVLKVSNCTKIT  349


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 86/199 (43%), Gaps = 29/199 (15%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +S G   ++ L L  C  ++D G+ S  +    ++ L +  C ++S  G           
Sbjct  93   ISDGFKCLRVLNLHNCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKG-----------  141

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L A+A                   C+ LR+L +  C    D SL  LS  C  L  L L 
Sbjct  142  LSAVA-----------------EGCHDLRALHLAGCRFITDESLKSLSERCRELEALGLQ  184

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            G   +TD GL   V+ C   +  ++++ C NV D  +S++AK    +L+ L L  C  V 
Sbjct  185  GCANITDSGLADLVKGC-RKIKSLDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVG  243

Query  545  DASLAAIADYCSVLRDLDI  601
            + S+ ++A  C  L  L I
Sbjct  244  NESILSLAQSCKNLETLII  262


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 63/114 (55%), Gaps = 2/114 (2%)
 Frame = +2

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
            LR L++ NC G  D  L  + R    L  L++S    ++D GL    + C   L  ++L+
Sbjct  100  LRVLNLHNCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGC-HDLRALHLA  158

Query  446  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            GC  +TD+++ ++++   E LE L L GC  +TD+ LA +   C  ++ LDI+K
Sbjct  159  GCRFITDESLKSLSERCRE-LEALGLQGCANITDSGLADLVKGCRKIKSLDINK  211



>gb|ESA18827.1| hypothetical protein GLOINDRAFT_40076 [Rhizophagus irregularis 
DAOM 181602]
Length=572

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 103/198 (52%), Gaps = 3/198 (2%)
 Frame = +2

Query  14   GCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKA  193
             C  +++L L  C  L+DNG++  +  A+ + +L + +   ++ A V  ++     +L+ 
Sbjct  121  SCERLERLTLGGCRRLTDNGLLKLLDKADGLVALDVSDIENLTDA-VVELVGERCRRLQG  179

Query  194  LAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLN  373
            L    C  + D      A   C SLR + + +C    D S+V+L++ CP+L+ L+L+  N
Sbjct  180  LNVSLCKKVSDKGILAVA-SKCRSLRRIKLSSCDIITDESVVILAKNCPHLLELDLTNCN  238

Query  374  GVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDAS  553
             +T+  + P  ++C   L ++ L+ C  +TD++ +       E L +L+L  C  +TD +
Sbjct  239  QITNDAIQPVFENC-TQLRELRLACCTKLTDESFTETMPALYEQLRILDLTSCALITDQT  297

Query  554  LAAIADYCSVLRDLDISK  607
            L  IA     LR+L ++K
Sbjct  298  LLKIAHSAPKLRNLVLAK  315


 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 94/201 (47%), Gaps = 5/201 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V + C  ++ L +  C  +SD G+++      S+  ++L  C  I+   V  IL  +   
Sbjct  170  VGERCRRLQGLNVSLCKKVSDKGILAVASKCRSLRRIKLSSCDIITDESVV-ILAKNCPH  228

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLV-VLSRLCPNLVHLNL  361
            L  L   NC  + + A   P    C  LR L +  CT   D S    +  L   L  L+L
Sbjct  229  LLELDLTNCNQITNDAIQ-PVFENCTQLRELRLACCTKLTDESFTETMPALYEQLRILDL  287

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
            +    +TD  LL    S    L  + L+ C N+TD+ +  I +L G+ L  L+L  C  +
Sbjct  288  TSCALITDQTLLKIAHSA-PKLRNLVLAKCGNITDEGVYHITRL-GKHLHYLHLGHCSRI  345

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD S+  +A +C+ LR LD++
Sbjct  346  TDHSITHLARHCTRLRYLDLA  366



>ref|XP_006419761.1| hypothetical protein CICLE_v100047052mg, partial [Citrus clementina]
 gb|ESR33001.1| hypothetical protein CICLE_v100047052mg, partial [Citrus clementina]
Length=519

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 104/201 (52%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGC  +K L L  C  LSD G+ +     + +  L++  CH I   G+  I   S  
Sbjct  223  AVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIGTMGLESI-GKSCR  281

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L  LA   C  + +LA  +     C SL++L + +C+  GD ++  ++  C NL  L++
Sbjct  282  NLTELALLYCQRIGNLAL-LEVGRGCKSLQALHLVDCSSIGDDAICGIAEGCQNLKKLHI  340

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 + + G++   + C++ L +++L  C  V D+ + +I +  G +L+ LN++GC  +
Sbjct  341  RRCYKIGNNGIVAVGEHCNS-LTELSLRFCDRVGDEALISIGQ--GCSLQHLNVSGCHQI  397

Query  542  TDASLAAIADYCSVLRDLDIS  604
             DA + AIA  C  L  LD+S
Sbjct  398  GDAGIMAIAKGCPELNYLDVS  418


 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/201 (25%), Positives = 100/201 (50%), Gaps = 5/201 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V +GC +++ L L  C+ + D+ +    +  ++++ L +  C++I   G+  +  H    
Sbjct  302  VGRGCKSLQALHLVDCSSIGDDAICGIAEGCQNLKKLHIRRCYKIGNNGIVAVGEH-CNS  360

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L  L+   C  + D A  +     C SL+ L++  C   GDA ++ +++ CP L +L++S
Sbjct  361  LTELSLRFCDRVGDEAL-ISIGQGC-SLQHLNVSGCHQIGDAGIMAIAKGCPELNYLDVS  418

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
             L  + D  ++   + C   L  V LS C  +TD  +S + K +   LE  ++  C  +T
Sbjct  419  VLQNLGDQAMVELGKGCPL-LKDVVLSHCRQITDVGLSHLVK-NCRMLESCHMVYCPGIT  476

Query  545  DASLAAIADYCSVLRDLDISK  607
             A +A +   C+ ++ + + K
Sbjct  477  AAGVATVVSGCANIKKVMVEK  497


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 92/200 (46%), Gaps = 6/200 (3%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ G P +++L L  C+ +S  G++S  +    ++SL L+ C+   Q      +     +
Sbjct  44   LADGFPKLEKLSLIWCSNISSLGLMSLAQKCLHLKSLDLQGCYVGDQG--LAAVGKVCNQ  101

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L+ L    C G+ D      A     SL+SL I  C    D SL  +   C +L  L+L 
Sbjct  102  LEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGSHCKSLETLSLD  161

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
                + + G+    Q C   L++V    CINVTD+ + A+      +LELL L      T
Sbjct  162  S-EFIHNKGVHAVAQGCP--LLRVLKLQCINVTDEALVAVGN-RCLSLELLALYSFQQFT  217

Query  545  DASLAAIADYCSVLRDLDIS  604
            D  L A+   C  L++L +S
Sbjct  218  DKGLHAVGKGCKKLKNLTLS  237



>ref|NP_197725.1| RNI-like superfamily protein [Arabidopsis thaliana]
 dbj|BAB11189.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL06927.1| AT5g23340/MKD15_20 [Arabidopsis thaliana]
 gb|AAM91352.1| At5g23340/MKD15_20 [Arabidopsis thaliana]
 dbj|BAE98436.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93153.1| RNI-like superfamily protein [Arabidopsis thaliana]
Length=405

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 95/185 (51%), Gaps = 2/185 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GC +++ L L  C  ++D  + S  +    +E+L L+ C  I+ +G+   LV    
Sbjct  144  AVAEGCHDLRALHLAGCRFITDESLKSLSERCRDLEALGLQGCTNITDSGL-ADLVKGCR  202

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            K+K+L    C  + D      A    +SL++L + +C   G+ S+  L++ C NL  L +
Sbjct  203  KIKSLDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGNESISSLAQFCKNLETLII  262

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G   ++D  ++    SC   L  + +  C+N++D ++S I K   + LE L++  C  V
Sbjct  263  GGCRDISDESIMLLADSCKDSLKNLRMDWCLNISDSSLSCILK-QCKNLEALDIGCCEEV  321

Query  542  TDASL  556
            TD + 
Sbjct  322  TDTAF  326


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 90/199 (45%), Gaps = 29/199 (15%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            +S+G   ++ L L  C  ++D G+ S  +    ++ L +  C ++S  G           
Sbjct  93   ISEGFKFLRVLNLHNCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKG-----------  141

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L A+A                   C+ LR+L +  C    D SL  LS  C +L  L L 
Sbjct  142  LSAVA-----------------EGCHDLRALHLAGCRFITDESLKSLSERCRDLEALGLQ  184

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
            G   +TD GL   V+ C   +  ++++ C NV D  +S++AK    +L+ L L  C  V 
Sbjct  185  GCTNITDSGLADLVKGC-RKIKSLDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVG  243

Query  545  DASLAAIADYCSVLRDLDI  601
            + S++++A +C  L  L I
Sbjct  244  NESISSLAQFCKNLETLII  262


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 87/182 (48%), Gaps = 7/182 (4%)
 Frame = +2

Query  11   KGCPNVKQLCLRKCTLLSDNGVVSFVKA-AESIESLQLEECHRISQAGVFGILVHSAGKL  187
            KGC  +K L + KC+ + D GV S  KA A S+++L+L +C+++    +   L      L
Sbjct  199  KGCRKIKSLDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGNESISS-LAQFCKNL  257

Query  188  KALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSG  367
            + L    C  + D +  + A    +SL++L +  C    D+SL  + + C NL  L++  
Sbjct  258  ETLIIGGCRDISDESIMLLADSCKDSLKNLRMDWCLNISDSSLSCILKQCKNLEALDIGC  317

Query  368  LNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGE--TLELLNLNGCGCV  541
               VTD            GL  + +S C  +   T++ I KL  +  +LE +++     V
Sbjct  318  CEEVTDTAFRDLGSDDVLGLKVLKVSNCTKI---TVTGIGKLLDKCSSLEYIDVRSLPHV  374

Query  542  TD  547
            T+
Sbjct  375  TE  376


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 62/114 (54%), Gaps = 2/114 (2%)
 Frame = +2

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
            LR L++ NC G  D  L  + R    L  L++S    ++D GL    + C   L  ++L+
Sbjct  100  LRVLNLHNCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKGLSAVAEGC-HDLRALHLA  158

Query  446  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDISK  607
            GC  +TD+++ ++++     LE L L GC  +TD+ LA +   C  ++ LDI+K
Sbjct  159  GCRFITDESLKSLSE-RCRDLEALGLQGCTNITDSGLADLVKGCRKIKSLDINK  211



>gb|EYE99357.1| hypothetical protein EURHEDRAFT_511604 [Aspergillus ruber CBS 
135680]
Length=1569

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 63/195 (32%), Positives = 99/195 (51%), Gaps = 7/195 (4%)
 Frame = +2

Query  26   VKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFE  205
            +K+L L   T +SD  VV F +    IE L L  C  +S  GV G LV     L+AL   
Sbjct  112  IKRLNLSALTDVSDGTVVPFAQC-NRIERLTLTNCSHLSDTGVSG-LVDGNRHLQALDVS  169

Query  206  NCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTD  385
            +   + D    + +   C  L+ L+I NC    D SL+ +S  C  +  L L+G+  +TD
Sbjct  170  DLTSLTDHTLHIVS-QNCPRLQGLNITNCAKVTDESLIAVSENCRQIRRLKLNGITQLTD  228

Query  386  YGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAI  565
              ++ F Q+C A +++V+L  C  VT ++I+A+      +L  L L  C  + D++  +I
Sbjct  229  QTVMSFAQNCRA-VLEVDLHNCRLVTSESITALINAL-RSLRELRLQDCKNIDDSAFLSI  286

Query  566  ADY--CSVLRDLDIS  604
             DY     LR LD++
Sbjct  287  PDYLMLDTLRVLDLT  301


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 54/216 (25%), Positives = 105/216 (49%), Gaps = 31/216 (14%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AVS+ C  +++L L   T L+D  V+SF +   ++  + L  C  ++   +   L+++  
Sbjct  207  AVSENCRQIRRLKLNGITQLTDQTVMSFAQNCRAVLEVDLHNCRLVTSESITA-LINALR  265

Query  182  KLKALAFENCFGMKDLAF-GVPA-----------LPPCN---------------SLRSLS  280
             L+ L  ++C  + D AF  +P            L  C+                LR+L 
Sbjct  266  SLRELRLQDCKNIDDSAFLSIPDYLMLDTLRVLDLTSCDLITDESVERIINAAPRLRNLV  325

Query  281  ICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINV  460
            +  C    D +++ + RL  NL +++L   + +TD+ ++  V+SC+  +  ++L+ C N+
Sbjct  326  LSKCRLISDRAVLSICRLGKNLHYVHLGHCSNITDFAVVHLVKSCNR-IRYIDLACCNNL  384

Query  461  TDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIA  568
            TD+++  +A L    L  + L  C  +TD SL A++
Sbjct  385  TDRSVQHLATL--PKLRRIGLVKCQSITDRSLFALS  418



>ref|XP_007245724.1| PREDICTED: F-box/LRR-repeat protein 2 [Astyanax mexicanus]
Length=432

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/210 (30%), Positives = 103/210 (49%), Gaps = 24/210 (11%)
 Frame = +2

Query  8    SKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKL  187
            ++ C N++QL L  CT ++D+  +S  K    + +L L  C  I+              L
Sbjct  109  AQNCRNIEQLNLNGCTKITDSTCISLSKFCSKLRNLDLTSCVSITNHA-----------L  157

Query  188  KALAFENCFGMKDLAF---------GVPALPP-CNSLRSLSICNCTGFGDASLVVLSRLC  337
            KAL+ E C  +++L           G+ AL   CN L++L +  CT   D +L  L + C
Sbjct  158  KALS-EGCRMLENLNLSWCDQITRDGIEALSRGCNGLKALFLRGCTQLDDTALKHLQKHC  216

Query  338  PNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELL  517
            P LV +N+     +TD G +   + C   L  V +SGC N+TD +++A+  L+ + L++L
Sbjct  217  PELVTINMQSCTQITDEGFVSLCRGCHK-LQMVCVSGCSNITDASLTALG-LNCQRLKIL  274

Query  518  NLNGCGCVTDASLAAIADYCSVLRDLDISK  607
                C  VTDA    +A  C  +  +D+ +
Sbjct  275  EAARCSHVTDAGFTVLARNCHEMEKMDLEE  304


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 92/202 (46%), Gaps = 6/202 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+S+GC  +K L LR CT L D  +    K    + ++ ++ C +I+  G F  L     
Sbjct  185  ALSRGCNGLKALFLRGCTQLDDTALKHLQKHCPELVTINMQSCTQITDEG-FVSLCRGCH  243

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            KL+ +    C  + D +     L  C  L+ L    C+   DA   VL+R C  +  ++L
Sbjct  244  KLQMVCVSGCSNITDASLTALGL-NCQRLKILEAARCSHVTDAGFTVLARNCHEMEKMDL  302

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAK--LHGETLELLNLNGCG  535
                 VTD  L+     C   L  ++LS C  +TD  I  ++      E L+++ L+ C 
Sbjct  303  EECILVTDNTLVQLSIHC-PRLQALSLSHCELITDDGIRHLSSSVCGQERLQVVELDNCP  361

Query  536  CVTDASLAAIADYCSVLRDLDI  601
             +TD +L  +   C  L  +++
Sbjct  362  LITDITLEHLKS-CQRLERIEL  382


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 62/110 (56%), Gaps = 2/110 (2%)
 Frame = +2

Query  266  LRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLS  445
            LR LS+  C   GDAS+   ++ C N+  LNL+G   +TD   +   + C + L  ++L+
Sbjct  89   LRQLSLRGCLSVGDASMKTFAQNCRNIEQLNLNGCTKITDSTCISLSKFC-SKLRNLDLT  147

Query  446  GCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDL  595
             C+++T+  + A+++     LE LNL+ C  +T   + A++  C+ L+ L
Sbjct  148  SCVSITNHALKALSE-GCRMLENLNLSWCDQITRDGIEALSRGCNGLKAL  196



>ref|XP_006489225.1| PREDICTED: F-box/LRR-repeat protein 4-like [Citrus sinensis]
Length=608

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 104/201 (52%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGC  +K L L  C  LSD G+ +     + +  L++  CH I   G+  I   S  
Sbjct  312  AVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIGTMGLESI-GKSCR  370

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
             L  LA   C  + +LA  +     C SL++L + +C+  GD ++  ++  C NL  L++
Sbjct  371  NLTELALLYCQRIGNLAL-LEVGRGCKSLQALHLVDCSSIGDDAICSIAEGCQNLKKLHI  429

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 + + G++   + C++ L +++L  C  V D+ + +I +  G +L+ LN++GC  +
Sbjct  430  RRCYKIGNNGIVAVGEHCNS-LTELSLRFCDRVGDEALISIGQ--GCSLQHLNVSGCHQI  486

Query  542  TDASLAAIADYCSVLRDLDIS  604
             DA + AIA  C  L  LD+S
Sbjct  487  GDAGIMAIAKGCPELNYLDVS  507


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 101/201 (50%), Gaps = 5/201 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V +GC +++ L L  C+ + D+ + S  +  ++++ L +  C++I   G+  +  H    
Sbjct  391  VGRGCKSLQALHLVDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEH-CNS  449

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L  L+   C  + D A  +     C SL+ L++  C   GDA ++ +++ CP L +L++S
Sbjct  450  LTELSLRFCDRVGDEAL-ISIGQGC-SLQHLNVSGCHQIGDAGIMAIAKGCPELNYLDVS  507

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
             L  + D  ++   + C   L  V LS C  +TD  +S + K +   LE  ++  C  +T
Sbjct  508  VLQNLGDQAMVELGKGCPL-LKDVVLSHCRQITDVGLSHLVK-NCRMLESCHMVYCPGIT  565

Query  545  DASLAAIADYCSVLRDLDISK  607
             A +A +   C+ ++ + + K
Sbjct  566  AAGVATVVSGCANIKKVMVEK  586


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 77/182 (42%), Gaps = 31/182 (17%)
 Frame = +2

Query  59   LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG  238
            LSD+G+ +       +E L L  C  IS  G+   L      LK+L  + C+        
Sbjct  125  LSDSGLNALADGFSKLEKLSLIWCSNISSLGLMS-LAQKCIHLKSLDLQGCY--------  175

Query  239  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD  418
                                 GD  L  + ++C  L  LNL    G+TD GL+     C 
Sbjct  176  --------------------VGDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCG  215

Query  419  AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD  598
              L  + ++ C+ +TD ++ A+   H ++LE L+L+    + +  + A+A  C +LR L 
Sbjct  216  KSLKSLGIAACVKITDVSLEAVGS-HCKSLETLSLDS-EFIHNKGVHAVAQGCPLLRVLK  273

Query  599  IS  604
            + 
Sbjct  274  LQ  275


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 92/201 (46%), Gaps = 6/201 (3%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A++ G   +++L L  C+ +S  G++S  +    ++SL L+ C+   Q      +     
Sbjct  132  ALADGFSKLEKLSLIWCSNISSLGLMSLAQKCIHLKSLDLQGCYVGDQG--LAAVGKVCN  189

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            +L+ L    C G+ D      A     SL+SL I  C    D SL  +   C +L  L+L
Sbjct  190  QLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEAVGSHCKSLETLSL  249

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 + + G+    Q C   L++V    CINVTD+ + A+      +LELL L      
Sbjct  250  DS-EFIHNKGVHAVAQGCP--LLRVLKLQCINVTDEALVAVGN-QCLSLELLALYSFQQF  305

Query  542  TDASLAAIADYCSVLRDLDIS  604
            TD  L A+   C  L++L +S
Sbjct  306  TDKGLHAVGKGCKKLKNLTLS  326



>ref|XP_006283360.1| hypothetical protein CARUB_v10004403mg [Capsella rubella]
 gb|EOA16258.1| hypothetical protein CARUB_v10004403mg [Capsella rubella]
Length=610

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 103/201 (51%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            A+ KGC  +K L L  C  ++  G+ +     + +  +++  CH I   GV  +   S  
Sbjct  314  AIGKGCKKLKNLTLSDCYFVTCKGLEAIANGCKELTRIEINGCHNIGTYGVEAV-GKSCP  372

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            +L  LA   C  + + A        C SL  L + +C+G GD ++  +++ C NL  L++
Sbjct  373  RLNELALLYCQRIGNSALQEIG-KGCKSLEILQLVDCSGIGDNAMCSIAKGCRNLKKLHI  431

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
                 + + G++   + C + L +++L  C  V D+ + AI K  G +L+ LN++GC  +
Sbjct  432  RRCYEIGNKGIIAIGKHCKS-LTELSLRFCDKVGDQALIAIGK--GCSLQQLNVSGCNHI  488

Query  542  TDASLAAIADYCSVLRDLDIS  604
            +DA ++AIA  C  L  LDIS
Sbjct  489  SDAGISAIAKGCPQLTHLDIS  509


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 54/201 (27%), Positives = 95/201 (47%), Gaps = 5/201 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            + KGC +++ L L  C+ + DN + S  K   +++ L +  C+ I   G+  I  H    
Sbjct  393  IGKGCKSLEILQLVDCSGIGDNAMCSIAKGCRNLKKLHIRRCYEIGNKGIIAIGKHCKS-  451

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L  L+   C  + D A    A+    SL+ L++  C    DA +  +++ CP L HL++S
Sbjct  452  LTELSLRFCDKVGDQAL--IAIGKGCSLQQLNVSGCNHISDAGISAIAKGCPQLTHLDIS  509

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
             L  + D  L+   + C   L  V LS C N+TD  ++ + +     LE  ++  C  +T
Sbjct  510  VLQNIGDMPLVELGEGCPM-LKDVVLSHCHNITDSGLNHLVQ-KCTLLESCHMVYCPGIT  567

Query  545  DASLAAIADYCSVLRDLDISK  607
               +A +   C  ++ + I K
Sbjct  568  SVGVATVVSSCPHIKKVLIEK  588


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 57/199 (29%), Positives = 91/199 (46%), Gaps = 7/199 (4%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKA-AESIESLQLEECHRISQAGVFGILVHSA  178
            AV K C  +++L LR C  L+D GV+  V   A+S++S+ +   ++I+   +  +  H  
Sbjct  185  AVGKFCKQLEELNLRFCEGLTDIGVIDLVVGCAKSLKSIGVAASNKITDLSLEAVGSHC-  243

Query  179  GKLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLN  358
             KL  + F +   + D    +     CN L+ L +  C G  D +   +  LC +L  L 
Sbjct  244  -KLLEVLFLDSEYIHDKGL-IAVAQGCNRLKDLKL-QCVGVTDKAFGAVGDLCTSLERLA  300

Query  359  LSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGC  538
            L      TD G+    + C   L  + LS C  VT K + AIA    E L  + +NGC  
Sbjct  301  LYSFQHFTDKGMRAIGKGCKK-LKNLTLSDCYFVTCKGLEAIANGCKE-LTRIEINGCHN  358

Query  539  VTDASLAAIADYCSVLRDL  595
            +    + A+   C  L +L
Sbjct  359  IGTYGVEAVGKSCPRLNEL  377


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 79/182 (43%), Gaps = 31/182 (17%)
 Frame = +2

Query  59   LSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGKLKALAFENCFGMKDLAFG  238
            L+D G+ +       IE+L L  C  +S AG           L +LA             
Sbjct  127  LTDVGLTALANGFPRIENLSLIWCPNVSSAG-----------LHSLA-------------  162

Query  239  VPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCD  418
                  C SLRSL +  C   GD  L  + + C  L  LNL    G+TD G++  V  C 
Sbjct  163  ----EKCTSLRSLDLQGCF-VGDKGLAAVGKFCKQLEELNLRFCEGLTDIGVIDLVVGCA  217

Query  419  AGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLD  598
              L  + ++    +TD ++ A+   H + LE+L L+    + D  L A+A  C+ L+DL 
Sbjct  218  KSLKSIGVAASNKITDLSLEAVGS-HCKLLEVLFLDS-EYIHDKGLIAVAQGCNRLKDLK  275

Query  599  IS  604
            + 
Sbjct  276  LQ  277



>gb|KDO74919.1| hypothetical protein CISIN_1g007312mg [Citrus sinensis]
Length=448

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 105/205 (51%), Gaps = 13/205 (6%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV KGC  +K L L  C  LSD G+ +     + +  L++  CH I   G     + S G
Sbjct  152  AVGKGCKKLKNLTLSDCYFLSDMGLEAIATGCKELTHLEINGCHNIGTMG-----LESIG  206

Query  182  K----LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLV  349
            K    L  LA   C  + +LA  +     C SL++L + +C+  GD ++  ++  C NL 
Sbjct  207  KFCRNLTELALLYCQRIGNLAL-LEVGRGCKSLQALHLVDCSSIGDDAICSIAEGCQNLK  265

Query  350  HLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNG  529
             L++     + + G++   + C++ L +++L  C  V D+ + +I +  G +L+ LN++G
Sbjct  266  KLHIRRCYKIGNNGIVAVGEHCNS-LTELSLRFCDRVGDEALISIGQ--GCSLQHLNVSG  322

Query  530  CGCVTDASLAAIADYCSVLRDLDIS  604
            C  + DA + AIA  C  L  LD+S
Sbjct  323  CHQIGDAGIMAIAKGCPELNYLDVS  347


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 101/201 (50%), Gaps = 5/201 (2%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            V +GC +++ L L  C+ + D+ + S  +  ++++ L +  C++I   G+  +  H    
Sbjct  231  VGRGCKSLQALHLVDCSSIGDDAICSIAEGCQNLKKLHIRRCYKIGNNGIVAVGEH-CNS  289

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L  L+   C  + D A  +     C SL+ L++  C   GDA ++ +++ CP L +L++S
Sbjct  290  LTELSLRFCDRVGDEAL-ISIGQGC-SLQHLNVSGCHQIGDAGIMAIAKGCPELNYLDVS  347

Query  365  GLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVT  544
             L  + D  ++   + C   L  V LS C  +TD  +S + K +   LE  ++  C  +T
Sbjct  348  VLQNLGDQAMVELGKGCPL-LKDVVLSHCRQITDVGLSHLVK-NCRMLESCHMVYCPGIT  405

Query  545  DASLAAIADYCSVLRDLDISK  607
             A +A +   C+ ++ + + K
Sbjct  406  AAGVATVVSGCANIKKVMVEK  426


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +2

Query  302  GDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISA  481
            GD  L  + ++C  L  LNL    G+TD GL+     C   L  + ++ C+ +TD ++ A
Sbjct  17   GDQGLAAVGKVCNQLEDLNLRFCEGLTDTGLVDLAHGCGKSLKSLGIAACVKITDVSLEA  76

Query  482  IAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLRDLDIS  604
            +   H ++LE L+L+    + +  + A+A  C +LR L + 
Sbjct  77   VGS-HCKSLETLSLDS-EFIHNKGVHAVAQGCPLLRVLKLQ  115



>ref|XP_006359273.1| PREDICTED: F-box/LRR-repeat protein 2-like [Solanum tuberosum]
Length=418

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 95/189 (50%), Gaps = 2/189 (1%)
 Frame = +2

Query  2    AVSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAG  181
            AV++GC +++ L L  C  +SD+ + +  K    +E L L+ C  I+ +G   +LV    
Sbjct  156  AVAEGCHDLRTLHLAGCRFVSDSLMKALSKNCHYVEELGLQGCTNITNSG-LSVLVEGCR  214

Query  182  KLKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNL  361
            ++K L    C  + D+     +     +LR+L + +C   GD S++ L+  C NL  L +
Sbjct  215  RIKYLDINKCSNIGDIGITSVSEACSLTLRTLKLLDCYKVGDDSILSLANYCKNLETLVI  274

Query  362  SGLNGVTDYGLLPFVQSCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCV  541
             G   ++D  +     SC   L K+ +  C+N+TD ++  I     E LE+L++  C  +
Sbjct  275  GGCRNISDEPMKSLAASCSNSLRKLRMDWCLNITDSSLDCIISKCRE-LEVLDIGCCEEL  333

Query  542  TDASLAAIA  568
            TDA+   + 
Sbjct  334  TDAAFQQLG  342



>ref|XP_008619596.1| hypothetical protein SDRG_15207 [Saprolegnia diclina VS20]
 gb|EQC26994.1| hypothetical protein SDRG_15207 [Saprolegnia diclina VS20]
Length=470

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 108/231 (47%), Gaps = 40/231 (17%)
 Frame = +2

Query  5    VSKGCPNVKQLCLRKCTLLSDNGVVSFVKAAESIESLQLEECHRISQAGVFGILVHSAGK  184
            ++ GCPN++ + +  C+ + D+G+ +  +   S++ L +  C R++ AG F  L H    
Sbjct  161  IATGCPNLELVDIAGCSRIGDDGIAALARHCRSLQELDVSMCIRVTDAG-FVALAHRPPT  219

Query  185  LKALAFENCFGMKDLAFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLS  364
            L+ LA   C  + + +  +  +     L+SLS+ NC    D  L  L    P L  L LS
Sbjct  220  LRRLAANKCLKITEASLAL-VVHAQTQLQSLSVGNCPKVRDLFLATLRPETP-LTSLVLS  277

Query  365  GLNGVTDYGLLP---------FVQSCDAGLVKVNLSG-----------------------  448
            G   ++D  L+P         F QS  A L  ++L+G                       
Sbjct  278  GCASISDAPLIPTAPRGCLSSFFQSHGARLQTLDLTGLGQLTSETLQRISLCPTLTHLTL  337

Query  449  --CINVTDKTISAIAKLHG-ETLELLNLNGCGCVTDASLAAIADYCSVLRD  592
              C NVTD  ++ IA+  G   L+ L+L+GC  VTD +L +IA +C  LRD
Sbjct  338  AMCRNVTDADVAVIAE--GCPQLQGLSLHGCVLVTDTALVSIATHCKHLRD  386


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 67/124 (54%), Gaps = 3/124 (2%)
 Frame = +2

Query  230  AFGVPALPPCNSLRSLSICNCTGFGDASLVVLSRLCPNLVHLNLSGLNGVTDYGLLPFVQ  409
            A G   L  C+SL  L + NC    DA LV+++  CPNL  ++++G + + D G+    +
Sbjct  131  AAGFSILAQCHSLLQLRL-NCIKLSDAELVLIATGCPNLELVDIAGCSRIGDDGIAALAR  189

Query  410  SCDAGLVKVNLSGCINVTDKTISAIAKLHGETLELLNLNGCGCVTDASLAAIADYCSVLR  589
             C + L ++++S CI VTD    A+A     TL  L  N C  +T+ASLA +    + L+
Sbjct  190  HCRS-LQELDVSMCIRVTDAGFVALAH-RPPTLRRLAANKCLKITEASLALVVHAQTQLQ  247

Query  590  DLDI  601
             L +
Sbjct  248  SLSV  251



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660